>>1KYO:HELIX  132 132 SER N  172  ILE N  203  1                                  32    
SNPTIQRFFALHYLVPFIIAAMVIMHLMALHI
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 132 132 SER N 172 ILE N 203 1 32 ATOM 24656 N SER N 172 36.046 -35.068 38.128 1.00 37.51 N ATOM 24657 CA SER N 172 35.399 -36.055 39.001 1.00 37.51 C ATOM 24658 C SER N 172 34.618 -35.354 40.109 1.00 35.98 C ATOM 24659 O SER N 172 34.347 -34.149 40.010 1.00 34.80 O ATOM 24660 CB SER N 172 36.423 -37.014 39.622 1.00 40.14 C ATOM 24661 OG SER N 172 37.322 -36.326 40.484 1.00 46.42 O ATOM 24662 N ASN N 173 34.321 -36.082 41.190 1.00 34.21 N ATOM 24663 CA ASN N 173 33.542 -35.515 42.292 1.00 32.26 C ATOM 24664 C ASN N 173 33.951 -34.120 42.769 1.00 31.14 C ATOM 24665 O ASN N 173 33.106 -33.225 42.855 1.00 31.46 O ATOM 24666 CB ASN N 173 33.466 -36.470 43.478 1.00 31.35 C ATOM 24667 CG ASN N 173 32.302 -36.143 44.407 1.00 31.59 C ATOM 24668 OD1 ASN N 173 32.430 -36.176 45.627 1.00 32.25 O ATOM 24669 ND2 ASN N 173 31.158 -35.826 43.824 1.00 31.32 N ATOM 24670 N PRO N 174 35.248 -33.907 43.053 1.00 29.13 N ATOM 24671 CA PRO N 174 35.750 -32.609 43.518 1.00 28.05 C ATOM 24672 C PRO N 174 35.350 -31.462 42.595 1.00 28.58 C ATOM 24673 O PRO N 174 35.004 -30.368 43.059 1.00 29.77 O ATOM 24674 CB PRO N 174 37.261 -32.803 43.469 1.00 27.59 C ATOM 24675 CG PRO N 174 37.429 -34.247 43.746 1.00 28.77 C ATOM 24676 CD PRO N 174 36.353 -34.874 42.919 1.00 28.23 C ATOM 24677 N THR N 175 35.405 -31.738 41.292 1.00 26.88 N ATOM 24678 CA THR N 175 35.095 -30.776 40.244 1.00 25.99 C ATOM 24679 C THR N 175 33.628 -30.331 40.277 1.00 27.33 C ATOM 24680 O THR N 175 33.338 -29.129 40.337 1.00 26.90 O ATOM 24681 CB THR N 175 35.407 -31.375 38.857 1.00 25.57 C ATOM 24682 OG1 THR N 175 36.351 -32.445 38.995 1.00 25.41 O ATOM 24683 CG2 THR N 175 36.003 -30.318 37.945 1.00 25.80 C ATOM 24684 N ILE N 176 32.714 -31.304 40.264 1.00 26.44 N ATOM 24685 CA ILE N 176 31.279 -31.037 40.284 1.00 24.76 C ATOM 24686 C ILE N 176 30.784 -30.389 41.577 1.00 27.12 C ATOM 24687 O ILE N 176 29.849 -29.574 41.546 1.00 29.77 O ATOM 24688 CB ILE N 176 30.477 -32.316 40.050 1.00 22.02 C ATOM 24689 CG1 ILE N 176 30.964 -33.000 38.780 1.00 20.67 C ATOM 24690 CG2 ILE N 176 29.000 -31.990 39.945 1.00 20.73 C ATOM 24691 CD1 ILE N 176 30.978 -32.091 37.574 1.00 21.26 C ATOM 24692 N GLN N 177 31.381 -30.761 42.708 1.00 26.77 N ATOM 24693 CA GLN N 177 30.980 -30.191 43.990 1.00 26.16 C ATOM 24694 C GLN N 177 31.449 -28.756 44.216 1.00 26.02 C ATOM 24695 O GLN N 177 30.756 -27.978 44.890 1.00 26.90 O ATOM 24696 CB GLN N 177 31.425 -31.070 45.150 1.00 26.87 C ATOM 24697 CG GLN N 177 30.596 -32.322 45.331 1.00 26.89 C ATOM 24698 CD GLN N 177 30.843 -32.950 46.674 1.00 27.03 C ATOM 24699 OE1 GLN N 177 31.963 -32.939 47.163 1.00 27.53 O ATOM 24700 NE2 GLN N 177 29.792 -33.471 47.298 1.00 27.50 N ATOM 24701 N ARG N 178 32.626 -28.407 43.691 1.00 24.49 N ATOM 24702 CA ARG N 178 33.134 -27.035 43.833 1.00 23.55 C ATOM 24703 C ARG N 178 32.465 -26.180 42.769 1.00 23.39 C ATOM 24704 O ARG N 178 32.366 -24.961 42.907 1.00 24.53 O ATOM 24705 CB ARG N 178 34.653 -26.968 43.658 1.00 23.07 C ATOM 24706 CG ARG N 178 35.122 -27.028 42.215 1.00 26.07 C ATOM 24707 CD ARG N 178 36.636 -27.069 42.106 1.00 27.85 C ATOM 24708 NE ARG N 178 37.186 -28.190 42.868 1.00 28.99 N ATOM 24709 CZ ARG N 178 38.413 -28.232 43.374 1.00 27.34 C ATOM 24710 NH1 ARG N 178 38.793 -29.289 44.071 1.00 29.86 N ATOM 24711 NH2 ARG N 178 39.268 -27.241 43.163 1.00 24.01 N ATOM 24712 N PHE N 179 32.045 -26.828 41.685 1.00 22.81 N ATOM 24713 CA PHE N 179 31.379 -26.125 40.607 1.00 22.38 C ATOM 24714 C PHE N 179 29.978 -25.710 41.045 1.00 21.81 C ATOM 24715 O PHE N 179 29.513 -24.631 40.676 1.00 24.51 O ATOM 24716 CB PHE N 179 31.364 -26.953 39.306 1.00 22.60 C ATOM 24717 CG PHE N 179 32.641 -26.834 38.475 1.00 21.94 C ATOM 24718 CD1 PHE N 179 33.634 -25.918 38.805 1.00 22.44 C ATOM 24719 CD2 PHE N 179 32.842 -27.646 37.361 1.00 22.11 C ATOM 24720 CE1 PHE N 179 34.796 -25.818 38.040 1.00 22.25 C ATOM 24721 CE2 PHE N 179 34.000 -27.553 36.594 1.00 19.54 C ATOM 24722 CZ PHE N 179 34.973 -26.640 36.934 1.00 21.28 C ATOM 24723 N PHE N 180 29.301 -26.533 41.840 1.00 20.34 N ATOM 24724 CA PHE N 180 27.977 -26.122 42.312 1.00 21.10 C ATOM 24725 C PHE N 180 28.202 -24.936 43.248 1.00 20.91 C ATOM 24726 O PHE N 180 27.570 -23.883 43.115 1.00 20.04 O ATOM 24727 CB PHE N 180 27.270 -27.244 43.082 1.00 20.64 C ATOM 24728 CG PHE N 180 26.003 -26.799 43.790 1.00 19.32 C ATOM 24729 CD1 PHE N 180 25.849 -26.997 45.157 1.00 19.16 C ATOM 24730 CD2 PHE N 180 24.953 -26.225 43.082 1.00 19.06 C ATOM 24731 CE1 PHE N 180 24.667 -26.637 45.809 1.00 20.55 C ATOM 24732 CE2 PHE N 180 23.771 -25.863 43.723 1.00 18.72 C ATOM 24733 CZ PHE N 180 23.627 -26.072 45.090 1.00 20.02 C ATOM 24734 N ALA N 181 29.151 -25.118 44.165 1.00 21.43 N ATOM 24735 CA ALA N 181 29.511 -24.108 45.151 1.00 20.79 C ATOM 24736 C ALA N 181 29.690 -22.745 44.498 1.00 19.23 C ATOM 24737 O ALA N 181 29.131 -21.752 44.956 1.00 17.76 O ATOM 24738 CB ALA N 181 30.785 -24.528 45.872 1.00 20.72 C ATOM 24739 N LEU N 182 30.439 -22.730 43.399 1.00 17.79 N ATOM 24740 CA LEU N 182 30.710 -21.518 42.653 1.00 16.75 C ATOM 24741 C LEU N 182 29.522 -21.058 41.838 1.00 17.51 C ATOM 24742 O LEU N 182 29.338 -19.863 41.633 1.00 19.79 O ATOM 24743 CB LEU N 182 31.913 -21.725 41.750 1.00 15.59 C ATOM 24744 CG LEU N 182 33.285 -21.274 42.260 1.00 15.36 C ATOM 24745 CD1 LEU N 182 33.332 -21.110 43.766 1.00 13.37 C ATOM 24746 CD2 LEU N 182 34.301 -22.283 41.785 1.00 15.07 C ATOM 24747 N HIS N 183 28.701 -21.992 41.378 1.00 17.17 N ATOM 24748 CA HIS N 183 27.532 -21.608 40.599 1.00 16.67 C ATOM 24749 C HIS N 183 26.550 -20.833 41.480 1.00 16.63 C ATOM 24750 O HIS N 183 25.748 -20.030 40.998 1.00 18.86 O ATOM 24751 CB HIS N 183 26.843 -22.833 40.005 1.00 16.22 C ATOM 24752 CG HIS N 183 25.632 -22.501 39.186 1.00 16.71 C ATOM 24753 ND1 HIS N 183 25.638 -21.614 38.133 1.00 15.10 N ATOM 24754 CD2 HIS N 183 24.351 -22.943 39.288 1.00 15.89 C ATOM 24755 CE1 HIS N 183 24.394 -21.548 37.641 1.00 16.03 C ATOM 24756 NE2 HIS N 183 23.571 -22.335 38.305 1.00 15.32 N ATOM 24757 N TYR N 184 26.634 -21.065 42.779 1.00 14.87 N ATOM 24758 CA TYR N 184 25.759 -20.408 43.728 1.00 14.23 C ATOM 24759 C TYR N 184 26.310 -19.014 44.018 1.00 15.07 C ATOM 24760 O TYR N 184 25.563 -18.048 44.061 1.00 17.26 O ATOM 24761 CB TYR N 184 25.738 -21.242 45.009 1.00 14.21 C ATOM 24762 CG TYR N 184 24.548 -21.081 45.941 1.00 13.08 C ATOM 24763 CD1 TYR N 184 24.019 -22.194 46.602 1.00 11.03 C ATOM 24764 CD2 TYR N 184 23.994 -19.835 46.210 1.00 11.78 C ATOM 24765 CE1 TYR N 184 22.988 -22.073 47.500 1.00 11.71 C ATOM 24766 CE2 TYR N 184 22.950 -19.700 47.117 1.00 13.26 C ATOM 24767 CZ TYR N 184 22.455 -20.822 47.759 1.00 13.27 C ATOM 24768 OH TYR N 184 21.437 -20.693 48.674 1.00 14.64 O ATOM 24769 N LEU N 185 27.631 -18.916 44.139 1.00 15.76 N ATOM 24770 CA LEU N 185 28.332 -17.672 44.473 1.00 14.81 C ATOM 24771 C LEU N 185 28.332 -16.544 43.428 1.00 15.60 C ATOM 24772 O LEU N 185 27.980 -15.397 43.755 1.00 16.78 O ATOM 24773 CB LEU N 185 29.780 -18.011 44.879 1.00 13.88 C ATOM 24774 CG LEU N 185 30.667 -17.032 45.667 1.00 14.16 C ATOM 24775 CD1 LEU N 185 31.800 -16.462 44.832 1.00 8.03 C ATOM 24776 CD2 LEU N 185 29.802 -15.941 46.278 1.00 13.91 C ATOM 24777 N VAL N 186 28.717 -16.857 42.184 1.00 14.10 N ATOM 24778 CA VAL N 186 28.793 -15.839 41.131 1.00 12.11 C ATOM 24779 C VAL N 186 27.531 -14.986 40.940 1.00 13.38 C ATOM 24780 O VAL N 186 27.629 -13.767 40.864 1.00 12.86 O ATOM 24781 CB VAL N 186 29.240 -16.427 39.789 1.00 10.13 C ATOM 24782 CG1 VAL N 186 29.753 -15.327 38.894 1.00 8.88 C ATOM 24783 CG2 VAL N 186 30.321 -17.445 39.995 1.00 7.85 C ATOM 24784 N PRO N 187 26.332 -15.605 40.918 1.00 14.00 N ATOM 24785 CA PRO N 187 25.096 -14.837 40.741 1.00 14.34 C ATOM 24786 C PRO N 187 25.039 -13.637 41.644 1.00 14.38 C ATOM 24787 O PRO N 187 24.669 -12.536 41.204 1.00 13.87 O ATOM 24788 CB PRO N 187 24.013 -15.847 41.093 1.00 14.46 C ATOM 24789 CG PRO N 187 24.575 -17.108 40.525 1.00 15.39 C ATOM 24790 CD PRO N 187 26.031 -17.048 40.988 1.00 15.61 C ATOM 24791 N PHE N 188 25.443 -13.837 42.897 1.00 15.27 N ATOM 24792 CA PHE N 188 25.444 -12.732 43.856 1.00 16.83 C ATOM 24793 C PHE N 188 26.488 -11.680 43.466 1.00 16.44 C ATOM 24794 O PHE N 188 26.301 -10.486 43.701 1.00 16.13 O ATOM 24795 CB PHE N 188 25.605 -13.243 45.291 1.00 16.99 C ATOM 24796 CG PHE N 188 24.432 -14.050 45.763 1.00 17.99 C ATOM 24797 CD1 PHE N 188 24.506 -15.430 45.841 1.00 16.71 C ATOM 24798 CD2 PHE N 188 23.217 -13.427 46.050 1.00 19.25 C ATOM 24799 CE1 PHE N 188 23.380 -16.177 46.189 1.00 18.57 C ATOM 24800 CE2 PHE N 188 22.082 -14.167 46.402 1.00 17.76 C ATOM 24801 CZ PHE N 188 22.163 -15.539 46.468 1.00 18.81 C ATOM 24802 N ILE N 189 27.554 -12.104 42.800 1.00 16.12 N ATOM 24803 CA ILE N 189 28.540 -11.128 42.359 1.00 15.97 C ATOM 24804 C ILE N 189 27.956 -10.352 41.191 1.00 16.60 C ATOM 24805 O ILE N 189 28.072 -9.132 41.150 1.00 17.95 O ATOM 24806 CB ILE N 189 29.859 -11.771 41.945 1.00 14.04 C ATOM 24807 CG1 ILE N 189 30.512 -12.406 43.173 1.00 11.49 C ATOM 24808 CG2 ILE N 189 30.762 -10.725 41.292 1.00 7.53 C ATOM 24809 CD1 ILE N 189 31.804 -13.053 42.852 1.00 13.24 C ATOM 24810 N ILE N 190 27.313 -11.068 40.263 1.00 17.19 N ATOM 24811 CA ILE N 190 26.675 -10.459 39.083 1.00 17.35 C ATOM 24812 C ILE N 190 25.731 -9.369 39.588 1.00 17.76 C ATOM 24813 O ILE N 190 25.743 -8.227 39.101 1.00 16.50 O ATOM 24814 CB ILE N 190 25.844 -11.511 38.261 1.00 16.06 C ATOM 24815 CG1 ILE N 190 26.782 -12.515 37.577 1.00 16.68 C ATOM 24816 CG2 ILE N 190 24.947 -10.817 37.236 1.00 13.10 C ATOM 24817 CD1 ILE N 190 26.084 -13.558 36.711 1.00 17.60 C ATOM 24818 N ALA N 191 24.958 -9.731 40.611 1.00 17.32 N ATOM 24819 CA ALA N 191 24.010 -8.820 41.227 1.00 18.49 C ATOM 24820 C ALA N 191 24.731 -7.537 41.663 1.00 19.95 C ATOM 24821 O ALA N 191 24.270 -6.432 41.384 1.00 20.33 O ATOM 24822 CB ALA N 191 23.346 -9.499 42.413 1.00 15.94 C ATOM 24823 N ALA N 192 25.884 -7.695 42.315 1.00 21.03 N ATOM 24824 CA ALA N 192 26.690 -6.558 42.772 1.00 19.47 C ATOM 24825 C ALA N 192 27.144 -5.752 41.557 1.00 19.60 C ATOM 24826 O ALA N 192 27.025 -4.522 41.531 1.00 18.57 O ATOM 24827 CB ALA N 192 27.884 -7.057 43.523 1.00 17.85 C ATOM 24828 N MET N 193 27.653 -6.474 40.556 1.00 19.01 N ATOM 24829 CA MET N 193 28.114 -5.898 39.307 1.00 17.77 C ATOM 24830 C MET N 193 27.009 -5.118 38.625 1.00 17.23 C ATOM 24831 O MET N 193 27.281 -4.168 37.886 1.00 16.70 O ATOM 24832 CB MET N 193 28.608 -6.999 38.380 1.00 18.28 C ATOM 24833 CG MET N 193 30.053 -7.359 38.605 1.00 22.16 C ATOM 24834 SD MET N 193 31.111 -5.915 38.442 1.00 26.32 S ATOM 24835 CE MET N 193 31.321 -5.500 40.148 1.00 26.14 C ATOM 24836 N VAL N 194 25.764 -5.540 38.852 1.00 16.09 N ATOM 24837 CA VAL N 194 24.610 -4.861 38.265 1.00 15.74 C ATOM 24838 C VAL N 194 24.391 -3.498 38.927 1.00 16.53 C ATOM 24839 O VAL N 194 24.280 -2.489 38.233 1.00 18.25 O ATOM 24840 CB VAL N 194 23.326 -5.752 38.285 1.00 13.72 C ATOM 24841 CG1 VAL N 194 22.061 -4.900 38.278 1.00 8.35 C ATOM 24842 CG2 VAL N 194 23.328 -6.673 37.068 1.00 10.88 C ATOM 24843 N ILE N 195 24.443 -3.449 40.254 1.00 16.61 N ATOM 24844 CA ILE N 195 24.267 -2.190 40.964 1.00 16.38 C ATOM 24845 C ILE N 195 25.302 -1.165 40.532 1.00 17.41 C ATOM 24846 O ILE N 195 25.037 0.022 40.579 1.00 19.62 O ATOM 24847 CB ILE N 195 24.366 -2.366 42.468 1.00 15.15 C ATOM 24848 CG1 ILE N 195 23.344 -3.407 42.915 1.00 16.18 C ATOM 24849 CG2 ILE N 195 24.091 -1.043 43.165 1.00 13.23 C ATOM 24850 CD1 ILE N 195 23.522 -3.860 44.331 1.00 17.23 C ATOM 24851 N MET N 196 26.473 -1.612 40.094 1.00 18.26 N ATOM 24852 CA MET N 196 27.503 -0.674 39.637 1.00 19.50 C ATOM 24853 C MET N 196 27.133 -0.178 38.238 1.00 19.23 C ATOM 24854 O MET N 196 27.355 0.989 37.881 1.00 18.27 O ATOM 24855 CB MET N 196 28.869 -1.351 39.607 1.00 20.96 C ATOM 24856 CG MET N 196 29.241 -2.029 40.899 1.00 23.84 C ATOM 24857 SD MET N 196 30.956 -2.539 40.886 1.00 28.68 S ATOM 24858 CE MET N 196 31.748 -0.985 41.239 1.00 26.67 C ATOM 24859 N HIS N 197 26.570 -1.096 37.455 1.00 18.60 N ATOM 24860 CA HIS N 197 26.117 -0.814 36.103 1.00 18.17 C ATOM 24861 C HIS N 197 25.037 0.252 36.258 1.00 18.95 C ATOM 24862 O HIS N 197 24.982 1.219 35.502 1.00 19.66 O ATOM 24863 CB HIS N 197 25.526 -2.087 35.500 1.00 16.98 C ATOM 24864 CG HIS N 197 25.161 -1.972 34.050 1.00 17.07 C ATOM 24865 ND1 HIS N 197 26.067 -1.723 33.042 1.00 15.85 N ATOM 24866 CD2 HIS N 197 23.963 -2.159 33.434 1.00 14.46 C ATOM 24867 CE1 HIS N 197 25.406 -1.783 31.880 1.00 15.97 C ATOM 24868 NE2 HIS N 197 24.124 -2.043 32.066 1.00 15.05 N ATOM 24869 N LEU N 198 24.214 0.103 37.285 1.00 17.56 N ATOM 24870 CA LEU N 198 23.172 1.068 37.522 1.00 18.39 C ATOM 24871 C LEU N 198 23.715 2.401 37.989 1.00 21.34 C ATOM 24872 O LEU N 198 23.235 3.430 37.525 1.00 25.30 O ATOM 24873 CB LEU N 198 22.143 0.543 38.507 1.00 16.23 C ATOM 24874 CG LEU N 198 21.226 -0.534 37.948 1.00 15.37 C ATOM 24875 CD1 LEU N 198 19.948 -0.441 38.734 1.00 14.03 C ATOM 24876 CD2 LEU N 198 20.950 -0.347 36.452 1.00 10.56 C ATOM 24877 N MET N 199 24.691 2.402 38.904 1.00 22.16 N ATOM 24878 CA MET N 199 25.285 3.655 39.401 1.00 21.92 C ATOM 24879 C MET N 199 25.910 4.442 38.250 1.00 23.34 C ATOM 24880 O MET N 199 25.813 5.669 38.195 1.00 23.04 O ATOM 24881 CB MET N 199 26.365 3.372 40.429 1.00 21.32 C ATOM 24882 CG MET N 199 25.861 2.902 41.766 1.00 22.96 C ATOM 24883 SD MET N 199 27.217 2.220 42.770 1.00 25.57 S ATOM 24884 CE MET N 199 28.094 3.734 43.276 1.00 24.48 C ATOM 24885 N ALA N 200 26.563 3.720 37.341 1.00 24.08 N ATOM 24886 CA ALA N 200 27.201 4.323 36.172 1.00 25.42 C ATOM 24887 C ALA N 200 26.148 4.845 35.195 1.00 26.15 C ATOM 24888 O ALA N 200 26.397 5.765 34.415 1.00 27.98 O ATOM 24889 CB ALA N 200 28.101 3.299 35.487 1.00 23.62 C ATOM 24890 N LEU N 201 24.981 4.214 35.201 1.00 26.40 N ATOM 24891 CA LEU N 201 23.899 4.630 34.325 1.00 25.51 C ATOM 24892 C LEU N 201 23.333 5.918 34.889 1.00 26.70 C ATOM 24893 O LEU N 201 23.319 6.946 34.224 1.00 29.30 O ATOM 24894 CB LEU N 201 22.796 3.565 34.284 1.00 19.26 C ATOM 24895 CG LEU N 201 21.531 3.933 33.526 1.00 12.25 C ATOM 24896 CD1 LEU N 201 21.894 4.087 32.111 1.00 12.00 C ATOM 24897 CD2 LEU N 201 20.490 2.886 33.661 1.00 6.81 C ATOM 24898 N HIS N 202 23.001 5.864 36.170 1.00 27.62 N ATOM 24899 CA HIS N 202 22.384 6.958 36.888 1.00 30.36 C ATOM 24900 C HIS N 202 23.008 8.355 36.870 1.00 30.63 C ATOM 24901 O HIS N 202 22.295 9.328 37.109 1.00 31.89 O ATOM 24902 CB HIS N 202 22.111 6.525 38.326 1.00 33.56 C ATOM 24903 CG HIS N 202 21.204 7.449 39.071 1.00 38.02 C ATOM 24904 ND1 HIS N 202 19.843 7.491 38.850 1.00 39.68 N ATOM 24905 CD2 HIS N 202 21.461 8.373 40.029 1.00 40.48 C ATOM 24906 CE1 HIS N 202 19.302 8.401 39.642 1.00 42.49 C ATOM 24907 NE2 HIS N 202 20.261 8.951 40.368 1.00 42.22 N ATOM 24908 N ILE N 203 24.305 8.488 36.591 1.00 30.40 N ATOM 24909 CA ILE N 203 24.904 9.829 36.591 1.00 29.87 C ATOM 24910 C ILE N 203 24.710 10.578 35.292 1.00 30.81 C ATOM 24911 O ILE N 203 24.718 11.799 35.290 1.00 32.00 O ATOM 24912 CB ILE N 203 26.402 9.847 36.976 1.00 29.41 C ATOM 24913 CG1 ILE N 203 27.257 9.265 35.861 1.00 29.61 C ATOM 24914 CG2 ILE N 203 26.625 9.091 38.277 1.00 29.95 C ATOM 24915 CD1 ILE N 203 28.708 9.174 36.223 1.00 31.18 C