>>1L0N:HELIX   66  66 GLU D  197  SER D  232  1                                  36    
EHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 66 66 GLU D 197 SER D 232 1 36 ATOM 11168 N GLU D 197 52.152 76.006 178.201 1.00 36.57 N ATOM 11169 CA GLU D 197 51.660 76.426 176.891 1.00 37.39 C ATOM 11170 C GLU D 197 50.377 75.720 176.421 1.00 38.40 C ATOM 11171 O GLU D 197 49.784 76.103 175.408 1.00 38.21 O ATOM 11172 CB GLU D 197 52.756 76.183 175.848 1.00 37.58 C ATOM 11173 CG GLU D 197 53.049 74.700 175.570 1.00 45.79 C ATOM 11174 CD GLU D 197 54.189 74.136 176.410 1.00 46.35 C ATOM 11175 OE1 GLU D 197 54.933 73.269 175.893 1.00 44.58 O ATOM 11176 OE2 GLU D 197 54.334 74.540 177.578 1.00 43.53 O ATOM 11177 N HIS D 198 49.977 74.687 177.156 1.00 39.59 N ATOM 11178 CA HIS D 198 48.803 73.865 176.843 1.00 40.58 C ATOM 11179 C HIS D 198 47.596 74.555 176.176 1.00 41.50 C ATOM 11180 O HIS D 198 47.170 74.152 175.118 1.00 41.52 O ATOM 11181 CB HIS D 198 48.357 73.139 178.085 1.00 40.36 C ATOM 11182 CG HIS D 198 47.192 72.248 177.874 1.00 41.31 C ATOM 11183 ND1 HIS D 198 45.889 72.683 177.998 1.00 41.06 N ATOM 11184 CD2 HIS D 198 47.125 70.930 177.584 1.00 48.55 C ATOM 11185 CE1 HIS D 198 45.070 71.673 177.773 1.00 43.01 C ATOM 11186 NE2 HIS D 198 45.794 70.594 177.532 1.00 48.24 N ATOM 11187 N ASP D 199 47.044 75.569 176.833 1.00 42.37 N ATOM 11188 CA ASP D 199 45.880 76.292 176.321 1.00 43.04 C ATOM 11189 C ASP D 199 46.129 76.900 174.964 1.00 44.06 C ATOM 11190 O ASP D 199 45.495 76.535 173.980 1.00 44.43 O ATOM 11191 CB ASP D 199 45.519 77.408 177.270 1.00 43.00 C ATOM 11192 CG ASP D 199 45.350 76.931 178.677 1.00 49.81 C ATOM 11193 OD1 ASP D 199 45.728 75.773 178.962 1.00 45.99 O ATOM 11194 OD2 ASP D 199 44.860 77.646 179.575 1.00 51.43 O ATOM 11195 N HIS D 200 47.086 77.820 174.932 1.00 44.73 N ATOM 11196 CA HIS D 200 47.460 78.574 173.749 1.00 45.18 C ATOM 11197 C HIS D 200 47.799 77.666 172.583 1.00 45.66 C ATOM 11198 O HIS D 200 47.495 77.974 171.431 1.00 45.78 O ATOM 11199 CB HIS D 200 48.664 79.441 174.085 1.00 45.30 C ATOM 11200 CG HIS D 200 48.722 80.712 173.315 1.00 53.77 C ATOM 11201 ND1 HIS D 200 49.842 81.113 172.624 1.00 55.12 N ATOM 11202 CD2 HIS D 200 47.802 81.687 173.139 1.00 59.30 C ATOM 11203 CE1 HIS D 200 49.607 82.277 172.047 1.00 55.76 C ATOM 11204 NE2 HIS D 200 48.377 82.648 172.345 1.00 59.32 N ATOM 11205 N ARG D 201 48.467 76.564 172.902 1.00 45.85 N ATOM 11206 CA ARG D 201 48.852 75.540 171.944 1.00 45.85 C ATOM 11207 C ARG D 201 47.604 75.196 171.169 1.00 45.87 C ATOM 11208 O ARG D 201 47.523 75.407 169.951 1.00 46.09 O ATOM 11209 CB ARG D 201 49.241 74.311 172.745 1.00 46.03 C ATOM 11210 CG ARG D 201 50.334 73.464 172.243 1.00 43.28 C ATOM 11211 CD ARG D 201 50.361 72.126 172.988 1.00 26.59 C ATOM 11212 NE ARG D 201 49.226 71.337 172.566 1.00 21.93 N ATOM 11213 CZ ARG D 201 48.580 70.455 173.319 1.00 34.72 C ATOM 11214 NH1 ARG D 201 48.944 70.231 174.587 1.00 34.28 N ATOM 11215 NH2 ARG D 201 47.562 69.792 172.803 1.00 29.67 N ATOM 11216 N LYS D 202 46.596 74.732 171.915 1.00 45.48 N ATOM 11217 CA LYS D 202 45.313 74.333 171.368 1.00 45.14 C ATOM 11218 C LYS D 202 44.483 75.476 170.763 1.00 44.92 C ATOM 11219 O LYS D 202 43.523 75.228 170.031 1.00 45.30 O ATOM 11220 CB LYS D 202 44.507 73.619 172.429 1.00 45.09 C ATOM 11221 CG LYS D 202 45.091 72.286 172.845 1.00 45.40 C ATOM 11222 CD LYS D 202 44.436 71.809 174.119 1.00 46.50 C ATOM 11223 CE LYS D 202 44.726 70.360 174.397 1.00 46.73 C ATOM 11224 NZ LYS D 202 43.723 69.819 175.376 1.00 53.80 N ATOM 11225 N ARG D 203 44.827 76.715 171.081 1.00 44.21 N ATOM 11226 CA ARG D 203 44.114 77.843 170.509 1.00 44.04 C ATOM 11227 C ARG D 203 44.642 78.086 169.111 1.00 44.17 C ATOM 11228 O ARG D 203 43.874 78.298 168.166 1.00 44.58 O ATOM 11229 CB ARG D 203 44.330 79.076 171.346 1.00 44.12 C ATOM 11230 CG ARG D 203 43.482 80.264 170.967 1.00 43.24 C ATOM 11231 CD ARG D 203 43.773 81.476 171.842 1.00 46.81 C ATOM 11232 NE ARG D 203 42.597 82.290 172.113 1.00 46.78 N ATOM 11233 CZ ARG D 203 42.395 82.914 173.254 1.00 54.74 C ATOM 11234 NH1 ARG D 203 43.292 82.809 174.223 1.00 62.97 N ATOM 11235 NH2 ARG D 203 41.303 83.648 173.438 1.00 56.76 N ATOM 11236 N MET D 204 45.961 78.056 168.979 1.00 43.67 N ATOM 11237 CA MET D 204 46.584 78.245 167.700 1.00 43.25 C ATOM 11238 C MET D 204 46.118 77.122 166.817 1.00 43.11 C ATOM 11239 O MET D 204 45.788 77.337 165.649 1.00 42.75 O ATOM 11240 CB MET D 204 48.094 78.199 167.829 1.00 43.13 C ATOM 11241 CG MET D 204 48.683 79.324 168.621 1.00 42.80 C ATOM 11242 SD MET D 204 50.460 79.495 168.281 1.00 51.30 S ATOM 11243 CE MET D 204 50.847 80.697 169.369 1.00 45.48 C ATOM 11244 N GLY D 205 46.055 75.924 167.406 1.00 43.26 N ATOM 11245 CA GLY D 205 45.599 74.722 166.723 1.00 43.72 C ATOM 11246 C GLY D 205 44.216 74.865 166.117 1.00 43.83 C ATOM 11247 O GLY D 205 43.984 74.392 164.985 1.00 43.95 O ATOM 11248 N LEU D 206 43.301 75.518 166.852 1.00 43.58 N ATOM 11249 CA LEU D 206 41.966 75.789 166.338 1.00 43.92 C ATOM 11250 C LEU D 206 42.082 76.703 165.105 1.00 44.61 C ATOM 11251 O LEU D 206 41.468 76.448 164.059 1.00 44.80 O ATOM 11252 CB LEU D 206 41.118 76.481 167.382 1.00 43.81 C ATOM 11253 CG LEU D 206 39.826 77.072 166.808 1.00 46.98 C ATOM 11254 CD1 LEU D 206 38.835 75.979 166.439 1.00 48.42 C ATOM 11255 CD2 LEU D 206 39.200 78.062 167.753 1.00 52.33 C ATOM 11256 N LYS D 207 42.899 77.744 165.228 1.00 44.88 N ATOM 11257 CA LYS D 207 43.101 78.680 164.144 1.00 45.13 C ATOM 11258 C LYS D 207 43.781 77.994 162.958 1.00 46.03 C ATOM 11259 O LYS D 207 43.405 78.216 161.795 1.00 46.34 O ATOM 11260 CB LYS D 207 43.913 79.859 164.630 1.00 44.85 C ATOM 11261 CG LYS D 207 43.246 80.598 165.777 1.00 43.04 C ATOM 11262 CD LYS D 207 43.984 81.867 166.164 1.00 43.27 C ATOM 11263 CE LYS D 207 43.053 82.826 166.904 1.00 41.71 C ATOM 11264 NZ LYS D 207 43.730 83.791 167.805 1.00 37.43 N ATOM 11265 N MET D 208 44.740 77.111 163.264 1.00 46.15 N ATOM 11266 CA MET D 208 45.478 76.352 162.247 1.00 45.39 C ATOM 11267 C MET D 208 44.528 75.447 161.473 1.00 45.18 C ATOM 11268 O MET D 208 44.642 75.341 160.277 1.00 45.12 O ATOM 11269 CB MET D 208 46.600 75.534 162.912 1.00 45.20 C ATOM 11270 CG MET D 208 47.604 74.918 161.974 1.00 37.12 C ATOM 11271 SD MET D 208 47.120 73.297 161.395 1.00 49.48 S ATOM 11272 CE MET D 208 47.246 72.374 162.809 1.00 34.98 C ATOM 11273 N LEU D 209 43.588 74.796 162.169 1.00 45.17 N ATOM 11274 CA LEU D 209 42.597 73.929 161.487 1.00 45.17 C ATOM 11275 C LEU D 209 41.617 74.744 160.641 1.00 45.54 C ATOM 11276 O LEU D 209 41.250 74.318 159.560 1.00 45.59 O ATOM 11277 CB LEU D 209 41.810 73.064 162.480 1.00 44.98 C ATOM 11278 CG LEU D 209 42.516 71.860 163.097 1.00 41.84 C ATOM 11279 CD1 LEU D 209 41.617 71.180 164.085 1.00 40.20 C ATOM 11280 CD2 LEU D 209 42.933 70.889 162.012 1.00 42.41 C ATOM 11281 N LEU D 210 41.183 75.909 161.151 1.00 45.77 N ATOM 11282 CA LEU D 210 40.261 76.770 160.404 1.00 46.29 C ATOM 11283 C LEU D 210 40.963 77.359 159.173 1.00 47.71 C ATOM 11284 O LEU D 210 40.375 77.432 158.084 1.00 48.61 O ATOM 11285 CB LEU D 210 39.726 77.905 161.279 1.00 46.04 C ATOM 11286 CG LEU D 210 38.652 77.649 162.369 1.00 48.58 C ATOM 11287 CD1 LEU D 210 38.836 78.605 163.527 1.00 42.74 C ATOM 11288 CD2 LEU D 210 37.212 77.730 161.839 1.00 38.83 C ATOM 11289 N MET D 211 42.223 77.757 159.324 1.00 47.87 N ATOM 11290 CA MET D 211 42.935 78.340 158.202 1.00 48.05 C ATOM 11291 C MET D 211 43.309 77.330 157.168 1.00 48.73 C ATOM 11292 O MET D 211 43.142 77.576 155.965 1.00 49.36 O ATOM 11293 CB MET D 211 44.166 79.126 158.645 1.00 47.86 C ATOM 11294 CG MET D 211 43.852 80.445 159.330 1.00 55.63 C ATOM 11295 SD MET D 211 43.649 81.845 158.226 1.00 58.76 S ATOM 11296 CE MET D 211 42.267 81.331 157.168 1.00 65.99 C ATOM 11297 N MET D 212 43.808 76.177 157.618 1.00 48.38 N ATOM 11298 CA MET D 212 44.217 75.156 156.703 1.00 47.99 C ATOM 11299 C MET D 212 42.974 74.736 155.998 1.00 48.17 C ATOM 11300 O MET D 212 42.942 74.666 154.789 1.00 48.37 O ATOM 11301 CB MET D 212 44.863 73.995 157.431 1.00 47.89 C ATOM 11302 CG MET D 212 45.972 73.314 156.640 1.00 56.89 C ATOM 11303 SD MET D 212 47.467 74.373 156.390 1.00 62.48 S ATOM 11304 CE MET D 212 48.179 74.328 157.940 1.00 59.98 C ATOM 11305 N GLY D 213 41.895 74.621 156.757 1.00 48.44 N ATOM 11306 CA GLY D 213 40.601 74.255 156.211 1.00 48.78 C ATOM 11307 C GLY D 213 40.062 75.255 155.199 1.00 49.12 C ATOM 11308 O GLY D 213 39.121 74.959 154.485 1.00 49.94 O ATOM 11309 N LEU D 214 40.657 76.434 155.134 1.00 48.57 N ATOM 11310 CA LEU D 214 40.227 77.421 154.168 1.00 48.68 C ATOM 11311 C LEU D 214 41.280 77.593 153.059 1.00 48.93 C ATOM 11312 O LEU D 214 40.925 77.763 151.891 1.00 49.64 O ATOM 11313 CB LEU D 214 39.905 78.754 154.852 1.00 48.78 C ATOM 11314 CG LEU D 214 39.173 79.825 154.025 1.00 46.40 C ATOM 11315 CD1 LEU D 214 37.924 80.354 154.773 1.00 44.86 C ATOM 11316 CD2 LEU D 214 40.095 80.958 153.621 1.00 38.57 C ATOM 11317 N LEU D 215 42.573 77.546 153.424 1.00 48.08 N ATOM 11318 CA LEU D 215 43.666 77.669 152.436 1.00 47.01 C ATOM 11319 C LEU D 215 43.765 76.428 151.538 1.00 46.48 C ATOM 11320 O LEU D 215 43.922 76.551 150.337 1.00 46.46 O ATOM 11321 CB LEU D 215 45.004 77.855 153.125 1.00 46.62 C ATOM 11322 CG LEU D 215 45.273 79.148 153.833 1.00 39.38 C ATOM 11323 CD1 LEU D 215 46.596 79.026 154.624 1.00 33.91 C ATOM 11324 CD2 LEU D 215 45.341 80.278 152.813 1.00 36.64 C ATOM 11325 N LEU D 216 43.724 75.240 152.149 1.00 45.93 N ATOM 11326 CA LEU D 216 43.796 74.004 151.405 1.00 45.76 C ATOM 11327 C LEU D 216 42.874 73.918 150.177 1.00 45.91 C ATOM 11328 O LEU D 216 43.366 73.655 149.079 1.00 46.33 O ATOM 11329 CB LEU D 216 43.700 72.778 152.296 1.00 45.85 C ATOM 11330 CG LEU D 216 45.036 72.155 152.686 1.00 52.50 C ATOM 11331 CD1 LEU D 216 44.804 71.106 153.752 1.00 50.04 C ATOM 11332 CD2 LEU D 216 45.700 71.515 151.443 1.00 51.68 C ATOM 11333 N PRO D 217 41.557 74.135 150.322 1.00 45.42 N ATOM 11334 CA PRO D 217 40.696 74.120 149.128 1.00 44.65 C ATOM 11335 C PRO D 217 41.142 75.198 148.130 1.00 43.97 C ATOM 11336 O PRO D 217 41.320 74.890 146.953 1.00 43.39 O ATOM 11337 CB PRO D 217 39.307 74.449 149.679 1.00 44.49 C ATOM 11338 CG PRO D 217 39.371 74.068 151.141 1.00 47.17 C ATOM 11339 CD PRO D 217 40.777 74.332 151.565 1.00 45.48 C ATOM 11340 N LEU D 218 41.365 76.422 148.612 1.00 43.84 N ATOM 11341 CA LEU D 218 41.772 77.532 147.731 1.00 43.98 C ATOM 11342 C LEU D 218 43.063 77.281 146.929 1.00 44.05 C ATOM 11343 O LEU D 218 43.103 77.535 145.716 1.00 43.42 O ATOM 11344 CB LEU D 218 41.839 78.862 148.493 1.00 43.97 C ATOM 11345 CG LEU D 218 40.474 79.423 148.938 1.00 45.03 C ATOM 11346 CD1 LEU D 218 40.642 80.704 149.686 1.00 47.25 C ATOM 11347 CD2 LEU D 218 39.536 79.623 147.749 1.00 44.76 C ATOM 11348 N VAL D 219 44.091 76.732 147.590 1.00 44.62 N ATOM 11349 CA VAL D 219 45.359 76.435 146.912 1.00 45.02 C ATOM 11350 C VAL D 219 45.154 75.308 145.891 1.00 45.67 C ATOM 11351 O VAL D 219 45.769 75.301 144.815 1.00 46.27 O ATOM 11352 CB VAL D 219 46.508 76.118 147.905 1.00 44.71 C ATOM 11353 CG1 VAL D 219 47.753 75.815 147.167 1.00 50.64 C ATOM 11354 CG2 VAL D 219 46.773 77.323 148.802 1.00 46.01 C ATOM 11355 N TYR D 220 44.233 74.407 146.198 1.00 45.58 N ATOM 11356 CA TYR D 220 43.889 73.318 145.294 1.00 45.53 C ATOM 11357 C TYR D 220 43.252 73.910 144.033 1.00 45.13 C ATOM 11358 O TYR D 220 43.732 73.667 142.927 1.00 45.69 O ATOM 11359 CB TYR D 220 42.914 72.420 145.971 1.00 45.87 C ATOM 11360 CG TYR D 220 42.758 71.054 145.402 1.00 56.71 C ATOM 11361 CD1 TYR D 220 43.391 69.988 145.973 1.00 67.14 C ATOM 11362 CD2 TYR D 220 41.875 70.808 144.394 1.00 61.56 C ATOM 11363 CE1 TYR D 220 43.197 68.724 145.513 1.00 73.01 C ATOM 11364 CE2 TYR D 220 41.672 69.533 143.930 1.00 69.21 C ATOM 11365 CZ TYR D 220 42.339 68.498 144.502 1.00 69.43 C ATOM 11366 OH TYR D 220 42.155 67.219 144.048 1.00 64.40 O ATOM 11367 N ALA D 221 42.204 74.726 144.204 1.00 43.93 N ATOM 11368 CA ALA D 221 41.560 75.386 143.062 1.00 42.65 C ATOM 11369 C ALA D 221 42.534 76.269 142.299 1.00 42.57 C ATOM 11370 O ALA D 221 42.348 76.498 141.120 1.00 42.88 O ATOM 11371 CB ALA D 221 40.369 76.169 143.480 1.00 41.93 C ATOM 11372 N MET D 222 43.562 76.786 142.970 1.00 42.23 N ATOM 11373 CA MET D 222 44.571 77.583 142.253 1.00 42.28 C ATOM 11374 C MET D 222 45.323 76.625 141.351 1.00 42.88 C ATOM 11375 O MET D 222 45.475 76.871 140.158 1.00 43.00 O ATOM 11376 CB MET D 222 45.562 78.241 143.219 1.00 41.99 C ATOM 11377 CG MET D 222 45.061 79.537 143.898 1.00 41.48 C ATOM 11378 SD MET D 222 46.415 80.685 144.298 1.00 51.97 S ATOM 11379 CE MET D 222 47.516 79.682 145.222 1.00 59.30 C ATOM 11380 N LYS D 223 45.719 75.485 141.921 1.00 43.11 N ATOM 11381 CA LYS D 223 46.473 74.491 141.201 1.00 43.46 C ATOM 11382 C LYS D 223 45.698 73.796 140.064 1.00 44.23 C ATOM 11383 O LYS D 223 46.219 73.677 138.953 1.00 45.61 O ATOM 11384 CB LYS D 223 47.065 73.474 142.171 1.00 43.68 C ATOM 11385 CG LYS D 223 47.950 72.381 141.536 1.00 46.32 C ATOM 11386 CD LYS D 223 47.228 71.056 141.417 1.00 47.14 C ATOM 11387 CE LYS D 223 48.149 69.995 140.776 1.00 57.46 C ATOM 11388 NZ LYS D 223 47.408 68.737 140.361 1.00 61.03 N ATOM 11389 N ARG D 224 44.477 73.343 140.313 1.00 43.07 N ATOM 11390 CA ARG D 224 43.759 72.670 139.221 1.00 42.63 C ATOM 11391 C ARG D 224 43.474 73.662 138.088 1.00 42.65 C ATOM 11392 O ARG D 224 43.500 73.295 136.910 1.00 42.77 O ATOM 11393 CB ARG D 224 42.433 72.109 139.732 1.00 42.46 C ATOM 11394 CG ARG D 224 42.338 70.591 139.586 1.00 20.00 C ATOM 11395 CD ARG D 224 42.462 69.851 140.917 1.00 20.00 C ATOM 11396 NE ARG D 224 42.373 68.393 140.767 1.00 20.00 N ATOM 11397 CZ ARG D 224 42.452 67.528 141.786 1.00 20.00 C ATOM 11398 NH1 ARG D 224 42.623 67.955 143.043 1.00 20.00 N ATOM 11399 NH2 ARG D 224 42.369 66.198 141.645 1.00 20.00 N ATOM 11400 N HIS D 225 43.264 74.921 138.460 1.00 42.47 N ATOM 11401 CA HIS D 225 43.035 75.971 137.478 1.00 42.16 C ATOM 11402 C HIS D 225 44.193 76.016 136.508 1.00 42.44 C ATOM 11403 O HIS D 225 43.978 75.922 135.290 1.00 43.19 O ATOM 11404 CB HIS D 225 42.847 77.318 138.163 1.00 41.48 C ATOM 11405 CG HIS D 225 43.060 78.497 137.275 1.00 32.14 C ATOM 11406 ND1 HIS D 225 42.047 79.061 136.531 1.00 42.96 N ATOM 11407 CD2 HIS D 225 44.144 79.291 137.096 1.00 37.23 C ATOM 11408 CE1 HIS D 225 42.507 80.133 135.900 1.00 45.18 C ATOM 11409 NE2 HIS D 225 43.774 80.300 136.234 1.00 42.65 N ATOM 11410 N LYS D 226 45.427 76.083 137.023 1.00 41.41 N ATOM 11411 CA LYS D 226 46.561 76.125 136.115 1.00 41.03 C ATOM 11412 C LYS D 226 46.853 74.796 135.410 1.00 41.01 C ATOM 11413 O LYS D 226 47.339 74.787 134.287 1.00 41.94 O ATOM 11414 CB LYS D 226 47.799 76.731 136.744 1.00 40.55 C ATOM 11415 CG LYS D 226 47.586 78.137 137.069 1.00 42.85 C ATOM 11416 CD LYS D 226 48.801 78.977 136.903 1.00 39.98 C ATOM 11417 CE LYS D 226 48.380 80.310 136.317 1.00 34.35 C ATOM 11418 NZ LYS D 226 49.107 81.397 136.900 1.00 46.94 N ATOM 11419 N TRP D 227 46.493 73.695 136.029 1.00 39.42 N ATOM 11420 CA TRP D 227 46.749 72.422 135.438 1.00 38.89 C ATOM 11421 C TRP D 227 45.672 72.031 134.444 1.00 39.06 C ATOM 11422 O TRP D 227 45.824 71.013 133.697 1.00 38.88 O ATOM 11423 CB TRP D 227 46.863 71.358 136.528 1.00 38.98 C ATOM 11424 CG TRP D 227 48.178 71.271 137.032 1.00 41.87 C ATOM 11425 CD1 TRP D 227 48.788 72.152 137.843 1.00 41.54 C ATOM 11426 CD2 TRP D 227 49.154 70.307 136.671 1.00 38.24 C ATOM 11427 NE1 TRP D 227 50.099 71.793 138.023 1.00 42.80 N ATOM 11428 CE2 TRP D 227 50.343 70.659 137.303 1.00 39.52 C ATOM 11429 CE3 TRP D 227 49.150 69.194 135.846 1.00 44.14 C ATOM 11430 CZ2 TRP D 227 51.492 69.927 137.172 1.00 45.59 C ATOM 11431 CZ3 TRP D 227 50.295 68.457 135.725 1.00 45.61 C ATOM 11432 CH2 TRP D 227 51.449 68.829 136.380 1.00 48.63 C ATOM 11433 N SER D 228 44.590 72.834 134.395 1.00 38.55 N ATOM 11434 CA SER D 228 43.450 72.505 133.541 1.00 37.44 C ATOM 11435 C SER D 228 43.773 72.538 132.044 1.00 36.84 C ATOM 11436 O SER D 228 43.161 71.775 131.252 1.00 36.62 O ATOM 11437 CB SER D 228 42.248 73.358 133.873 1.00 37.02 C ATOM 11438 OG SER D 228 42.233 74.508 133.092 1.00 38.21 O ATOM 11439 N VAL D 229 44.757 73.379 131.661 1.00 36.51 N ATOM 11440 CA VAL D 229 45.231 73.465 130.252 1.00 36.88 C ATOM 11441 C VAL D 229 45.762 72.111 129.855 1.00 38.02 C ATOM 11442 O VAL D 229 45.616 71.687 128.711 1.00 37.27 O ATOM 11443 CB VAL D 229 46.392 74.389 130.099 1.00 36.58 C ATOM 11444 CG1 VAL D 229 46.822 74.418 128.664 1.00 36.40 C ATOM 11445 CG2 VAL D 229 46.057 75.791 130.600 1.00 32.46 C ATOM 11446 N LEU D 230 46.364 71.418 130.828 1.00 39.46 N ATOM 11447 CA LEU D 230 46.871 70.089 130.601 1.00 40.95 C ATOM 11448 C LEU D 230 45.844 68.961 130.835 1.00 42.67 C ATOM 11449 O LEU D 230 45.778 68.044 130.041 1.00 43.17 O ATOM 11450 CB LEU D 230 48.157 69.842 131.408 1.00 40.78 C ATOM 11451 CG LEU D 230 49.306 70.800 131.000 1.00 52.09 C ATOM 11452 CD1 LEU D 230 50.575 70.491 131.776 1.00 51.29 C ATOM 11453 CD2 LEU D 230 49.586 70.759 129.486 1.00 39.49 C ATOM 11454 N LYS D 231 45.068 69.002 131.929 1.00 43.60 N ATOM 11455 CA LYS D 231 44.094 67.897 132.185 1.00 44.28 C ATOM 11456 C LYS D 231 43.071 67.795 131.054 1.00 45.20 C ATOM 11457 O LYS D 231 42.746 66.696 130.595 1.00 45.88 O ATOM 11458 CB LYS D 231 43.388 68.051 133.507 1.00 44.07 C ATOM 11459 CG LYS D 231 44.323 68.175 134.700 1.00 59.50 C ATOM 11460 CD LYS D 231 45.072 66.890 135.023 1.00 60.49 C ATOM 11461 CE LYS D 231 45.905 67.067 136.305 1.00 65.92 C ATOM 11462 NZ LYS D 231 46.477 65.779 136.841 1.00 71.47 N ATOM 11463 N SER D 232 42.563 68.946 130.618 1.00 44.87 N ATOM 11464 CA SER D 232 41.643 69.012 129.494 1.00 44.40 C ATOM 11465 C SER D 232 42.590 69.373 128.477 1.00 44.45 C ATOM 11466 O SER D 232 43.228 70.404 128.630 1.00 46.12 O ATOM 11467 CB SER D 232 40.694 70.173 129.689 1.00 44.13 C ATOM 11468 OG SER D 232 40.481 70.857 128.479 1.00 40.06 O