>>1L0N:HELIX   45  45 TYR C   75  GLY C  105  1                                  31    
YGWIIRYMHANGASMFFICLYMHVGRGLYYG
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 45 45 TYR C 75 GLY C 105 1 31 ATOM 7196 N TYR C 75 57.215 82.309 172.678 1.00 40.06 N ATOM 7197 CA TYR C 75 57.013 81.402 171.593 1.00 39.94 C ATOM 7198 C TYR C 75 58.145 80.424 171.436 1.00 40.73 C ATOM 7199 O TYR C 75 58.319 79.821 170.354 1.00 41.42 O ATOM 7200 CB TYR C 75 56.766 82.175 170.307 1.00 39.47 C ATOM 7201 CG TYR C 75 55.616 83.118 170.433 1.00 37.82 C ATOM 7202 CD1 TYR C 75 55.820 84.447 170.716 1.00 32.08 C ATOM 7203 CD2 TYR C 75 54.304 82.662 170.329 1.00 42.60 C ATOM 7204 CE1 TYR C 75 54.776 85.305 170.868 1.00 34.15 C ATOM 7205 CE2 TYR C 75 53.242 83.526 170.469 1.00 40.30 C ATOM 7206 CZ TYR C 75 53.492 84.850 170.748 1.00 38.02 C ATOM 7207 OH TYR C 75 52.457 85.739 170.902 1.00 43.04 O ATOM 7208 N GLY C 76 58.920 80.252 172.507 1.00 40.81 N ATOM 7209 CA GLY C 76 60.019 79.325 172.491 1.00 41.86 C ATOM 7210 C GLY C 76 59.502 77.912 172.265 1.00 43.45 C ATOM 7211 O GLY C 76 60.078 77.136 171.476 1.00 43.74 O ATOM 7212 N TRP C 77 58.363 77.603 172.898 1.00 44.39 N ATOM 7213 CA TRP C 77 57.769 76.282 172.811 1.00 44.94 C ATOM 7214 C TRP C 77 57.463 75.809 171.402 1.00 45.76 C ATOM 7215 O TRP C 77 57.845 74.696 171.038 1.00 46.32 O ATOM 7216 CB TRP C 77 56.568 76.122 173.751 1.00 44.83 C ATOM 7217 CG TRP C 77 55.454 77.086 173.528 1.00 43.27 C ATOM 7218 CD1 TRP C 77 55.272 78.280 174.150 1.00 39.90 C ATOM 7219 CD2 TRP C 77 54.330 76.912 172.660 1.00 46.71 C ATOM 7220 NE1 TRP C 77 54.113 78.874 173.710 1.00 40.93 N ATOM 7221 CE2 TRP C 77 53.516 78.052 172.792 1.00 45.10 C ATOM 7222 CE3 TRP C 77 53.925 75.903 171.776 1.00 47.33 C ATOM 7223 CZ2 TRP C 77 52.331 78.215 172.073 1.00 45.73 C ATOM 7224 CZ3 TRP C 77 52.752 76.071 171.066 1.00 48.17 C ATOM 7225 CH2 TRP C 77 51.973 77.220 171.217 1.00 46.98 C ATOM 7226 N ILE C 78 56.842 76.662 170.580 1.00 45.82 N ATOM 7227 CA ILE C 78 56.535 76.257 169.202 1.00 45.71 C ATOM 7228 C ILE C 78 57.813 76.054 168.485 1.00 45.80 C ATOM 7229 O ILE C 78 57.994 75.050 167.835 1.00 46.11 O ATOM 7230 CB ILE C 78 55.740 77.294 168.457 1.00 45.60 C ATOM 7231 CG1 ILE C 78 55.379 78.439 169.348 1.00 57.51 C ATOM 7232 CG2 ILE C 78 54.538 76.680 167.834 1.00 44.23 C ATOM 7233 CD1 ILE C 78 54.140 79.066 168.962 1.00 64.29 C ATOM 7234 N ILE C 79 58.730 77.007 168.631 1.00 45.60 N ATOM 7235 CA ILE C 79 60.021 76.891 167.981 1.00 45.23 C ATOM 7236 C ILE C 79 60.654 75.561 168.362 1.00 45.20 C ATOM 7237 O ILE C 79 61.006 74.762 167.470 1.00 45.47 O ATOM 7238 CB ILE C 79 60.925 78.079 168.310 1.00 44.84 C ATOM 7239 CG1 ILE C 79 60.379 79.343 167.630 1.00 41.82 C ATOM 7240 CG2 ILE C 79 62.289 77.822 167.807 1.00 36.22 C ATOM 7241 CD1 ILE C 79 61.139 80.587 167.939 1.00 42.36 C ATOM 7242 N ARG C 80 60.678 75.256 169.670 1.00 44.39 N ATOM 7243 CA ARG C 80 61.229 73.983 170.121 1.00 43.87 C ATOM 7244 C ARG C 80 60.521 72.758 169.490 1.00 43.23 C ATOM 7245 O ARG C 80 61.184 71.908 168.912 1.00 43.23 O ATOM 7246 CB ARG C 80 61.246 73.876 171.639 1.00 43.99 C ATOM 7247 CG ARG C 80 62.103 72.680 172.183 1.00 46.89 C ATOM 7248 CD ARG C 80 61.406 71.296 172.157 1.00 40.62 C ATOM 7249 NE ARG C 80 62.277 70.213 172.601 1.00 34.19 N ATOM 7250 CZ ARG C 80 62.368 69.815 173.854 1.00 41.56 C ATOM 7251 NH1 ARG C 80 61.649 70.418 174.807 1.00 39.66 N ATOM 7252 NH2 ARG C 80 63.180 68.825 174.171 1.00 46.93 N ATOM 7253 N TYR C 81 59.189 72.686 169.594 1.00 42.54 N ATOM 7254 CA TYR C 81 58.446 71.540 169.031 1.00 42.22 C ATOM 7255 C TYR C 81 58.477 71.440 167.487 1.00 42.14 C ATOM 7256 O TYR C 81 58.441 70.339 166.936 1.00 42.27 O ATOM 7257 CB TYR C 81 57.026 71.469 169.569 1.00 42.20 C ATOM 7258 CG TYR C 81 56.987 71.387 171.071 1.00 44.10 C ATOM 7259 CD1 TYR C 81 57.915 70.623 171.761 1.00 46.30 C ATOM 7260 CD2 TYR C 81 56.064 72.101 171.797 1.00 42.29 C ATOM 7261 CE1 TYR C 81 57.926 70.575 173.121 1.00 47.25 C ATOM 7262 CE2 TYR C 81 56.072 72.066 173.156 1.00 49.34 C ATOM 7263 CZ TYR C 81 57.007 71.291 173.816 1.00 49.69 C ATOM 7264 OH TYR C 81 57.013 71.236 175.173 1.00 53.92 O ATOM 7265 N MET C 82 58.580 72.582 166.802 1.00 41.57 N ATOM 7266 CA MET C 82 58.665 72.561 165.368 1.00 41.31 C ATOM 7267 C MET C 82 59.980 71.910 164.978 1.00 41.59 C ATOM 7268 O MET C 82 60.037 71.160 163.990 1.00 42.18 O ATOM 7269 CB MET C 82 58.600 73.950 164.783 1.00 41.08 C ATOM 7270 CG MET C 82 57.251 74.557 164.759 1.00 40.36 C ATOM 7271 SD MET C 82 57.385 76.202 164.075 1.00 50.09 S ATOM 7272 CE MET C 82 55.816 76.896 164.454 1.00 46.38 C ATOM 7273 N HIS C 83 61.041 72.193 165.752 1.00 40.72 N ATOM 7274 CA HIS C 83 62.337 71.590 165.492 1.00 39.47 C ATOM 7275 C HIS C 83 62.167 70.095 165.716 1.00 39.79 C ATOM 7276 O HIS C 83 62.333 69.295 164.791 1.00 39.93 O ATOM 7277 CB HIS C 83 63.398 72.151 166.427 1.00 38.30 C ATOM 7278 CG HIS C 83 64.795 71.961 165.934 1.00 29.32 C ATOM 7279 ND1 HIS C 83 65.286 72.600 164.807 1.00 40.94 N ATOM 7280 CD2 HIS C 83 65.819 71.223 166.418 1.00 27.03 C ATOM 7281 CE1 HIS C 83 66.550 72.256 164.619 1.00 27.57 C ATOM 7282 NE2 HIS C 83 66.899 71.416 165.579 1.00 25.96 N ATOM 7283 N ALA C 84 61.740 69.736 166.917 1.00 40.06 N ATOM 7284 CA ALA C 84 61.514 68.346 167.274 1.00 40.89 C ATOM 7285 C ALA C 84 60.712 67.593 166.189 1.00 42.10 C ATOM 7286 O ALA C 84 61.200 66.626 165.609 1.00 42.64 O ATOM 7287 CB ALA C 84 60.802 68.255 168.604 1.00 40.61 C ATOM 7288 N ASN C 85 59.527 68.085 165.863 1.00 42.33 N ATOM 7289 CA ASN C 85 58.703 67.398 164.889 1.00 42.84 C ATOM 7290 C ASN C 85 59.156 67.473 163.445 1.00 43.52 C ATOM 7291 O ASN C 85 58.905 66.545 162.643 1.00 43.17 O ATOM 7292 CB ASN C 85 57.243 67.716 165.081 1.00 42.67 C ATOM 7293 CG ASN C 85 56.721 67.131 166.351 1.00 52.99 C ATOM 7294 OD1 ASN C 85 56.873 65.932 166.583 1.00 58.65 O ATOM 7295 ND2 ASN C 85 56.204 67.978 167.241 1.00 53.41 N ATOM 7296 N GLY C 86 59.894 68.532 163.128 1.00 44.03 N ATOM 7297 CA GLY C 86 60.409 68.697 161.800 1.00 44.57 C ATOM 7298 C GLY C 86 61.453 67.636 161.542 1.00 45.21 C ATOM 7299 O GLY C 86 61.700 67.267 160.423 1.00 44.87 O ATOM 7300 N ALA C 87 62.074 67.151 162.605 1.00 46.08 N ATOM 7301 CA ALA C 87 63.066 66.119 162.460 1.00 46.82 C ATOM 7302 C ALA C 87 62.397 64.822 162.009 1.00 47.54 C ATOM 7303 O ALA C 87 62.933 64.093 161.178 1.00 47.90 O ATOM 7304 CB ALA C 87 63.801 65.924 163.746 1.00 46.66 C ATOM 7305 N SER C 88 61.217 64.551 162.534 1.00 47.59 N ATOM 7306 CA SER C 88 60.516 63.370 162.125 1.00 48.41 C ATOM 7307 C SER C 88 59.904 63.592 160.775 1.00 49.28 C ATOM 7308 O SER C 88 59.900 62.694 159.939 1.00 49.22 O ATOM 7309 CB SER C 88 59.457 62.986 163.129 1.00 48.34 C ATOM 7310 OG SER C 88 60.029 62.261 164.183 1.00 42.39 O ATOM 7311 N MET C 89 59.393 64.801 160.551 1.00 50.09 N ATOM 7312 CA MET C 89 58.820 65.133 159.264 1.00 50.69 C ATOM 7313 C MET C 89 59.900 64.995 158.193 1.00 51.58 C ATOM 7314 O MET C 89 59.635 64.469 157.114 1.00 52.52 O ATOM 7315 CB MET C 89 58.222 66.541 159.253 1.00 50.47 C ATOM 7316 CG MET C 89 56.919 66.683 160.025 1.00 48.37 C ATOM 7317 SD MET C 89 55.641 65.527 159.533 1.00 48.51 S ATOM 7318 CE MET C 89 55.543 65.849 157.905 1.00 54.76 C ATOM 7319 N PHE C 90 61.127 65.405 158.524 1.00 51.18 N ATOM 7320 CA PHE C 90 62.261 65.282 157.613 1.00 51.15 C ATOM 7321 C PHE C 90 62.519 63.807 157.372 1.00 51.36 C ATOM 7322 O PHE C 90 62.963 63.434 156.301 1.00 52.51 O ATOM 7323 CB PHE C 90 63.510 65.883 158.243 1.00 51.33 C ATOM 7324 CG PHE C 90 64.595 66.247 157.264 1.00 56.25 C ATOM 7325 CD1 PHE C 90 65.374 65.274 156.660 1.00 58.37 C ATOM 7326 CD2 PHE C 90 64.924 67.571 157.051 1.00 60.80 C ATOM 7327 CE1 PHE C 90 66.403 65.623 155.784 1.00 62.18 C ATOM 7328 CE2 PHE C 90 65.948 67.919 156.174 1.00 62.57 C ATOM 7329 CZ PHE C 90 66.689 66.940 155.551 1.00 60.01 C ATOM 7330 N PHE C 91 62.264 62.957 158.355 1.00 50.15 N ATOM 7331 CA PHE C 91 62.523 61.556 158.119 1.00 49.67 C ATOM 7332 C PHE C 91 61.474 60.831 157.322 1.00 49.75 C ATOM 7333 O PHE C 91 61.814 59.953 156.533 1.00 50.07 O ATOM 7334 CB PHE C 91 62.967 60.798 159.370 1.00 49.43 C ATOM 7335 CG PHE C 91 64.455 60.865 159.614 1.00 44.54 C ATOM 7336 CD1 PHE C 91 64.997 61.863 160.401 1.00 28.91 C ATOM 7337 CD2 PHE C 91 65.312 59.947 159.017 1.00 45.11 C ATOM 7338 CE1 PHE C 91 66.348 61.940 160.610 1.00 34.43 C ATOM 7339 CE2 PHE C 91 66.686 60.027 159.225 1.00 46.14 C ATOM 7340 CZ PHE C 91 67.205 61.027 160.018 1.00 34.44 C ATOM 7341 N ILE C 92 60.200 61.211 157.492 1.00 49.49 N ATOM 7342 CA ILE C 92 59.111 60.589 156.729 1.00 49.34 C ATOM 7343 C ILE C 92 59.348 60.952 155.244 1.00 49.51 C ATOM 7344 O ILE C 92 59.300 60.071 154.327 1.00 49.97 O ATOM 7345 CB ILE C 92 57.737 61.138 157.184 1.00 49.25 C ATOM 7346 CG1 ILE C 92 57.411 60.693 158.607 1.00 51.96 C ATOM 7347 CG2 ILE C 92 56.620 60.664 156.243 1.00 38.75 C ATOM 7348 CD1 ILE C 92 56.802 59.313 158.681 1.00 66.57 C ATOM 7349 N CYS C 93 59.665 62.216 155.006 1.00 48.50 N ATOM 7350 CA CYS C 93 59.902 62.650 153.662 1.00 47.97 C ATOM 7351 C CYS C 93 61.096 61.933 153.083 1.00 48.22 C ATOM 7352 O CYS C 93 61.013 61.366 151.977 1.00 48.55 O ATOM 7353 CB CYS C 93 60.023 64.142 153.590 1.00 47.36 C ATOM 7354 SG CYS C 93 58.503 64.959 154.148 1.00 45.09 S ATOM 7355 N LEU C 94 62.162 61.838 153.869 1.00 47.78 N ATOM 7356 CA LEU C 94 63.380 61.153 153.437 1.00 47.30 C ATOM 7357 C LEU C 94 63.003 59.726 153.066 1.00 47.38 C ATOM 7358 O LEU C 94 63.355 59.238 151.993 1.00 47.52 O ATOM 7359 CB LEU C 94 64.366 61.138 154.578 1.00 47.00 C ATOM 7360 CG LEU C 94 65.858 61.210 154.410 1.00 42.93 C ATOM 7361 CD1 LEU C 94 66.278 62.418 153.585 1.00 35.07 C ATOM 7362 CD2 LEU C 94 66.387 61.352 155.785 1.00 48.58 C ATOM 7363 N TYR C 95 62.221 59.073 153.921 1.00 47.14 N ATOM 7364 CA TYR C 95 61.808 57.705 153.621 1.00 46.89 C ATOM 7365 C TYR C 95 60.887 57.581 152.382 1.00 47.07 C ATOM 7366 O TYR C 95 61.046 56.668 151.604 1.00 47.86 O ATOM 7367 CB TYR C 95 61.316 56.947 154.858 1.00 46.39 C ATOM 7368 CG TYR C 95 62.424 56.753 155.898 1.00 45.60 C ATOM 7369 CD1 TYR C 95 63.755 56.591 155.504 1.00 42.44 C ATOM 7370 CD2 TYR C 95 62.145 56.763 157.257 1.00 46.61 C ATOM 7371 CE1 TYR C 95 64.760 56.448 156.425 1.00 34.86 C ATOM 7372 CE2 TYR C 95 63.144 56.605 158.188 1.00 45.78 C ATOM 7373 CZ TYR C 95 64.452 56.451 157.770 1.00 47.93 C ATOM 7374 OH TYR C 95 65.460 56.295 158.708 1.00 53.38 O ATOM 7375 N MET C 96 59.970 58.521 152.183 1.00 46.36 N ATOM 7376 CA MET C 96 59.149 58.505 150.948 1.00 46.05 C ATOM 7377 C MET C 96 60.069 58.608 149.677 1.00 45.27 C ATOM 7378 O MET C 96 59.958 57.796 148.733 1.00 44.62 O ATOM 7379 CB MET C 96 58.190 59.705 150.934 1.00 46.24 C ATOM 7380 CG MET C 96 56.788 59.385 151.243 1.00 54.20 C ATOM 7381 SD MET C 96 56.509 58.746 152.825 1.00 52.33 S ATOM 7382 CE MET C 96 54.778 58.551 152.794 1.00 52.37 C ATOM 7383 N HIS C 97 60.955 59.624 149.699 1.00 44.42 N ATOM 7384 CA HIS C 97 61.893 59.935 148.624 1.00 43.93 C ATOM 7385 C HIS C 97 62.754 58.755 148.213 1.00 43.92 C ATOM 7386 O HIS C 97 62.855 58.453 147.023 1.00 44.00 O ATOM 7387 CB HIS C 97 62.803 61.017 149.103 1.00 43.95 C ATOM 7388 CG HIS C 97 63.379 61.870 148.031 1.00 41.90 C ATOM 7389 ND1 HIS C 97 62.599 62.559 147.127 1.00 42.65 N ATOM 7390 CD2 HIS C 97 64.658 62.283 147.819 1.00 51.30 C ATOM 7391 CE1 HIS C 97 63.381 63.335 146.380 1.00 56.60 C ATOM 7392 NE2 HIS C 97 64.632 63.202 146.794 1.00 42.39 N ATOM 7393 N VAL C 98 63.376 58.083 149.190 1.00 43.75 N ATOM 7394 CA VAL C 98 64.223 56.951 148.873 1.00 44.09 C ATOM 7395 C VAL C 98 63.338 55.892 148.279 1.00 45.64 C ATOM 7396 O VAL C 98 63.618 55.352 147.192 1.00 47.00 O ATOM 7397 CB VAL C 98 64.877 56.370 150.113 1.00 43.86 C ATOM 7398 CG1 VAL C 98 65.486 54.982 149.813 1.00 39.50 C ATOM 7399 CG2 VAL C 98 65.932 57.290 150.644 1.00 42.71 C ATOM 7400 N GLY C 99 62.215 55.644 148.931 1.00 45.25 N ATOM 7401 CA GLY C 99 61.306 54.647 148.451 1.00 45.25 C ATOM 7402 C GLY C 99 60.837 54.937 147.041 1.00 45.18 C ATOM 7403 O GLY C 99 60.804 54.036 146.195 1.00 45.86 O ATOM 7404 N ARG C 100 60.522 56.195 146.768 1.00 44.23 N ATOM 7405 CA ARG C 100 59.996 56.556 145.466 1.00 43.90 C ATOM 7406 C ARG C 100 60.972 56.167 144.388 1.00 43.56 C ATOM 7407 O ARG C 100 60.610 55.617 143.373 1.00 42.44 O ATOM 7408 CB ARG C 100 59.700 58.063 145.410 1.00 43.77 C ATOM 7409 CG ARG C 100 59.132 58.545 144.073 1.00 33.10 C ATOM 7410 CD ARG C 100 60.179 58.845 143.058 1.00 41.36 C ATOM 7411 NE ARG C 100 61.346 59.409 143.696 1.00 33.88 N ATOM 7412 CZ ARG C 100 61.705 60.663 143.546 1.00 45.36 C ATOM 7413 NH1 ARG C 100 61.000 61.449 142.719 1.00 38.01 N ATOM 7414 NH2 ARG C 100 62.792 61.135 144.175 1.00 40.46 N ATOM 7415 N GLY C 101 62.227 56.458 144.639 1.00 44.33 N ATOM 7416 CA GLY C 101 63.257 56.190 143.681 1.00 44.47 C ATOM 7417 C GLY C 101 63.462 54.728 143.470 1.00 44.01 C ATOM 7418 O GLY C 101 63.752 54.287 142.353 1.00 43.80 O ATOM 7419 N LEU C 102 63.308 53.967 144.534 1.00 44.04 N ATOM 7420 CA LEU C 102 63.517 52.553 144.453 1.00 44.77 C ATOM 7421 C LEU C 102 62.434 51.949 143.569 1.00 45.21 C ATOM 7422 O LEU C 102 62.727 51.217 142.619 1.00 45.15 O ATOM 7423 CB LEU C 102 63.495 51.947 145.843 1.00 45.11 C ATOM 7424 CG LEU C 102 64.530 50.871 146.124 1.00 50.40 C ATOM 7425 CD1 LEU C 102 64.320 50.361 147.526 1.00 57.88 C ATOM 7426 CD2 LEU C 102 64.432 49.720 145.120 1.00 48.37 C ATOM 7427 N TYR C 103 61.199 52.338 143.830 1.00 45.80 N ATOM 7428 CA TYR C 103 60.070 51.840 143.082 1.00 46.86 C ATOM 7429 C TYR C 103 60.138 52.242 141.636 1.00 47.79 C ATOM 7430 O TYR C 103 59.889 51.433 140.774 1.00 49.22 O ATOM 7431 CB TYR C 103 58.773 52.363 143.689 1.00 47.18 C ATOM 7432 CG TYR C 103 57.506 51.822 143.059 1.00 48.09 C ATOM 7433 CD1 TYR C 103 56.747 50.829 143.696 1.00 39.50 C ATOM 7434 CD2 TYR C 103 57.034 52.338 141.869 1.00 47.79 C ATOM 7435 CE1 TYR C 103 55.584 50.357 143.125 1.00 31.23 C ATOM 7436 CE2 TYR C 103 55.882 51.852 141.284 1.00 48.21 C ATOM 7437 CZ TYR C 103 55.166 50.883 141.902 1.00 40.82 C ATOM 7438 OH TYR C 103 54.027 50.457 141.298 1.00 40.11 O ATOM 7439 N TYR C 104 60.488 53.486 141.365 1.00 46.95 N ATOM 7440 CA TYR C 104 60.494 53.971 140.000 1.00 46.45 C ATOM 7441 C TYR C 104 61.790 53.847 139.199 1.00 46.91 C ATOM 7442 O TYR C 104 61.844 54.295 138.072 1.00 47.22 O ATOM 7443 CB TYR C 104 59.921 55.396 139.920 1.00 45.85 C ATOM 7444 CG TYR C 104 58.454 55.434 140.230 1.00 42.64 C ATOM 7445 CD1 TYR C 104 57.990 55.892 141.468 1.00 46.16 C ATOM 7446 CD2 TYR C 104 57.526 54.945 139.323 1.00 42.08 C ATOM 7447 CE1 TYR C 104 56.631 55.892 141.785 1.00 32.76 C ATOM 7448 CE2 TYR C 104 56.145 54.953 139.617 1.00 35.48 C ATOM 7449 CZ TYR C 104 55.723 55.429 140.861 1.00 40.64 C ATOM 7450 OH TYR C 104 54.412 55.454 141.160 1.00 38.31 O ATOM 7451 N GLY C 105 62.827 53.230 139.750 1.00 46.98 N ATOM 7452 CA GLY C 105 64.080 53.107 138.989 1.00 47.43 C ATOM 7453 C GLY C 105 64.875 54.430 138.890 1.00 48.52 C ATOM 7454 O GLY C 105 65.842 54.563 138.108 1.00 49.28 O