>>1MVW:HELIX   73  73 SER D  474  GLU D  506  1                                  33    
SFEQLCINFTNELQQFFNHHMFVLEQEEYE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 73 73 SER D 474 GLU D 506 1 33 ATOM 12826 N SER D 474 -53.024 -2.694 102.783 1.00 20.00 N ATOM 12827 CA SER D 474 -52.024 -2.518 103.781 1.00 20.00 C ATOM 12828 C SER D 474 -52.285 -3.422 104.942 1.00 20.00 C ATOM 12829 O SER D 474 -53.155 -4.304 104.896 1.00 20.00 O ATOM 12830 CB SER D 474 -51.803 -1.086 104.219 1.00 20.00 C ATOM 12831 OG SER D 474 -50.420 -0.975 104.575 1.00 20.00 O ATOM 12832 N PHE D 475 -51.496 -3.172 105.978 1.00 20.00 N ATOM 12833 CA PHE D 475 -51.474 -3.958 107.190 1.00 20.00 C ATOM 12834 C PHE D 475 -52.829 -4.323 107.702 1.00 20.00 C ATOM 12835 O PHE D 475 -53.120 -5.460 108.044 1.00 20.00 O ATOM 12836 CB PHE D 475 -50.750 -3.152 108.231 1.00 20.00 C ATOM 12837 CG PHE D 475 -50.715 -3.764 109.569 1.00 20.00 C ATOM 12838 CD1 PHE D 475 -50.099 -4.996 109.812 1.00 20.00 C ATOM 12839 CD2 PHE D 475 -51.205 -3.065 110.666 1.00 20.00 C ATOM 12840 CE1 PHE D 475 -50.015 -5.542 111.100 1.00 20.00 C ATOM 12841 CE2 PHE D 475 -51.143 -3.598 111.967 1.00 20.00 C ATOM 12842 CZ PHE D 475 -50.529 -4.834 112.193 1.00 20.00 C ATOM 12843 N GLU D 476 -53.660 -3.319 107.789 1.00 20.00 N ATOM 12844 CA GLU D 476 -55.019 -3.527 108.306 1.00 20.00 C ATOM 12845 C GLU D 476 -55.788 -4.580 107.503 1.00 20.00 C ATOM 12846 O GLU D 476 -56.555 -5.378 108.027 1.00 20.00 O ATOM 12847 CB GLU D 476 -55.770 -2.210 108.417 1.00 20.00 C ATOM 12848 CG GLU D 476 -54.862 -1.002 108.859 1.00 20.00 C ATOM 12849 CD GLU D 476 -54.032 -0.377 107.779 1.00 20.00 C ATOM 12850 OE1 GLU D 476 -54.665 -0.047 106.636 1.00 20.00 O ATOM 12851 OE2 GLU D 476 -52.862 -0.217 107.913 1.00 20.00 O ATOM 12852 N GLN D 477 -55.540 -4.621 106.196 1.00 20.00 N ATOM 12853 CA GLN D 477 -56.182 -5.546 105.322 1.00 20.00 C ATOM 12854 C GLN D 477 -55.782 -6.981 105.614 1.00 20.00 C ATOM 12855 O GLN D 477 -56.546 -7.949 105.615 1.00 20.00 O ATOM 12856 CB GLN D 477 -55.953 -5.179 103.902 1.00 20.00 C ATOM 12857 CG GLN D 477 -56.916 -4.094 103.474 1.00 20.00 C ATOM 12858 CD GLN D 477 -56.482 -2.687 103.885 1.00 20.00 C ATOM 12859 OE1 GLN D 477 -55.440 -2.157 103.446 1.00 20.00 O ATOM 12860 NE2 GLN D 477 -57.279 -2.087 104.768 1.00 20.00 N ATOM 12861 N LEU D 478 -54.508 -7.136 105.826 1.00 20.00 N ATOM 12862 CA LEU D 478 -54.004 -8.449 106.168 1.00 20.00 C ATOM 12863 C LEU D 478 -54.733 -8.965 107.422 1.00 20.00 C ATOM 12864 O LEU D 478 -55.297 -10.027 107.472 1.00 20.00 O ATOM 12865 CB LEU D 478 -52.529 -8.329 106.505 1.00 20.00 C ATOM 12866 CG LEU D 478 -51.945 -9.622 106.987 1.00 20.00 C ATOM 12867 CD1 LEU D 478 -52.110 -10.554 105.762 1.00 20.00 C ATOM 12868 CD2 LEU D 478 -50.477 -9.342 107.289 1.00 20.00 C ATOM 12869 N CYS D 479 -54.756 -8.137 108.469 1.00 20.00 N ATOM 12870 CA CYS D 479 -55.375 -8.522 109.699 1.00 20.00 C ATOM 12871 C CYS D 479 -56.818 -8.955 109.490 1.00 20.00 C ATOM 12872 O CYS D 479 -57.292 -10.002 109.967 1.00 20.00 O ATOM 12873 CB CYS D 479 -55.258 -7.607 110.898 1.00 20.00 C ATOM 12874 SG CYS D 479 -53.686 -6.950 111.185 1.00 20.00 S ATOM 12875 N ILE D 480 -57.550 -8.189 108.713 1.00 20.00 N ATOM 12876 CA ILE D 480 -58.935 -8.538 108.487 1.00 20.00 C ATOM 12877 C ILE D 480 -59.068 -9.767 107.616 1.00 20.00 C ATOM 12878 O ILE D 480 -59.796 -10.682 107.929 1.00 20.00 O ATOM 12879 CB ILE D 480 -59.769 -7.411 107.954 1.00 20.00 C ATOM 12880 CG1 ILE D 480 -60.950 -7.193 108.870 1.00 20.00 C ATOM 12881 CG2 ILE D 480 -60.347 -7.934 106.679 1.00 20.00 C ATOM 12882 CD1 ILE D 480 -60.794 -5.929 109.694 1.00 20.00 C ATOM 12883 N ASN D 481 -58.329 -9.777 106.501 1.00 20.00 N ATOM 12884 CA ASN D 481 -58.393 -10.896 105.582 1.00 20.00 C ATOM 12885 C ASN D 481 -58.065 -12.166 106.302 1.00 20.00 C ATOM 12886 O ASN D 481 -58.748 -13.168 106.148 1.00 20.00 O ATOM 12887 CB ASN D 481 -57.431 -10.692 104.426 1.00 20.00 C ATOM 12888 CG ASN D 481 -57.887 -9.467 103.644 1.00 20.00 C ATOM 12889 OD1 ASN D 481 -57.491 -9.133 102.525 1.00 20.00 O ATOM 12890 ND2 ASN D 481 -58.791 -8.769 104.249 1.00 20.00 N ATOM 12891 N PHE D 482 -57.047 -12.081 107.101 1.00 20.00 N ATOM 12892 CA PHE D 482 -56.637 -13.226 107.854 1.00 20.00 C ATOM 12893 C PHE D 482 -57.761 -13.695 108.729 1.00 20.00 C ATOM 12894 O PHE D 482 -57.985 -14.838 108.887 1.00 20.00 O ATOM 12895 CB PHE D 482 -55.484 -12.793 108.745 1.00 20.00 C ATOM 12896 CG PHE D 482 -55.038 -13.923 109.628 1.00 20.00 C ATOM 12897 CD1 PHE D 482 -54.806 -15.202 109.123 1.00 20.00 C ATOM 12898 CD2 PHE D 482 -54.800 -13.668 110.972 1.00 20.00 C ATOM 12899 CE1 PHE D 482 -54.359 -16.215 109.973 1.00 20.00 C ATOM 12900 CE2 PHE D 482 -54.351 -14.667 111.818 1.00 20.00 C ATOM 12901 CZ PHE D 482 -54.120 -15.942 111.315 1.00 20.00 C ATOM 12902 N THR D 483 -58.513 -12.735 109.274 1.00 20.00 N ATOM 12903 CA THR D 483 -59.585 -13.106 110.139 1.00 20.00 C ATOM 12904 C THR D 483 -60.581 -13.886 109.358 1.00 20.00 C ATOM 12905 O THR D 483 -61.043 -14.944 109.723 1.00 20.00 O ATOM 12906 CB THR D 483 -60.264 -11.904 110.725 1.00 20.00 C ATOM 12907 OG1 THR D 483 -59.234 -11.093 111.168 1.00 20.00 O ATOM 12908 CG2 THR D 483 -61.171 -12.354 111.805 1.00 20.00 C ATOM 12909 N ASN D 484 -60.913 -13.344 108.209 1.00 20.00 N ATOM 12910 CA ASN D 484 -61.904 -13.977 107.358 1.00 20.00 C ATOM 12911 C ASN D 484 -61.443 -15.324 106.806 1.00 20.00 C ATOM 12912 O ASN D 484 -62.175 -16.294 106.753 1.00 20.00 O ATOM 12913 CB ASN D 484 -62.407 -13.035 106.249 1.00 20.00 C ATOM 12914 CG ASN D 484 -63.504 -12.073 106.689 1.00 20.00 C ATOM 12915 OD1 ASN D 484 -64.604 -12.455 107.082 1.00 20.00 O ATOM 12916 ND2 ASN D 484 -63.231 -10.806 106.592 1.00 20.00 N ATOM 12917 N GLU D 485 -60.213 -15.426 106.362 1.00 20.00 N ATOM 12918 CA GLU D 485 -59.808 -16.687 105.808 1.00 20.00 C ATOM 12919 C GLU D 485 -59.905 -17.795 106.828 1.00 20.00 C ATOM 12920 O GLU D 485 -60.028 -18.965 106.563 1.00 20.00 O ATOM 12921 CB GLU D 485 -58.394 -16.680 105.277 1.00 20.00 C ATOM 12922 CG GLU D 485 -58.160 -17.859 104.364 1.00 20.00 C ATOM 12923 CD GLU D 485 -57.573 -17.455 103.064 1.00 20.00 C ATOM 12924 OE1 GLU D 485 -57.253 -16.206 103.043 1.00 20.00 O ATOM 12925 OE2 GLU D 485 -57.441 -18.227 102.128 1.00 20.00 O HETATM12926 N MLY D 486 -59.937 -17.438 108.066 1.00 20.00 N HETATM12927 CA MLY D 486 -60.016 -18.357 109.155 1.00 20.00 C HETATM12928 CB MLY D 486 -59.469 -17.734 110.452 1.00 20.00 C HETATM12929 CG MLY D 486 -58.036 -18.105 110.805 1.00 20.00 C HETATM12930 CD MLY D 486 -57.703 -18.089 112.298 1.00 20.00 C HETATM12931 CE MLY D 486 -56.728 -19.184 112.687 1.00 20.00 C HETATM12932 NZ MLY D 486 -56.516 -19.360 114.118 1.00 20.00 N HETATM12933 CH1 MLY D 486 -55.883 -18.189 114.653 1.00 20.00 C HETATM12934 CH2 MLY D 486 -55.681 -20.531 114.352 1.00 20.00 C HETATM12935 C MLY D 486 -61.445 -18.765 109.316 1.00 20.00 C HETATM12936 O MLY D 486 -61.771 -19.924 109.369 1.00 20.00 O ATOM 12937 N LEU D 487 -62.301 -17.745 109.416 1.00 20.00 N ATOM 12938 CA LEU D 487 -63.747 -17.855 109.557 1.00 20.00 C ATOM 12939 C LEU D 487 -64.321 -18.798 108.497 1.00 20.00 C ATOM 12940 O LEU D 487 -65.106 -19.711 108.740 1.00 20.00 O ATOM 12941 CB LEU D 487 -64.309 -16.472 109.334 1.00 20.00 C ATOM 12942 CG LEU D 487 -64.722 -15.683 110.584 1.00 20.00 C ATOM 12943 CD1 LEU D 487 -64.280 -16.222 111.875 1.00 20.00 C ATOM 12944 CD2 LEU D 487 -64.216 -14.286 110.451 1.00 20.00 C ATOM 12945 N GLN D 488 -63.834 -18.607 107.276 1.00 20.00 N ATOM 12946 CA GLN D 488 -64.189 -19.424 106.132 1.00 20.00 C ATOM 12947 C GLN D 488 -63.917 -20.909 106.334 1.00 20.00 C ATOM 12948 O GLN D 488 -64.789 -21.733 106.141 1.00 20.00 O ATOM 12949 CB GLN D 488 -63.465 -18.986 104.875 1.00 20.00 C ATOM 12950 CG GLN D 488 -64.092 -19.628 103.657 1.00 20.00 C ATOM 12951 CD GLN D 488 -65.579 -19.443 103.640 1.00 20.00 C ATOM 12952 OE1 GLN D 488 -66.078 -18.309 103.786 1.00 20.00 O ATOM 12953 NE2 GLN D 488 -66.278 -20.571 103.566 1.00 20.00 N ATOM 12954 N GLN D 489 -62.682 -21.225 106.722 1.00 20.00 N ATOM 12955 CA GLN D 489 -62.261 -22.566 106.994 1.00 20.00 C ATOM 12956 C GLN D 489 -63.095 -23.151 108.041 1.00 20.00 C ATOM 12957 O GLN D 489 -63.376 -24.332 108.059 1.00 20.00 O ATOM 12958 CB GLN D 489 -60.812 -22.660 107.405 1.00 20.00 C ATOM 12959 CG GLN D 489 -60.292 -24.121 107.546 1.00 20.00 C ATOM 12960 CD GLN D 489 -58.860 -24.210 108.084 1.00 20.00 C ATOM 12961 OE1 GLN D 489 -58.563 -23.661 109.170 1.00 20.00 O ATOM 12962 NE2 GLN D 489 -57.976 -24.887 107.308 1.00 20.00 N ATOM 12963 N PHE D 490 -63.556 -22.237 108.880 1.00 20.00 N ATOM 12964 CA PHE D 490 -64.385 -22.613 110.035 1.00 20.00 C ATOM 12965 C PHE D 490 -65.701 -23.165 109.598 1.00 20.00 C ATOM 12966 O PHE D 490 -66.281 -24.093 110.130 1.00 20.00 O ATOM 12967 CB PHE D 490 -64.642 -21.407 110.883 1.00 20.00 C ATOM 12968 CG PHE D 490 -65.551 -21.706 112.040 1.00 20.00 C ATOM 12969 CD1 PHE D 490 -65.291 -22.739 112.926 1.00 20.00 C ATOM 12970 CD2 PHE D 490 -66.701 -20.953 112.248 1.00 20.00 C ATOM 12971 CE1 PHE D 490 -66.130 -23.018 114.002 1.00 20.00 C ATOM 12972 CE2 PHE D 490 -67.562 -21.226 113.307 1.00 20.00 C ATOM 12973 CZ PHE D 490 -67.277 -22.261 114.193 1.00 20.00 C ATOM 12974 N PHE D 491 -66.163 -22.571 108.525 1.00 20.00 N ATOM 12975 CA PHE D 491 -67.382 -22.977 107.891 1.00 20.00 C ATOM 12976 C PHE D 491 -67.196 -24.275 107.099 1.00 20.00 C ATOM 12977 O PHE D 491 -67.806 -25.281 107.388 1.00 20.00 O ATOM 12978 CB PHE D 491 -67.715 -21.847 106.997 1.00 20.00 C ATOM 12979 CG PHE D 491 -68.818 -22.131 106.044 1.00 20.00 C ATOM 12980 CD1 PHE D 491 -70.146 -21.985 106.467 1.00 20.00 C ATOM 12981 CD2 PHE D 491 -68.541 -22.507 104.736 1.00 20.00 C ATOM 12982 CE1 PHE D 491 -71.200 -22.234 105.593 1.00 20.00 C ATOM 12983 CE2 PHE D 491 -69.591 -22.777 103.845 1.00 20.00 C ATOM 12984 CZ PHE D 491 -70.900 -22.624 104.280 1.00 20.00 C ATOM 12985 N ASN D 492 -66.296 -24.212 106.116 1.00 20.00 N ATOM 12986 CA ASN D 492 -65.960 -25.332 105.243 1.00 20.00 C ATOM 12987 C ASN D 492 -65.848 -26.639 105.990 1.00 20.00 C ATOM 12988 O ASN D 492 -66.023 -27.707 105.482 1.00 20.00 O ATOM 12989 CB ASN D 492 -64.609 -25.120 104.541 1.00 20.00 C ATOM 12990 CG ASN D 492 -64.644 -24.078 103.479 1.00 20.00 C ATOM 12991 OD1 ASN D 492 -65.339 -23.121 103.635 1.00 20.00 O ATOM 12992 ND2 ASN D 492 -63.794 -24.236 102.467 1.00 20.00 N ATOM 12993 N HIS D 493 -65.464 -26.522 107.236 1.00 20.00 N ATOM 12994 CA HIS D 493 -65.329 -27.692 108.034 1.00 20.00 C ATOM 12995 C HIS D 493 -66.669 -28.131 108.555 1.00 20.00 C ATOM 12996 O HIS D 493 -67.095 -29.276 108.373 1.00 20.00 O ATOM 12997 CB HIS D 493 -64.347 -27.389 109.186 1.00 20.00 C ATOM 12998 CG HIS D 493 -64.173 -28.499 110.184 1.00 20.00 C ATOM 12999 ND1 HIS D 493 -63.061 -29.305 110.199 1.00 20.00 N ATOM 13000 CD2 HIS D 493 -64.941 -28.901 111.193 1.00 20.00 C ATOM 13001 CE1 HIS D 493 -63.198 -30.139 111.218 1.00 20.00 C ATOM 13002 NE2 HIS D 493 -64.319 -29.914 111.857 1.00 20.00 N ATOM 13003 N HIS D 494 -67.368 -27.179 109.151 1.00 20.00 N ATOM 13004 CA HIS D 494 -68.688 -27.410 109.732 1.00 20.00 C ATOM 13005 C HIS D 494 -69.555 -28.033 108.686 1.00 20.00 C ATOM 13006 O HIS D 494 -70.349 -28.882 108.910 1.00 20.00 O ATOM 13007 CB HIS D 494 -69.285 -26.097 110.126 1.00 20.00 C ATOM 13008 CG HIS D 494 -70.687 -26.183 110.584 1.00 20.00 C ATOM 13009 ND1 HIS D 494 -70.993 -26.702 111.823 1.00 20.00 N ATOM 13010 CD2 HIS D 494 -71.843 -25.738 110.024 1.00 20.00 C ATOM 13011 CE1 HIS D 494 -72.329 -26.604 111.982 1.00 20.00 C ATOM 13012 NE2 HIS D 494 -72.884 -26.039 110.918 1.00 20.00 N ATOM 13013 N MET D 495 -69.296 -27.676 107.467 1.00 20.00 N ATOM 13014 CA MET D 495 -70.058 -28.213 106.390 1.00 20.00 C ATOM 13015 C MET D 495 -69.641 -29.621 106.058 1.00 20.00 C ATOM 13016 O MET D 495 -70.424 -30.494 105.665 1.00 20.00 O ATOM 13017 CB MET D 495 -70.036 -27.303 105.139 1.00 20.00 C ATOM 13018 CG MET D 495 -71.457 -27.038 104.609 1.00 20.00 C ATOM 13019 SD MET D 495 -71.384 -26.911 102.863 1.00 20.00 S ATOM 13020 CE MET D 495 -73.069 -26.233 102.672 1.00 20.00 C ATOM 13021 N PHE D 496 -68.375 -29.871 106.259 1.00 20.00 N ATOM 13022 CA PHE D 496 -67.868 -31.152 105.964 1.00 20.00 C ATOM 13023 C PHE D 496 -68.347 -32.091 106.999 1.00 20.00 C ATOM 13024 O PHE D 496 -68.760 -33.143 106.732 1.00 20.00 O ATOM 13025 CB PHE D 496 -66.386 -31.057 106.069 1.00 20.00 C ATOM 13026 CG PHE D 496 -65.686 -32.362 106.328 1.00 20.00 C ATOM 13027 CD1 PHE D 496 -65.415 -32.759 107.628 1.00 20.00 C ATOM 13028 CD2 PHE D 496 -65.194 -33.134 105.271 1.00 20.00 C ATOM 13029 CE1 PHE D 496 -64.687 -33.920 107.889 1.00 20.00 C ATOM 13030 CE2 PHE D 496 -64.478 -34.300 105.489 1.00 20.00 C ATOM 13031 CZ PHE D 496 -64.259 -34.689 106.804 1.00 20.00 C ATOM 13032 N VAL D 497 -68.340 -31.655 108.165 1.00 20.00 N ATOM 13033 CA VAL D 497 -68.841 -32.448 109.231 1.00 20.00 C ATOM 13034 C VAL D 497 -70.278 -32.762 109.014 1.00 20.00 C ATOM 13035 O VAL D 497 -70.708 -33.880 109.094 1.00 20.00 O ATOM 13036 CB VAL D 497 -68.743 -31.608 110.484 1.00 20.00 C ATOM 13037 CG1 VAL D 497 -69.534 -32.321 111.551 1.00 20.00 C ATOM 13038 CG2 VAL D 497 -67.264 -31.375 110.791 1.00 20.00 C ATOM 13039 N LEU D 498 -71.032 -31.707 108.747 1.00 20.00 N ATOM 13040 CA LEU D 498 -72.469 -31.713 108.506 1.00 20.00 C ATOM 13041 C LEU D 498 -72.885 -32.630 107.362 1.00 20.00 C ATOM 13042 O LEU D 498 -73.736 -33.489 107.499 1.00 20.00 O ATOM 13043 CB LEU D 498 -72.918 -30.279 108.164 1.00 20.00 C ATOM 13044 CG LEU D 498 -74.240 -29.900 108.763 1.00 20.00 C ATOM 13045 CD1 LEU D 498 -74.039 -29.478 110.206 1.00 20.00 C ATOM 13046 CD2 LEU D 498 -74.839 -28.781 107.917 1.00 20.00 C ATOM 13047 N GLU D 499 -72.264 -32.398 106.202 1.00 20.00 N ATOM 13048 CA GLU D 499 -72.525 -33.193 105.015 1.00 20.00 C ATOM 13049 C GLU D 499 -72.469 -34.691 105.322 1.00 20.00 C ATOM 13050 O GLU D 499 -73.404 -35.458 105.128 1.00 20.00 O ATOM 13051 CB GLU D 499 -71.412 -32.951 104.061 1.00 20.00 C ATOM 13052 CG GLU D 499 -71.737 -31.957 103.001 1.00 20.00 C ATOM 13053 CD GLU D 499 -72.950 -32.382 102.248 1.00 20.00 C ATOM 13054 OE1 GLU D 499 -74.055 -32.307 102.750 1.00 20.00 O ATOM 13055 OE2 GLU D 499 -72.721 -32.768 101.013 1.00 20.00 O ATOM 13056 N GLN D 500 -71.313 -35.081 105.783 1.00 20.00 N ATOM 13057 CA GLN D 500 -70.962 -36.403 106.146 1.00 20.00 C ATOM 13058 C GLN D 500 -71.944 -37.098 107.095 1.00 20.00 C ATOM 13059 O GLN D 500 -72.037 -38.315 107.191 1.00 20.00 O ATOM 13060 CB GLN D 500 -69.452 -36.474 106.529 1.00 20.00 C ATOM 13061 CG GLN D 500 -68.996 -37.628 107.430 1.00 20.00 C ATOM 13062 CD GLN D 500 -67.548 -37.481 107.886 1.00 20.00 C ATOM 13063 OE1 GLN D 500 -67.268 -36.991 109.032 1.00 20.00 O ATOM 13064 NE2 GLN D 500 -66.639 -37.948 106.973 1.00 20.00 N ATOM 13065 N GLU D 501 -72.767 -36.321 107.754 1.00 20.00 N ATOM 13066 CA GLU D 501 -73.722 -36.915 108.651 1.00 20.00 C ATOM 13067 C GLU D 501 -74.837 -37.486 107.801 1.00 20.00 C ATOM 13068 O GLU D 501 -75.334 -38.578 108.059 1.00 20.00 O ATOM 13069 CB GLU D 501 -74.339 -35.848 109.570 1.00 20.00 C ATOM 13070 CG GLU D 501 -74.362 -36.217 111.055 1.00 20.00 C ATOM 13071 CD GLU D 501 -74.654 -35.012 111.910 1.00 20.00 C ATOM 13072 OE1 GLU D 501 -73.884 -33.998 111.636 1.00 20.00 O ATOM 13073 OE2 GLU D 501 -75.507 -34.982 112.762 1.00 20.00 O ATOM 13074 N GLU D 502 -75.233 -36.726 106.777 1.00 20.00 N ATOM 13075 CA GLU D 502 -76.321 -37.137 105.896 1.00 20.00 C ATOM 13076 C GLU D 502 -75.966 -38.448 105.262 1.00 20.00 C ATOM 13077 O GLU D 502 -76.640 -39.449 105.466 1.00 20.00 O ATOM 13078 CB GLU D 502 -76.681 -36.109 104.786 1.00 20.00 C ATOM 13079 CG GLU D 502 -78.142 -36.236 104.275 1.00 20.00 C ATOM 13080 CD GLU D 502 -79.115 -35.745 105.310 1.00 20.00 C ATOM 13081 OE1 GLU D 502 -78.895 -34.751 105.981 1.00 20.00 O ATOM 13082 OE2 GLU D 502 -80.180 -36.515 105.440 1.00 20.00 O ATOM 13083 N TYR D 503 -74.873 -38.443 104.520 1.00 20.00 N ATOM 13084 CA TYR D 503 -74.460 -39.677 103.893 1.00 20.00 C ATOM 13085 C TYR D 503 -74.345 -40.851 104.880 1.00 20.00 C ATOM 13086 O TYR D 503 -74.257 -42.000 104.493 1.00 20.00 O ATOM 13087 CB TYR D 503 -73.144 -39.436 103.159 1.00 20.00 C ATOM 13088 CG TYR D 503 -73.219 -38.298 102.177 1.00 20.00 C ATOM 13089 CD1 TYR D 503 -74.366 -37.975 101.475 1.00 20.00 C ATOM 13090 CD2 TYR D 503 -72.074 -37.566 101.925 1.00 20.00 C ATOM 13091 CE1 TYR D 503 -74.356 -36.969 100.521 1.00 20.00 C ATOM 13092 CE2 TYR D 503 -72.058 -36.530 100.998 1.00 20.00 C ATOM 13093 CZ TYR D 503 -73.212 -36.231 100.298 1.00 20.00 C ATOM 13094 OH TYR D 503 -73.250 -35.236 99.347 1.00 20.00 O HETATM13095 N MLY D 504 -74.380 -40.538 106.162 1.00 20.00 N HETATM13096 CA MLY D 504 -74.241 -41.519 107.204 1.00 20.00 C HETATM13097 CB MLY D 504 -73.371 -40.999 108.328 1.00 20.00 C HETATM13098 CG MLY D 504 -73.401 -41.873 109.578 1.00 20.00 C HETATM13099 CD MLY D 504 -72.039 -42.489 109.904 1.00 20.00 C HETATM13100 CE MLY D 504 -72.137 -43.663 110.875 1.00 20.00 C HETATM13101 NZ MLY D 504 -71.108 -43.640 111.920 1.00 20.00 N HETATM13102 CH1 MLY D 504 -70.619 -45.019 112.160 1.00 20.00 C HETATM13103 CH2 MLY D 504 -71.674 -43.072 113.179 1.00 20.00 C HETATM13104 C MLY D 504 -75.621 -41.899 107.669 1.00 20.00 C HETATM13105 O MLY D 504 -75.926 -43.066 107.934 1.00 20.00 O HETATM13106 N MLY D 505 -76.467 -40.882 107.724 1.00 20.00 N HETATM13107 CA MLY D 505 -77.866 -41.030 108.108 1.00 20.00 C HETATM13108 CB MLY D 505 -78.488 -39.663 108.182 1.00 20.00 C HETATM13109 CG MLY D 505 -79.435 -39.493 109.330 1.00 20.00 C HETATM13110 CD MLY D 505 -79.921 -38.048 109.482 1.00 20.00 C HETATM13111 CE MLY D 505 -79.447 -37.400 110.768 1.00 20.00 C HETATM13112 NZ MLY D 505 -79.569 -35.944 110.759 1.00 20.00 N HETATM13113 CH1 MLY D 505 -78.296 -35.359 111.181 1.00 20.00 C HETATM13114 CH2 MLY D 505 -80.670 -35.531 111.661 1.00 20.00 C HETATM13115 C MLY D 505 -78.573 -41.866 107.014 1.00 20.00 C HETATM13116 O MLY D 505 -79.184 -42.911 107.217 1.00 20.00 O ATOM 13117 N GLU D 506 -78.412 -41.439 105.776 1.00 20.00 N ATOM 13118 CA GLU D 506 -78.993 -42.122 104.650 1.00 20.00 C ATOM 13119 C GLU D 506 -78.315 -43.438 104.353 1.00 20.00 C ATOM 13120 O GLU D 506 -78.947 -44.454 104.095 1.00 20.00 O ATOM 13121 CB GLU D 506 -78.950 -41.219 103.403 1.00 20.00 C ATOM 13122 CG GLU D 506 -80.287 -40.523 103.058 1.00 20.00 C ATOM 13123 CD GLU D 506 -81.147 -40.158 104.249 1.00 20.00 C ATOM 13124 OE1 GLU D 506 -80.779 -40.153 105.391 1.00 20.00 O ATOM 13125 OE2 GLU D 506 -82.384 -39.848 103.957 1.00 20.00 O