>>1MVW:HELIX  234 234 THR M  418  LEU M  449  1                                  32    
TVSEVHNSVGALAAVYEMFLWMVIRINQQL
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 234 234 THR M 418 LEU M 449 1 32 ATOM 39514 N THR M 418 10.950 -53.979 -21.668 1.00 20.00 N ATOM 39515 CA THR M 418 10.693 -54.924 -22.717 1.00 20.00 C ATOM 39516 C THR M 418 11.774 -55.969 -22.754 1.00 20.00 C ATOM 39517 O THR M 418 12.828 -55.793 -22.142 1.00 20.00 O ATOM 39518 CB THR M 418 10.749 -54.217 -24.064 1.00 20.00 C ATOM 39519 OG1 THR M 418 9.980 -53.054 -23.985 1.00 20.00 O ATOM 39520 CG2 THR M 418 10.244 -55.145 -25.150 1.00 20.00 C ATOM 39521 N VAL M 419 11.514 -57.013 -23.516 1.00 20.00 N ATOM 39522 CA VAL M 419 12.449 -58.085 -23.652 1.00 20.00 C ATOM 39523 C VAL M 419 13.751 -57.478 -24.194 1.00 20.00 C ATOM 39524 O VAL M 419 14.811 -57.551 -23.610 1.00 20.00 O ATOM 39525 CB VAL M 419 11.887 -59.137 -24.580 1.00 20.00 C ATOM 39526 CG1 VAL M 419 12.793 -60.330 -24.689 1.00 20.00 C ATOM 39527 CG2 VAL M 419 10.488 -59.548 -24.122 1.00 20.00 C ATOM 39528 N SER M 420 13.632 -56.779 -25.290 1.00 20.00 N ATOM 39529 CA SER M 420 14.782 -56.113 -25.913 1.00 20.00 C ATOM 39530 C SER M 420 15.490 -55.185 -24.983 1.00 20.00 C ATOM 39531 O SER M 420 16.654 -54.959 -25.130 1.00 20.00 O ATOM 39532 CB SER M 420 14.400 -55.330 -27.162 1.00 20.00 C ATOM 39533 OG SER M 420 13.990 -56.212 -28.197 1.00 20.00 O ATOM 39534 N GLU M 421 14.769 -54.619 -24.042 1.00 20.00 N ATOM 39535 CA GLU M 421 15.354 -53.685 -23.125 1.00 20.00 C ATOM 39536 C GLU M 421 16.198 -54.352 -22.058 1.00 20.00 C ATOM 39537 O GLU M 421 17.241 -53.804 -21.577 1.00 20.00 O ATOM 39538 CB GLU M 421 14.291 -52.810 -22.452 1.00 20.00 C ATOM 39539 CG GLU M 421 13.298 -52.195 -23.435 1.00 20.00 C ATOM 39540 CD GLU M 421 12.562 -51.051 -22.832 1.00 20.00 C ATOM 39541 OE1 GLU M 421 11.643 -51.198 -22.053 1.00 20.00 O ATOM 39542 OE2 GLU M 421 12.999 -49.880 -23.239 1.00 20.00 O ATOM 39543 N VAL M 422 15.790 -55.562 -21.710 1.00 20.00 N ATOM 39544 CA VAL M 422 16.482 -56.288 -20.669 1.00 20.00 C ATOM 39545 C VAL M 422 17.774 -56.797 -21.164 1.00 20.00 C ATOM 39546 O VAL M 422 18.800 -56.453 -20.615 1.00 20.00 O ATOM 39547 CB VAL M 422 15.683 -57.374 -20.028 1.00 20.00 C ATOM 39548 CG1 VAL M 422 16.461 -57.825 -18.806 1.00 20.00 C ATOM 39549 CG2 VAL M 422 14.290 -56.831 -19.640 1.00 20.00 C ATOM 39550 N HIS M 423 17.666 -57.550 -22.253 1.00 20.00 N ATOM 39551 CA HIS M 423 18.835 -58.155 -22.884 1.00 20.00 C ATOM 39552 C HIS M 423 19.916 -57.120 -23.032 1.00 20.00 C ATOM 39553 O HIS M 423 21.085 -57.350 -22.760 1.00 20.00 O ATOM 39554 CB HIS M 423 18.543 -58.844 -24.245 1.00 20.00 C ATOM 39555 CG HIS M 423 17.840 -60.198 -24.185 1.00 20.00 C ATOM 39556 ND1 HIS M 423 17.974 -61.078 -23.112 1.00 20.00 N ATOM 39557 CD2 HIS M 423 17.012 -60.810 -25.097 1.00 20.00 C ATOM 39558 CE1 HIS M 423 17.202 -62.157 -23.374 1.00 20.00 C ATOM 39559 NE2 HIS M 423 16.592 -62.019 -24.565 1.00 20.00 N ATOM 39560 N ASN M 424 19.503 -55.917 -23.382 1.00 20.00 N ATOM 39561 CA ASN M 424 20.433 -54.834 -23.560 1.00 20.00 C ATOM 39562 C ASN M 424 20.924 -54.342 -22.210 1.00 20.00 C ATOM 39563 O ASN M 424 22.125 -54.102 -22.031 1.00 20.00 O ATOM 39564 CB ASN M 424 19.960 -53.698 -24.513 1.00 20.00 C ATOM 39565 CG ASN M 424 19.774 -54.043 -25.992 1.00 20.00 C ATOM 39566 OD1 ASN M 424 19.121 -53.303 -26.706 1.00 20.00 O ATOM 39567 ND2 ASN M 424 20.355 -55.168 -26.448 1.00 20.00 N ATOM 39568 N SER M 425 20.060 -54.266 -21.206 1.00 20.00 N ATOM 39569 CA SER M 425 20.585 -53.764 -19.922 1.00 20.00 C ATOM 39570 C SER M 425 21.572 -54.692 -19.262 1.00 20.00 C ATOM 39571 O SER M 425 22.563 -54.317 -18.632 1.00 20.00 O ATOM 39572 CB SER M 425 19.597 -53.156 -18.945 1.00 20.00 C ATOM 39573 OG SER M 425 18.713 -54.137 -18.473 1.00 20.00 O ATOM 39574 N VAL M 426 21.290 -55.938 -19.395 1.00 20.00 N ATOM 39575 CA VAL M 426 22.126 -56.973 -18.865 1.00 20.00 C ATOM 39576 C VAL M 426 23.517 -56.777 -19.416 1.00 20.00 C ATOM 39577 O VAL M 426 24.494 -56.581 -18.711 1.00 20.00 O ATOM 39578 CB VAL M 426 21.588 -58.350 -19.273 1.00 20.00 C ATOM 39579 CG1 VAL M 426 22.557 -59.449 -18.870 1.00 20.00 C ATOM 39580 CG2 VAL M 426 20.282 -58.605 -18.611 1.00 20.00 C ATOM 39581 N GLY M 427 23.570 -56.748 -20.722 1.00 20.00 N ATOM 39582 CA GLY M 427 24.788 -56.522 -21.428 1.00 20.00 C ATOM 39583 C GLY M 427 25.479 -55.282 -20.922 1.00 20.00 C ATOM 39584 O GLY M 427 26.703 -55.195 -20.794 1.00 20.00 O ATOM 39585 N ALA M 428 24.689 -54.292 -20.563 1.00 20.00 N ATOM 39586 CA ALA M 428 25.314 -53.104 -20.043 1.00 20.00 C ATOM 39587 C ALA M 428 25.971 -53.296 -18.728 1.00 20.00 C ATOM 39588 O ALA M 428 27.036 -52.692 -18.477 1.00 20.00 O ATOM 39589 CB ALA M 428 24.454 -51.914 -19.967 1.00 20.00 C ATOM 39590 N LEU M 429 25.358 -54.120 -17.890 1.00 20.00 N ATOM 39591 CA LEU M 429 26.030 -54.359 -16.600 1.00 20.00 C ATOM 39592 C LEU M 429 27.270 -55.221 -16.761 1.00 20.00 C ATOM 39593 O LEU M 429 28.343 -54.858 -16.246 1.00 20.00 O ATOM 39594 CB LEU M 429 25.048 -54.906 -15.584 1.00 20.00 C ATOM 39595 CG LEU M 429 23.875 -53.939 -15.450 1.00 20.00 C ATOM 39596 CD1 LEU M 429 22.621 -54.655 -15.134 1.00 20.00 C ATOM 39597 CD2 LEU M 429 24.254 -52.995 -14.351 1.00 20.00 C ATOM 39598 N ALA M 430 27.132 -56.311 -17.556 1.00 20.00 N ATOM 39599 CA ALA M 430 28.182 -57.221 -17.854 1.00 20.00 C ATOM 39600 C ALA M 430 29.412 -56.440 -18.182 1.00 20.00 C ATOM 39601 O ALA M 430 30.469 -56.560 -17.560 1.00 20.00 O ATOM 39602 CB ALA M 430 27.861 -58.054 -19.084 1.00 20.00 C HETATM39603 N MLY M 431 29.244 -55.527 -19.122 1.00 20.00 N HETATM39604 CA MLY M 431 30.347 -54.674 -19.521 1.00 20.00 C HETATM39605 CB MLY M 431 30.037 -53.769 -20.701 1.00 20.00 C HETATM39606 CG MLY M 431 29.909 -54.406 -22.050 1.00 20.00 C HETATM39607 CD MLY M 431 28.669 -53.989 -22.773 1.00 20.00 C HETATM39608 CE MLY M 431 28.860 -52.865 -23.767 1.00 20.00 C HETATM39609 NZ MLY M 431 27.737 -52.693 -24.680 1.00 20.00 N HETATM39610 CH1 MLY M 431 28.161 -52.779 -26.075 1.00 20.00 C HETATM39611 CH2 MLY M 431 27.172 -51.363 -24.416 1.00 20.00 C HETATM39612 C MLY M 431 30.773 -53.778 -18.391 1.00 20.00 C HETATM39613 O MLY M 431 31.948 -53.578 -18.129 1.00 20.00 O ATOM 39614 N ALA M 432 29.806 -53.116 -17.771 1.00 20.00 N ATOM 39615 CA ALA M 432 30.102 -52.200 -16.688 1.00 20.00 C ATOM 39616 C ALA M 432 30.954 -52.844 -15.617 1.00 20.00 C ATOM 39617 O ALA M 432 31.979 -52.351 -15.213 1.00 20.00 O ATOM 39618 CB ALA M 432 28.851 -51.811 -16.032 1.00 20.00 C ATOM 39619 N VAL M 433 30.479 -53.978 -15.148 1.00 20.00 N ATOM 39620 CA VAL M 433 31.175 -54.743 -14.129 1.00 20.00 C ATOM 39621 C VAL M 433 32.585 -55.145 -14.457 1.00 20.00 C ATOM 39622 O VAL M 433 33.518 -54.975 -13.664 1.00 20.00 O ATOM 39623 CB VAL M 433 30.411 -55.995 -13.810 1.00 20.00 C ATOM 39624 CG1 VAL M 433 31.080 -56.698 -12.658 1.00 20.00 C ATOM 39625 CG2 VAL M 433 28.984 -55.653 -13.429 1.00 20.00 C ATOM 39626 N TYR M 434 32.735 -55.703 -15.654 1.00 20.00 N ATOM 39627 CA TYR M 434 34.048 -56.111 -16.136 1.00 20.00 C ATOM 39628 C TYR M 434 35.029 -54.972 -16.086 1.00 20.00 C ATOM 39629 O TYR M 434 36.088 -55.073 -15.493 1.00 20.00 O ATOM 39630 CB TYR M 434 33.927 -56.366 -17.548 1.00 20.00 C ATOM 39631 CG TYR M 434 35.146 -57.098 -17.991 1.00 20.00 C ATOM 39632 CD1 TYR M 434 35.232 -58.468 -17.827 1.00 20.00 C ATOM 39633 CD2 TYR M 434 36.202 -56.435 -18.575 1.00 20.00 C ATOM 39634 CE1 TYR M 434 36.354 -59.161 -18.262 1.00 20.00 C ATOM 39635 CE2 TYR M 434 37.340 -57.105 -19.027 1.00 20.00 C ATOM 39636 CZ TYR M 434 37.415 -58.476 -18.842 1.00 20.00 C ATOM 39637 OH TYR M 434 38.518 -59.159 -19.257 1.00 20.00 O ATOM 39638 N GLU M 435 34.617 -53.860 -16.730 1.00 20.00 N ATOM 39639 CA GLU M 435 35.403 -52.665 -16.748 1.00 20.00 C ATOM 39640 C GLU M 435 35.923 -52.285 -15.420 1.00 20.00 C ATOM 39641 O GLU M 435 37.096 -52.484 -15.134 1.00 20.00 O ATOM 39642 CB GLU M 435 34.689 -51.481 -17.288 1.00 20.00 C ATOM 39643 CG GLU M 435 35.581 -50.248 -17.050 1.00 20.00 C ATOM 39644 CD GLU M 435 35.119 -49.079 -17.880 1.00 20.00 C ATOM 39645 OE1 GLU M 435 33.834 -48.947 -17.841 1.00 20.00 O ATOM 39646 OE2 GLU M 435 35.840 -48.364 -18.538 1.00 20.00 O HETATM39647 N MLY M 436 35.027 -51.779 -14.610 1.00 20.00 N HETATM39648 CA MLY M 436 35.270 -51.399 -13.206 1.00 20.00 C HETATM39649 CB MLY M 436 34.040 -51.592 -12.386 1.00 20.00 C HETATM39650 CG MLY M 436 33.326 -50.317 -12.036 1.00 20.00 C HETATM39651 CD MLY M 436 32.203 -50.050 -13.004 1.00 20.00 C HETATM39652 CE MLY M 436 32.067 -48.577 -13.305 1.00 20.00 C HETATM39653 NZ MLY M 436 30.857 -48.280 -14.096 1.00 20.00 N HETATM39654 CH1 MLY M 436 31.118 -48.413 -15.549 1.00 20.00 C HETATM39655 CH2 MLY M 436 30.391 -46.930 -13.772 1.00 20.00 C HETATM39656 C MLY M 436 36.294 -52.281 -12.534 1.00 20.00 C HETATM39657 O MLY M 436 37.312 -51.840 -12.022 1.00 20.00 O ATOM 39658 N MET M 437 36.022 -53.559 -12.628 1.00 20.00 N ATOM 39659 CA MET M 437 36.884 -54.578 -12.060 1.00 20.00 C ATOM 39660 C MET M 437 38.272 -54.391 -12.558 1.00 20.00 C ATOM 39661 O MET M 437 39.261 -54.342 -11.822 1.00 20.00 O ATOM 39662 CB MET M 437 36.419 -55.959 -12.493 1.00 20.00 C ATOM 39663 CG MET M 437 37.332 -57.062 -11.961 1.00 20.00 C ATOM 39664 SD MET M 437 36.451 -58.658 -12.007 1.00 20.00 S ATOM 39665 CE MET M 437 36.940 -59.462 -13.489 1.00 20.00 C ATOM 39666 N PHE M 438 38.344 -54.299 -13.853 1.00 20.00 N ATOM 39667 CA PHE M 438 39.619 -54.104 -14.493 1.00 20.00 C ATOM 39668 C PHE M 438 40.292 -52.903 -13.960 1.00 20.00 C ATOM 39669 O PHE M 438 41.463 -52.863 -13.722 1.00 20.00 O ATOM 39670 CB PHE M 438 39.391 -53.900 -15.957 1.00 20.00 C ATOM 39671 CG PHE M 438 40.658 -53.668 -16.693 1.00 20.00 C ATOM 39672 CD1 PHE M 438 41.412 -54.742 -17.118 1.00 20.00 C ATOM 39673 CD2 PHE M 438 41.083 -52.390 -17.005 1.00 20.00 C ATOM 39674 CE1 PHE M 438 42.582 -54.549 -17.846 1.00 20.00 C ATOM 39675 CE2 PHE M 438 42.250 -52.182 -17.739 1.00 20.00 C ATOM 39676 CZ PHE M 438 42.997 -53.269 -18.137 1.00 20.00 C ATOM 39677 N LEU M 439 39.480 -51.862 -13.735 1.00 20.00 N ATOM 39678 CA LEU M 439 40.034 -50.632 -13.190 1.00 20.00 C ATOM 39679 C LEU M 439 40.582 -50.878 -11.807 1.00 20.00 C ATOM 39680 O LEU M 439 41.668 -50.526 -11.439 1.00 20.00 O ATOM 39681 CB LEU M 439 39.014 -49.491 -13.187 1.00 20.00 C ATOM 39682 CG LEU M 439 38.830 -48.781 -14.527 1.00 20.00 C ATOM 39683 CD1 LEU M 439 39.172 -49.772 -15.585 1.00 20.00 C ATOM 39684 CD2 LEU M 439 37.360 -48.458 -14.674 1.00 20.00 C ATOM 39685 N TRP M 440 39.793 -51.563 -11.024 1.00 20.00 N ATOM 39686 CA TRP M 440 40.148 -51.886 -9.671 1.00 20.00 C ATOM 39687 C TRP M 440 41.472 -52.619 -9.595 1.00 20.00 C ATOM 39688 O TRP M 440 42.352 -52.255 -8.813 1.00 20.00 O ATOM 39689 CB TRP M 440 39.081 -52.798 -9.141 1.00 20.00 C ATOM 39690 CG TRP M 440 39.359 -53.356 -7.789 1.00 20.00 C ATOM 39691 CD1 TRP M 440 39.467 -52.653 -6.668 1.00 20.00 C ATOM 39692 CD2 TRP M 440 39.456 -54.740 -7.381 1.00 20.00 C ATOM 39693 NE1 TRP M 440 39.675 -53.494 -5.611 1.00 20.00 N ATOM 39694 CE2 TRP M 440 39.658 -54.763 -6.019 1.00 20.00 C ATOM 39695 CE3 TRP M 440 39.430 -55.952 -8.065 1.00 20.00 C ATOM 39696 CZ2 TRP M 440 39.829 -55.932 -5.343 1.00 20.00 C ATOM 39697 CZ3 TRP M 440 39.624 -57.122 -7.416 1.00 20.00 C ATOM 39698 CH2 TRP M 440 39.794 -57.102 -6.066 1.00 20.00 C ATOM 39699 N MET M 441 41.560 -53.688 -10.391 1.00 20.00 N ATOM 39700 CA MET M 441 42.758 -54.508 -10.421 1.00 20.00 C ATOM 39701 C MET M 441 43.952 -53.638 -10.592 1.00 20.00 C ATOM 39702 O MET M 441 44.936 -53.758 -9.891 1.00 20.00 O ATOM 39703 CB MET M 441 42.668 -55.462 -11.582 1.00 20.00 C ATOM 39704 CG MET M 441 42.290 -56.821 -11.139 1.00 20.00 C ATOM 39705 SD MET M 441 42.219 -57.941 -12.507 1.00 20.00 S ATOM 39706 CE MET M 441 41.003 -57.162 -13.530 1.00 20.00 C ATOM 39707 N VAL M 442 43.804 -52.709 -11.533 1.00 20.00 N ATOM 39708 CA VAL M 442 44.901 -51.790 -11.768 1.00 20.00 C ATOM 39709 C VAL M 442 45.250 -51.039 -10.511 1.00 20.00 C ATOM 39710 O VAL M 442 46.384 -51.037 -10.080 1.00 20.00 O ATOM 39711 CB VAL M 442 44.602 -50.811 -12.848 1.00 20.00 C ATOM 39712 CG1 VAL M 442 45.696 -49.823 -12.858 1.00 20.00 C ATOM 39713 CG2 VAL M 442 44.533 -51.552 -14.148 1.00 20.00 C ATOM 39714 N ILE M 443 44.256 -50.446 -9.892 1.00 20.00 N ATOM 39715 CA ILE M 443 44.466 -49.729 -8.647 1.00 20.00 C ATOM 39716 C ILE M 443 45.155 -50.584 -7.612 1.00 20.00 C ATOM 39717 O ILE M 443 46.090 -50.209 -6.969 1.00 20.00 O ATOM 39718 CB ILE M 443 43.154 -49.386 -8.013 1.00 20.00 C ATOM 39719 CG1 ILE M 443 42.540 -48.161 -8.606 1.00 20.00 C ATOM 39720 CG2 ILE M 443 43.425 -49.196 -6.567 1.00 20.00 C ATOM 39721 CD1 ILE M 443 41.045 -48.280 -8.685 1.00 20.00 C ATOM 39722 N ARG M 444 44.630 -51.751 -7.424 1.00 20.00 N ATOM 39723 CA ARG M 444 45.207 -52.625 -6.458 1.00 20.00 C ATOM 39724 C ARG M 444 46.652 -52.903 -6.773 1.00 20.00 C ATOM 39725 O ARG M 444 47.536 -52.940 -5.922 1.00 20.00 O ATOM 39726 CB ARG M 444 44.347 -53.887 -6.243 1.00 20.00 C ATOM 39727 CG ARG M 444 43.161 -53.582 -5.354 1.00 20.00 C ATOM 39728 CD ARG M 444 43.485 -53.585 -3.842 1.00 20.00 C ATOM 39729 NE ARG M 444 44.046 -54.856 -3.419 1.00 20.00 N ATOM 39730 CZ ARG M 444 45.312 -55.002 -3.026 1.00 20.00 C ATOM 39731 NH1 ARG M 444 46.139 -53.957 -2.983 1.00 20.00 N ATOM 39732 NH2 ARG M 444 45.738 -56.219 -2.679 1.00 20.00 N ATOM 39733 N ILE M 445 46.932 -53.006 -8.060 1.00 20.00 N ATOM 39734 CA ILE M 445 48.296 -53.264 -8.484 1.00 20.00 C ATOM 39735 C ILE M 445 49.132 -52.093 -7.990 1.00 20.00 C ATOM 39736 O ILE M 445 50.014 -52.224 -7.203 1.00 20.00 O ATOM 39737 CB ILE M 445 48.326 -53.386 -10.007 1.00 20.00 C ATOM 39738 CG1 ILE M 445 47.581 -54.592 -10.441 1.00 20.00 C ATOM 39739 CG2 ILE M 445 49.677 -53.526 -10.525 1.00 20.00 C ATOM 39740 CD1 ILE M 445 47.721 -54.884 -11.915 1.00 20.00 C ATOM 39741 N ASN M 446 48.753 -50.907 -8.447 1.00 20.00 N ATOM 39742 CA ASN M 446 49.362 -49.652 -8.107 1.00 20.00 C ATOM 39743 C ASN M 446 49.641 -49.596 -6.612 1.00 20.00 C ATOM 39744 O ASN M 446 50.664 -49.075 -6.147 1.00 20.00 O ATOM 39745 CB ASN M 446 48.387 -48.496 -8.363 1.00 20.00 C ATOM 39746 CG ASN M 446 48.367 -47.906 -9.751 1.00 20.00 C ATOM 39747 OD1 ASN M 446 49.358 -47.969 -10.460 1.00 20.00 O ATOM 39748 ND2 ASN M 446 47.266 -47.279 -10.144 1.00 20.00 N ATOM 39749 N GLN M 447 48.693 -50.135 -5.856 1.00 20.00 N ATOM 39750 CA GLN M 447 48.828 -50.115 -4.424 1.00 20.00 C ATOM 39751 C GLN M 447 49.976 -50.866 -3.859 1.00 20.00 C ATOM 39752 O GLN M 447 50.671 -50.489 -2.931 1.00 20.00 O ATOM 39753 CB GLN M 447 47.654 -49.724 -3.516 1.00 20.00 C ATOM 39754 CG GLN M 447 46.559 -50.784 -3.353 1.00 20.00 C ATOM 39755 CD GLN M 447 45.184 -50.209 -2.977 1.00 20.00 C ATOM 39756 OE1 GLN M 447 44.531 -50.668 -2.055 1.00 20.00 O ATOM 39757 NE2 GLN M 447 44.682 -49.269 -3.764 1.00 20.00 N ATOM 39758 N GLN M 448 50.242 -51.960 -4.494 1.00 20.00 N ATOM 39759 CA GLN M 448 51.360 -52.748 -4.071 1.00 20.00 C ATOM 39760 C GLN M 448 52.616 -52.064 -4.557 1.00 20.00 C ATOM 39761 O GLN M 448 53.642 -52.045 -3.878 1.00 20.00 O ATOM 39762 CB GLN M 448 51.316 -54.146 -4.700 1.00 20.00 C ATOM 39763 CG GLN M 448 51.419 -55.258 -3.643 1.00 20.00 C ATOM 39764 CD GLN M 448 50.140 -55.402 -2.816 1.00 20.00 C ATOM 39765 OE1 GLN M 448 50.178 -55.215 -1.578 1.00 20.00 O ATOM 39766 NE2 GLN M 448 49.053 -55.756 -3.495 1.00 20.00 N ATOM 39767 N LEU M 449 52.513 -51.529 -5.760 1.00 20.00 N ATOM 39768 CA LEU M 449 53.630 -50.858 -6.404 1.00 20.00 C ATOM 39769 C LEU M 449 53.972 -49.550 -5.720 1.00 20.00 C ATOM 39770 O LEU M 449 54.671 -48.735 -6.284 1.00 20.00 O ATOM 39771 CB LEU M 449 53.349 -50.619 -7.885 1.00 20.00 C ATOM 39772 CG LEU M 449 53.796 -51.782 -8.725 1.00 20.00 C ATOM 39773 CD1 LEU M 449 53.738 -52.996 -7.827 1.00 20.00 C ATOM 39774 CD2 LEU M 449 52.878 -51.868 -9.941 1.00 20.00 C