>>1L0N:HELIX   51  51 ASP C  171  GLU C  202  1                                  32    
DKATLTRFFAFHFILPFIIMAIAMVHLLFLHE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 51 51 ASP C 171 GLU C 202 1 32 ATOM 7969 N ASP C 171 80.525 62.528 178.434 1.00 48.34 N ATOM 7970 CA ASP C 171 80.596 63.574 179.463 1.00 47.84 C ATOM 7971 C ASP C 171 80.399 65.016 178.984 1.00 47.78 C ATOM 7972 O ASP C 171 79.435 65.313 178.288 1.00 48.28 O ATOM 7973 CB ASP C 171 81.880 63.445 180.270 1.00 47.58 C ATOM 7974 CG ASP C 171 81.744 63.997 181.661 1.00 48.96 C ATOM 7975 OD1 ASP C 171 80.615 64.394 182.031 1.00 47.70 O ATOM 7976 OD2 ASP C 171 82.708 64.092 182.453 1.00 53.97 O ATOM 7977 N LYS C 172 81.304 65.909 179.398 1.00 47.09 N ATOM 7978 CA LYS C 172 81.207 67.320 179.067 1.00 46.66 C ATOM 7979 C LYS C 172 81.650 67.579 177.671 1.00 46.37 C ATOM 7980 O LYS C 172 80.993 68.298 176.934 1.00 46.43 O ATOM 7981 CB LYS C 172 82.061 68.159 180.016 1.00 46.65 C ATOM 7982 CG LYS C 172 81.585 68.160 181.445 1.00 53.32 C ATOM 7983 CD LYS C 172 82.418 69.092 182.314 1.00 50.21 C ATOM 7984 CE LYS C 172 81.820 69.191 183.697 1.00 54.15 C ATOM 7985 NZ LYS C 172 82.496 70.228 184.526 1.00 60.00 N ATOM 7986 N ALA C 173 82.794 67.009 177.320 1.00 46.05 N ATOM 7987 CA ALA C 173 83.376 67.183 176.012 1.00 45.76 C ATOM 7988 C ALA C 173 82.415 66.761 174.922 1.00 45.72 C ATOM 7989 O ALA C 173 82.271 67.467 173.919 1.00 45.87 O ATOM 7990 CB ALA C 173 84.663 66.419 175.906 1.00 45.80 C ATOM 7991 N THR C 174 81.702 65.653 175.154 1.00 45.17 N ATOM 7992 CA THR C 174 80.741 65.123 174.180 1.00 44.65 C ATOM 7993 C THR C 174 79.551 66.045 173.841 1.00 44.48 C ATOM 7994 O THR C 174 79.177 66.149 172.690 1.00 44.66 O ATOM 7995 CB THR C 174 80.224 63.755 174.611 1.00 44.61 C ATOM 7996 OG1 THR C 174 81.290 62.987 175.166 1.00 48.40 O ATOM 7997 CG2 THR C 174 79.811 62.944 173.398 1.00 47.98 C ATOM 7998 N LEU C 175 78.946 66.690 174.839 1.00 44.29 N ATOM 7999 CA LEU C 175 77.811 67.588 174.553 1.00 43.96 C ATOM 8000 C LEU C 175 78.184 68.785 173.691 1.00 44.02 C ATOM 8001 O LEU C 175 77.532 69.034 172.675 1.00 44.17 O ATOM 8002 CB LEU C 175 77.126 68.068 175.817 1.00 43.61 C ATOM 8003 CG LEU C 175 75.637 67.730 175.850 1.00 46.17 C ATOM 8004 CD1 LEU C 175 74.918 68.464 176.959 1.00 49.56 C ATOM 8005 CD2 LEU C 175 74.967 67.999 174.538 1.00 42.01 C ATOM 8006 N THR C 176 79.219 69.527 174.107 1.00 43.77 N ATOM 8007 CA THR C 176 79.667 70.707 173.381 1.00 44.01 C ATOM 8008 C THR C 176 80.103 70.271 171.987 1.00 43.47 C ATOM 8009 O THR C 176 79.791 70.912 170.990 1.00 43.34 O ATOM 8010 CB THR C 176 80.841 71.366 174.111 1.00 44.64 C ATOM 8011 OG1 THR C 176 81.994 70.518 174.025 1.00 58.85 O ATOM 8012 CG2 THR C 176 80.575 71.422 175.604 1.00 49.17 C ATOM 8013 N ARG C 177 80.800 69.148 171.946 1.00 42.86 N ATOM 8014 CA ARG C 177 81.269 68.564 170.722 1.00 41.90 C ATOM 8015 C ARG C 177 80.089 68.313 169.847 1.00 40.95 C ATOM 8016 O ARG C 177 79.960 68.934 168.813 1.00 40.87 O ATOM 8017 CB ARG C 177 81.939 67.263 171.046 1.00 42.12 C ATOM 8018 CG ARG C 177 82.482 66.541 169.935 1.00 49.59 C ATOM 8019 CD ARG C 177 83.407 65.484 170.373 1.00 44.91 C ATOM 8020 NE ARG C 177 84.404 66.014 171.293 1.00 38.88 N ATOM 8021 CZ ARG C 177 85.576 65.460 171.476 1.00 40.84 C ATOM 8022 NH1 ARG C 177 85.879 64.351 170.800 1.00 43.66 N ATOM 8023 NH2 ARG C 177 86.447 65.987 172.338 1.00 24.97 N ATOM 8024 N PHE C 178 79.181 67.446 170.291 1.00 40.64 N ATOM 8025 CA PHE C 178 77.975 67.157 169.508 1.00 41.24 C ATOM 8026 C PHE C 178 77.220 68.431 169.067 1.00 42.08 C ATOM 8027 O PHE C 178 76.646 68.445 167.995 1.00 42.79 O ATOM 8028 CB PHE C 178 77.009 66.192 170.220 1.00 41.08 C ATOM 8029 CG PHE C 178 77.337 64.707 170.035 1.00 34.88 C ATOM 8030 CD1 PHE C 178 76.349 63.742 170.253 1.00 38.07 C ATOM 8031 CD2 PHE C 178 78.617 64.280 169.701 1.00 32.40 C ATOM 8032 CE1 PHE C 178 76.627 62.382 170.120 1.00 37.17 C ATOM 8033 CE2 PHE C 178 78.907 62.918 169.563 1.00 31.87 C ATOM 8034 CZ PHE C 178 77.909 61.969 169.770 1.00 36.59 C ATOM 8035 N PHE C 179 77.261 69.504 169.872 1.00 42.06 N ATOM 8036 CA PHE C 179 76.593 70.752 169.477 1.00 41.67 C ATOM 8037 C PHE C 179 77.217 71.331 168.234 1.00 41.56 C ATOM 8038 O PHE C 179 76.523 71.590 167.243 1.00 41.76 O ATOM 8039 CB PHE C 179 76.644 71.804 170.572 1.00 41.11 C ATOM 8040 CG PHE C 179 75.778 73.010 170.288 1.00 33.60 C ATOM 8041 CD1 PHE C 179 76.200 74.273 170.613 1.00 39.57 C ATOM 8042 CD2 PHE C 179 74.522 72.858 169.710 1.00 39.82 C ATOM 8043 CE1 PHE C 179 75.393 75.379 170.360 1.00 41.72 C ATOM 8044 CE2 PHE C 179 73.725 73.942 169.453 1.00 38.00 C ATOM 8045 CZ PHE C 179 74.160 75.209 169.782 1.00 40.03 C ATOM 8046 N ALA C 180 78.530 71.526 168.292 1.00 41.15 N ATOM 8047 CA ALA C 180 79.283 72.097 167.188 1.00 40.94 C ATOM 8048 C ALA C 180 78.992 71.373 165.860 1.00 40.77 C ATOM 8049 O ALA C 180 78.610 72.004 164.888 1.00 40.16 O ATOM 8050 CB ALA C 180 80.793 72.113 167.510 1.00 40.79 C ATOM 8051 N PHE C 181 79.078 70.046 165.859 1.00 41.39 N ATOM 8052 CA PHE C 181 78.778 69.290 164.634 1.00 42.00 C ATOM 8053 C PHE C 181 77.318 69.394 164.212 1.00 42.64 C ATOM 8054 O PHE C 181 77.028 69.355 163.022 1.00 43.17 O ATOM 8055 CB PHE C 181 79.186 67.827 164.738 1.00 41.83 C ATOM 8056 CG PHE C 181 80.604 67.632 165.017 1.00 33.21 C ATOM 8057 CD1 PHE C 181 81.559 68.148 164.166 1.00 34.64 C ATOM 8058 CD2 PHE C 181 81.005 66.951 166.151 1.00 29.92 C ATOM 8059 CE1 PHE C 181 82.904 68.002 164.441 1.00 36.60 C ATOM 8060 CE2 PHE C 181 82.339 66.787 166.436 1.00 34.83 C ATOM 8061 CZ PHE C 181 83.300 67.321 165.581 1.00 41.08 C ATOM 8062 N HIS C 182 76.399 69.529 165.183 1.00 42.45 N ATOM 8063 CA HIS C 182 74.977 69.668 164.859 1.00 42.70 C ATOM 8064 C HIS C 182 74.700 71.018 164.250 1.00 44.15 C ATOM 8065 O HIS C 182 73.658 71.215 163.619 1.00 44.66 O ATOM 8066 CB HIS C 182 74.148 69.538 166.072 1.00 42.34 C ATOM 8067 CG HIS C 182 72.683 69.502 165.805 1.00 38.73 C ATOM 8068 ND1 HIS C 182 72.051 68.375 165.341 1.00 41.47 N ATOM 8069 CD2 HIS C 182 71.708 70.427 165.998 1.00 36.22 C ATOM 8070 CE1 HIS C 182 70.754 68.603 165.246 1.00 30.16 C ATOM 8071 NE2 HIS C 182 70.513 69.833 165.656 1.00 28.50 N ATOM 8072 N PHE C 183 75.606 71.975 164.461 1.00 44.67 N ATOM 8073 CA PHE C 183 75.420 73.282 163.880 1.00 45.53 C ATOM 8074 C PHE C 183 75.998 73.261 162.463 1.00 46.21 C ATOM 8075 O PHE C 183 75.351 73.698 161.523 1.00 46.81 O ATOM 8076 CB PHE C 183 76.117 74.367 164.731 1.00 45.79 C ATOM 8077 CG PHE C 183 75.459 75.754 164.648 1.00 49.22 C ATOM 8078 CD1 PHE C 183 75.143 76.334 163.426 1.00 49.06 C ATOM 8079 CD2 PHE C 183 75.182 76.470 165.803 1.00 45.37 C ATOM 8080 CE1 PHE C 183 74.552 77.616 163.368 1.00 48.11 C ATOM 8081 CE2 PHE C 183 74.589 77.735 165.742 1.00 43.68 C ATOM 8082 CZ PHE C 183 74.282 78.301 164.521 1.00 44.50 C ATOM 8083 N ILE C 184 77.195 72.695 162.317 1.00 45.99 N ATOM 8084 CA ILE C 184 77.902 72.695 161.041 1.00 45.79 C ATOM 8085 C ILE C 184 77.315 71.743 159.992 1.00 46.81 C ATOM 8086 O ILE C 184 77.357 72.038 158.782 1.00 47.64 O ATOM 8087 CB ILE C 184 79.406 72.416 161.271 1.00 45.34 C ATOM 8088 CG1 ILE C 184 80.182 72.532 159.999 1.00 36.28 C ATOM 8089 CG2 ILE C 184 79.617 71.056 161.792 1.00 44.87 C ATOM 8090 CD1 ILE C 184 80.148 73.772 159.468 1.00 32.81 C ATOM 8091 N LEU C 185 76.716 70.635 160.432 1.00 46.43 N ATOM 8092 CA LEU C 185 76.203 69.671 159.483 1.00 45.97 C ATOM 8093 C LEU C 185 75.147 70.058 158.430 1.00 45.66 C ATOM 8094 O LEU C 185 75.353 69.771 157.252 1.00 46.06 O ATOM 8095 CB LEU C 185 76.039 68.275 160.061 1.00 46.20 C ATOM 8096 CG LEU C 185 77.293 67.406 159.949 1.00 49.86 C ATOM 8097 CD1 LEU C 185 76.984 66.013 160.352 1.00 50.31 C ATOM 8098 CD2 LEU C 185 77.792 67.416 158.524 1.00 57.41 C ATOM 8099 N PRO C 186 74.046 70.720 158.818 1.00 45.04 N ATOM 8100 CA PRO C 186 73.030 71.138 157.835 1.00 44.70 C ATOM 8101 C PRO C 186 73.550 72.120 156.738 1.00 44.94 C ATOM 8102 O PRO C 186 72.965 72.159 155.657 1.00 45.58 O ATOM 8103 CB PRO C 186 71.951 71.786 158.696 1.00 44.14 C ATOM 8104 CG PRO C 186 72.140 71.171 160.000 1.00 38.07 C ATOM 8105 CD PRO C 186 73.633 71.060 160.187 1.00 44.96 C ATOM 8106 N PHE C 187 74.608 72.882 156.996 1.00 44.06 N ATOM 8107 CA PHE C 187 75.119 73.729 155.936 1.00 43.68 C ATOM 8108 C PHE C 187 75.835 72.859 154.934 1.00 43.93 C ATOM 8109 O PHE C 187 75.616 72.985 153.717 1.00 43.94 O ATOM 8110 CB PHE C 187 75.975 74.870 156.472 1.00 43.26 C ATOM 8111 CG PHE C 187 75.281 75.658 157.509 1.00 47.68 C ATOM 8112 CD1 PHE C 187 75.790 75.746 158.802 1.00 51.05 C ATOM 8113 CD2 PHE C 187 74.037 76.195 157.248 1.00 45.71 C ATOM 8114 CE1 PHE C 187 75.084 76.400 159.785 1.00 46.60 C ATOM 8115 CE2 PHE C 187 73.331 76.839 158.227 1.00 49.54 C ATOM 8116 CZ PHE C 187 73.845 76.929 159.501 1.00 44.39 C ATOM 8117 N ILE C 188 76.634 71.919 155.431 1.00 43.96 N ATOM 8118 CA ILE C 188 77.287 70.987 154.539 1.00 44.02 C ATOM 8119 C ILE C 188 76.205 70.260 153.755 1.00 44.30 C ATOM 8120 O ILE C 188 76.242 70.267 152.504 1.00 44.44 O ATOM 8121 CB ILE C 188 78.204 70.034 155.288 1.00 44.04 C ATOM 8122 CG1 ILE C 188 79.524 70.769 155.627 1.00 43.88 C ATOM 8123 CG2 ILE C 188 78.514 68.818 154.418 1.00 35.24 C ATOM 8124 CD1 ILE C 188 80.038 70.530 157.016 1.00 34.76 C ATOM 8125 N ILE C 189 75.168 69.746 154.468 1.00 44.08 N ATOM 8126 CA ILE C 189 74.009 69.079 153.798 1.00 43.84 C ATOM 8127 C ILE C 189 73.517 69.943 152.638 1.00 44.46 C ATOM 8128 O ILE C 189 73.256 69.436 151.548 1.00 45.11 O ATOM 8129 CB ILE C 189 72.810 68.886 154.766 1.00 43.21 C ATOM 8130 CG1 ILE C 189 73.115 67.885 155.822 1.00 32.15 C ATOM 8131 CG2 ILE C 189 71.587 68.403 154.021 1.00 22.32 C ATOM 8132 CD1 ILE C 189 71.982 67.685 156.757 1.00 35.60 C ATOM 8133 N MET C 190 73.403 71.251 152.866 1.00 44.28 N ATOM 8134 CA MET C 190 72.918 72.120 151.816 1.00 44.26 C ATOM 8135 C MET C 190 73.810 72.093 150.618 1.00 43.86 C ATOM 8136 O MET C 190 73.369 71.684 149.553 1.00 44.67 O ATOM 8137 CB MET C 190 72.652 73.534 152.288 1.00 44.36 C ATOM 8138 CG MET C 190 71.331 74.085 151.751 1.00 44.75 C ATOM 8139 SD MET C 190 70.651 75.346 152.882 1.00 61.75 S ATOM 8140 CE MET C 190 71.686 76.680 152.539 1.00 29.07 C ATOM 8141 N ALA C 191 75.080 72.436 150.774 1.00 42.76 N ATOM 8142 CA ALA C 191 75.980 72.375 149.608 1.00 41.95 C ATOM 8143 C ALA C 191 75.761 71.023 148.859 1.00 42.36 C ATOM 8144 O ALA C 191 75.597 71.007 147.660 1.00 42.91 O ATOM 8145 CB ALA C 191 77.456 72.538 150.015 1.00 40.53 C ATOM 8146 N ILE C 192 75.666 69.927 149.597 1.00 41.97 N ATOM 8147 CA ILE C 192 75.509 68.645 148.980 1.00 42.48 C ATOM 8148 C ILE C 192 74.189 68.527 148.217 1.00 43.55 C ATOM 8149 O ILE C 192 74.173 67.988 147.118 1.00 44.22 O ATOM 8150 CB ILE C 192 75.720 67.501 150.013 1.00 42.49 C ATOM 8151 CG1 ILE C 192 77.170 67.493 150.488 1.00 41.59 C ATOM 8152 CG2 ILE C 192 75.459 66.185 149.399 1.00 39.32 C ATOM 8153 CD1 ILE C 192 77.459 66.459 151.597 1.00 42.26 C ATOM 8154 N ALA C 193 73.103 69.105 148.754 1.00 43.95 N ATOM 8155 CA ALA C 193 71.788 69.086 148.060 1.00 44.51 C ATOM 8156 C ALA C 193 71.869 69.909 146.753 1.00 45.18 C ATOM 8157 O ALA C 193 71.168 69.626 145.769 1.00 45.90 O ATOM 8158 CB ALA C 193 70.716 69.622 148.935 1.00 44.49 C ATOM 8159 N MET C 194 72.716 70.924 146.745 1.00 44.63 N ATOM 8160 CA MET C 194 72.902 71.688 145.540 1.00 44.74 C ATOM 8161 C MET C 194 73.539 70.767 144.496 1.00 45.13 C ATOM 8162 O MET C 194 73.038 70.655 143.393 1.00 45.86 O ATOM 8163 CB MET C 194 73.737 72.938 145.808 1.00 44.58 C ATOM 8164 CG MET C 194 73.115 73.833 146.884 1.00 40.99 C ATOM 8165 SD MET C 194 73.957 75.311 147.067 1.00 70.42 S ATOM 8166 CE MET C 194 72.913 76.161 148.250 1.00 69.46 C ATOM 8167 N VAL C 195 74.571 70.025 144.888 1.00 44.63 N ATOM 8168 CA VAL C 195 75.225 69.087 143.987 1.00 44.55 C ATOM 8169 C VAL C 195 74.208 67.955 143.591 1.00 46.10 C ATOM 8170 O VAL C 195 74.203 67.450 142.438 1.00 46.72 O ATOM 8171 CB VAL C 195 76.501 68.506 144.634 1.00 43.98 C ATOM 8172 CG1 VAL C 195 77.205 67.590 143.694 1.00 40.38 C ATOM 8173 CG2 VAL C 195 77.467 69.652 145.062 1.00 40.69 C ATOM 8174 N HIS C 196 73.332 67.598 144.527 1.00 46.26 N ATOM 8175 CA HIS C 196 72.295 66.608 144.259 1.00 46.74 C ATOM 8176 C HIS C 196 71.482 67.161 143.072 1.00 47.84 C ATOM 8177 O HIS C 196 71.396 66.535 142.016 1.00 48.40 O ATOM 8178 CB HIS C 196 71.400 66.472 145.494 1.00 46.12 C ATOM 8179 CG HIS C 196 70.464 65.310 145.461 1.00 33.93 C ATOM 8180 ND1 HIS C 196 70.900 64.004 145.371 1.00 39.72 N ATOM 8181 CD2 HIS C 196 69.115 65.245 145.641 1.00 29.96 C ATOM 8182 CE1 HIS C 196 69.849 63.183 145.416 1.00 32.69 C ATOM 8183 NE2 HIS C 196 68.756 63.907 145.595 1.00 23.14 N ATOM 8184 N LEU C 197 71.010 68.394 143.217 1.00 47.77 N ATOM 8185 CA LEU C 197 70.222 69.036 142.188 1.00 47.86 C ATOM 8186 C LEU C 197 71.072 69.277 140.923 1.00 47.94 C ATOM 8187 O LEU C 197 70.552 69.223 139.804 1.00 47.84 O ATOM 8188 CB LEU C 197 69.697 70.354 142.720 1.00 47.96 C ATOM 8189 CG LEU C 197 68.220 70.679 142.687 1.00 50.28 C ATOM 8190 CD1 LEU C 197 67.383 69.422 142.974 1.00 48.42 C ATOM 8191 CD2 LEU C 197 67.964 71.755 143.772 1.00 44.18 C ATOM 8192 N LEU C 198 72.378 69.534 141.103 1.00 48.00 N ATOM 8193 CA LEU C 198 73.277 69.760 139.942 1.00 47.87 C ATOM 8194 C LEU C 198 73.318 68.511 139.048 1.00 48.42 C ATOM 8195 O LEU C 198 73.077 68.609 137.864 1.00 49.01 O ATOM 8196 CB LEU C 198 74.683 70.179 140.373 1.00 47.16 C ATOM 8197 CG LEU C 198 75.746 70.428 139.268 1.00 47.26 C ATOM 8198 CD1 LEU C 198 75.182 71.215 138.127 1.00 51.41 C ATOM 8199 CD2 LEU C 198 77.071 71.142 139.833 1.00 26.92 C ATOM 8200 N PHE C 199 73.529 67.332 139.641 1.00 48.19 N ATOM 8201 CA PHE C 199 73.550 66.098 138.854 1.00 47.18 C ATOM 8202 C PHE C 199 72.202 65.745 138.294 1.00 46.75 C ATOM 8203 O PHE C 199 72.121 65.242 137.190 1.00 47.21 O ATOM 8204 CB PHE C 199 74.114 64.945 139.644 1.00 46.56 C ATOM 8205 CG PHE C 199 75.571 64.951 139.701 1.00 44.18 C ATOM 8206 CD1 PHE C 199 76.306 64.898 138.540 1.00 41.06 C ATOM 8207 CD2 PHE C 199 76.233 65.082 140.918 1.00 45.97 C ATOM 8208 CE1 PHE C 199 77.669 64.923 138.574 1.00 38.34 C ATOM 8209 CE2 PHE C 199 77.598 65.105 140.974 1.00 40.08 C ATOM 8210 CZ PHE C 199 78.328 65.027 139.804 1.00 45.38 C ATOM 8211 N LEU C 200 71.139 66.006 139.058 1.00 45.67 N ATOM 8212 CA LEU C 200 69.780 65.729 138.597 1.00 44.75 C ATOM 8213 C LEU C 200 69.449 66.572 137.334 1.00 44.82 C ATOM 8214 O LEU C 200 68.894 66.047 136.342 1.00 45.13 O ATOM 8215 CB LEU C 200 68.765 66.050 139.683 1.00 44.32 C ATOM 8216 CG LEU C 200 67.338 65.776 139.224 1.00 45.59 C ATOM 8217 CD1 LEU C 200 67.127 64.298 139.201 1.00 56.36 C ATOM 8218 CD2 LEU C 200 66.253 66.476 140.075 1.00 31.01 C ATOM 8219 N HIS C 201 69.861 67.842 137.328 1.00 44.14 N ATOM 8220 CA HIS C 201 69.538 68.707 136.196 1.00 44.01 C ATOM 8221 C HIS C 201 70.140 68.292 134.893 1.00 42.56 C ATOM 8222 O HIS C 201 69.628 68.630 133.818 1.00 42.32 O ATOM 8223 CB HIS C 201 69.759 70.197 136.512 1.00 44.91 C ATOM 8224 CG HIS C 201 68.712 70.754 137.412 1.00 63.05 C ATOM 8225 ND1 HIS C 201 68.996 71.259 138.655 1.00 72.17 N ATOM 8226 CD2 HIS C 201 67.360 70.756 137.304 1.00 69.22 C ATOM 8227 CE1 HIS C 201 67.868 71.600 139.256 1.00 77.01 C ATOM 8228 NE2 HIS C 201 66.862 71.313 138.451 1.00 67.62 N ATOM 8229 N GLU C 202 71.192 67.502 134.986 1.00 41.38 N ATOM 8230 CA GLU C 202 71.867 66.988 133.820 1.00 40.67 C ATOM 8231 C GLU C 202 70.936 66.032 132.985 1.00 40.67 C ATOM 8232 O GLU C 202 71.176 65.834 131.794 1.00 41.48 O ATOM 8233 CB GLU C 202 73.126 66.276 134.255 1.00 40.32 C ATOM 8234 CG GLU C 202 74.076 65.946 133.170 1.00 44.76 C ATOM 8235 CD GLU C 202 75.120 66.996 133.024 1.00 61.67 C ATOM 8236 OE1 GLU C 202 76.014 66.801 132.155 1.00 69.69 O ATOM 8237 OE2 GLU C 202 75.058 68.025 133.790 1.00 51.45 O