>>1MVW:HELIX  291 291 THR P  418  LEU P  449  1                                  32    
TVSEVHNSVGALAAVYEMFLWMVIRINQQL
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 291 291 THR P 418 LEU P 449 1 32 ATOM 48564 N THR P 418 -10.855 32.828 -48.933 1.00 20.00 N ATOM 48565 CA THR P 418 -10.415 33.708 -49.979 1.00 20.00 C ATOM 48566 C THR P 418 -11.259 34.951 -50.002 1.00 20.00 C ATOM 48567 O THR P 418 -12.323 34.994 -49.385 1.00 20.00 O ATOM 48568 CB THR P 418 -10.622 33.037 -51.329 1.00 20.00 C ATOM 48569 OG1 THR P 418 -10.108 31.738 -51.262 1.00 20.00 O ATOM 48570 CG2 THR P 418 -9.943 33.846 -52.411 1.00 20.00 C ATOM 48571 N VAL P 419 -10.795 35.925 -50.758 1.00 20.00 N ATOM 48572 CA VAL P 419 -11.490 37.167 -50.883 1.00 20.00 C ATOM 48573 C VAL P 419 -12.891 36.844 -51.422 1.00 20.00 C ATOM 48574 O VAL P 419 -13.910 37.130 -50.832 1.00 20.00 O ATOM 48575 CB VAL P 419 -10.727 38.088 -51.808 1.00 20.00 C ATOM 48576 CG1 VAL P 419 -11.370 39.442 -51.904 1.00 20.00 C ATOM 48577 CG2 VAL P 419 -9.272 38.198 -51.356 1.00 20.00 C ATOM 48578 N SER P 420 -12.922 36.143 -52.523 1.00 20.00 N ATOM 48579 CA SER P 420 -14.188 35.732 -53.143 1.00 20.00 C ATOM 48580 C SER P 420 -15.068 34.963 -52.215 1.00 20.00 C ATOM 48581 O SER P 420 -16.253 34.982 -52.357 1.00 20.00 O ATOM 48582 CB SER P 420 -13.982 34.895 -54.398 1.00 20.00 C ATOM 48583 OG SER P 420 -13.405 35.682 -55.430 1.00 20.00 O ATOM 48584 N GLU P 421 -14.474 34.255 -51.281 1.00 20.00 N ATOM 48585 CA GLU P 421 -15.233 33.454 -50.366 1.00 20.00 C ATOM 48586 C GLU P 421 -15.918 34.276 -49.291 1.00 20.00 C ATOM 48587 O GLU P 421 -17.049 33.949 -48.807 1.00 20.00 O ATOM 48588 CB GLU P 421 -14.369 32.377 -49.704 1.00 20.00 C ATOM 48589 CG GLU P 421 -13.530 31.576 -50.697 1.00 20.00 C ATOM 48590 CD GLU P 421 -13.041 30.302 -50.105 1.00 20.00 C ATOM 48591 OE1 GLU P 421 -12.107 30.253 -49.330 1.00 20.00 O ATOM 48592 OE2 GLU P 421 -13.712 29.248 -50.517 1.00 20.00 O ATOM 48593 N VAL P 422 -15.269 35.372 -48.937 1.00 20.00 N ATOM 48594 CA VAL P 422 -15.788 36.218 -47.889 1.00 20.00 C ATOM 48595 C VAL P 422 -16.953 36.985 -48.373 1.00 20.00 C ATOM 48596 O VAL P 422 -18.025 36.855 -47.820 1.00 20.00 O ATOM 48597 CB VAL P 422 -14.781 37.113 -47.246 1.00 20.00 C ATOM 48598 CG1 VAL P 422 -15.446 37.705 -46.017 1.00 20.00 C ATOM 48599 CG2 VAL P 422 -13.529 36.292 -46.869 1.00 20.00 C ATOM 48600 N HIS P 423 -16.698 37.707 -49.458 1.00 20.00 N ATOM 48601 CA HIS P 423 -17.719 38.543 -50.078 1.00 20.00 C ATOM 48602 C HIS P 423 -18.992 37.753 -50.228 1.00 20.00 C ATOM 48603 O HIS P 423 -20.088 38.218 -49.948 1.00 20.00 O ATOM 48604 CB HIS P 423 -17.300 39.167 -51.437 1.00 20.00 C ATOM 48605 CG HIS P 423 -16.333 40.346 -51.373 1.00 20.00 C ATOM 48606 ND1 HIS P 423 -16.279 41.229 -50.294 1.00 20.00 N ATOM 48607 CD2 HIS P 423 -15.401 40.781 -52.286 1.00 20.00 C ATOM 48608 CE1 HIS P 423 -15.303 42.126 -50.554 1.00 20.00 C ATOM 48609 NE2 HIS P 423 -14.740 41.875 -51.749 1.00 20.00 N ATOM 48610 N ASN P 424 -18.836 36.493 -50.588 1.00 20.00 N ATOM 48611 CA ASN P 424 -19.969 35.627 -50.767 1.00 20.00 C ATOM 48612 C ASN P 424 -20.546 35.238 -49.417 1.00 20.00 C ATOM 48613 O ASN P 424 -21.769 35.248 -49.232 1.00 20.00 O ATOM 48614 CB ASN P 424 -19.745 34.424 -51.729 1.00 20.00 C ATOM 48615 CG ASN P 424 -19.500 34.733 -53.207 1.00 20.00 C ATOM 48616 OD1 ASN P 424 -19.016 33.880 -53.929 1.00 20.00 O ATOM 48617 ND2 ASN P 424 -19.839 35.955 -53.653 1.00 20.00 N ATOM 48618 N SER P 425 -19.711 34.978 -48.419 1.00 20.00 N ATOM 48619 CA SER P 425 -20.322 34.586 -47.134 1.00 20.00 C ATOM 48620 C SER P 425 -21.092 35.692 -46.463 1.00 20.00 C ATOM 48621 O SER P 425 -22.136 35.525 -45.829 1.00 20.00 O ATOM 48622 CB SER P 425 -19.473 33.782 -46.167 1.00 20.00 C ATOM 48623 OG SER P 425 -18.406 34.555 -45.693 1.00 20.00 O ATOM 48624 N VAL P 426 -20.561 36.854 -46.590 1.00 20.00 N ATOM 48625 CA VAL P 426 -21.164 38.036 -46.049 1.00 20.00 C ATOM 48626 C VAL P 426 -22.569 38.133 -46.593 1.00 20.00 C ATOM 48627 O VAL P 426 -23.562 38.138 -45.884 1.00 20.00 O ATOM 48628 CB VAL P 426 -20.356 39.277 -46.452 1.00 20.00 C ATOM 48629 CG1 VAL P 426 -21.079 40.547 -46.037 1.00 20.00 C ATOM 48630 CG2 VAL P 426 -19.023 39.253 -45.796 1.00 20.00 C ATOM 48631 N GLY P 427 -22.632 38.124 -47.898 1.00 20.00 N ATOM 48632 CA GLY P 427 -23.873 38.159 -48.600 1.00 20.00 C ATOM 48633 C GLY P 427 -24.803 37.083 -48.097 1.00 20.00 C ATOM 48634 O GLY P 427 -26.018 37.248 -47.963 1.00 20.00 O ATOM 48635 N ALA P 428 -24.231 35.950 -47.750 1.00 20.00 N ATOM 48636 CA ALA P 428 -25.085 34.914 -47.234 1.00 20.00 C ATOM 48637 C ALA P 428 -25.682 35.227 -45.913 1.00 20.00 C ATOM 48638 O ALA P 428 -26.848 34.853 -45.660 1.00 20.00 O ATOM 48639 CB ALA P 428 -24.489 33.572 -47.170 1.00 20.00 C ATOM 48640 N LEU P 429 -24.910 35.901 -45.074 1.00 20.00 N ATOM 48641 CA LEU P 429 -25.511 36.265 -43.779 1.00 20.00 C ATOM 48642 C LEU P 429 -26.548 37.365 -43.927 1.00 20.00 C ATOM 48643 O LEU P 429 -27.671 37.226 -43.408 1.00 20.00 O ATOM 48644 CB LEU P 429 -24.433 36.592 -42.766 1.00 20.00 C ATOM 48645 CG LEU P 429 -23.484 35.405 -42.643 1.00 20.00 C ATOM 48646 CD1 LEU P 429 -22.107 35.843 -42.329 1.00 20.00 C ATOM 48647 CD2 LEU P 429 -24.041 34.550 -41.548 1.00 20.00 C ATOM 48648 N ALA P 430 -26.193 38.409 -44.716 1.00 20.00 N ATOM 48649 CA ALA P 430 -27.035 39.517 -45.003 1.00 20.00 C ATOM 48650 C ALA P 430 -28.401 39.008 -45.328 1.00 20.00 C ATOM 48651 O ALA P 430 -29.407 39.338 -44.699 1.00 20.00 O ATOM 48652 CB ALA P 430 -26.556 40.273 -46.230 1.00 20.00 C HETATM48653 N MLY P 431 -28.429 38.085 -46.275 1.00 20.00 N HETATM48654 CA MLY P 431 -29.686 37.479 -46.673 1.00 20.00 C HETATM48655 CB MLY P 431 -29.574 36.537 -47.860 1.00 20.00 C HETATM48656 CG MLY P 431 -29.325 37.144 -49.206 1.00 20.00 C HETATM48657 CD MLY P 431 -28.200 36.485 -49.938 1.00 20.00 C HETATM48658 CE MLY P 431 -28.623 35.432 -50.939 1.00 20.00 C HETATM48659 NZ MLY P 431 -27.564 35.040 -51.859 1.00 20.00 N HETATM48660 CH1 MLY P 431 -27.968 35.220 -53.250 1.00 20.00 C HETATM48661 CH2 MLY P 431 -27.283 33.618 -51.607 1.00 20.00 C HETATM48662 C MLY P 431 -30.281 36.682 -45.546 1.00 20.00 C HETATM48663 O MLY P 431 -31.470 36.727 -45.280 1.00 20.00 O ATOM 48664 N ALA P 432 -29.466 35.832 -44.936 1.00 20.00 N ATOM 48665 CA ALA P 432 -29.939 34.989 -43.856 1.00 20.00 C ATOM 48666 C ALA P 432 -30.636 35.789 -42.778 1.00 20.00 C ATOM 48667 O ALA P 432 -31.738 35.514 -42.371 1.00 20.00 O ATOM 48668 CB ALA P 432 -28.792 34.348 -43.211 1.00 20.00 C ATOM 48669 N VAL P 433 -29.936 36.797 -42.303 1.00 20.00 N ATOM 48670 CA VAL P 433 -30.454 37.683 -41.276 1.00 20.00 C ATOM 48671 C VAL P 433 -31.755 38.367 -41.594 1.00 20.00 C ATOM 48672 O VAL P 433 -32.698 38.387 -40.797 1.00 20.00 O ATOM 48673 CB VAL P 433 -29.449 38.749 -40.953 1.00 20.00 C ATOM 48674 CG1 VAL P 433 -29.952 39.566 -39.794 1.00 20.00 C ATOM 48675 CG2 VAL P 433 -28.121 38.118 -40.583 1.00 20.00 C ATOM 48676 N TYR P 434 -31.792 38.952 -42.787 1.00 20.00 N ATOM 48677 CA TYR P 434 -32.996 39.624 -43.259 1.00 20.00 C ATOM 48678 C TYR P 434 -34.189 38.711 -43.211 1.00 20.00 C ATOM 48679 O TYR P 434 -35.202 39.024 -42.612 1.00 20.00 O ATOM 48680 CB TYR P 434 -32.831 39.859 -44.670 1.00 20.00 C ATOM 48681 CG TYR P 434 -33.875 40.828 -45.103 1.00 20.00 C ATOM 48682 CD1 TYR P 434 -33.677 42.187 -44.930 1.00 20.00 C ATOM 48683 CD2 TYR P 434 -35.048 40.399 -45.685 1.00 20.00 C ATOM 48684 CE1 TYR P 434 -34.636 43.096 -45.355 1.00 20.00 C ATOM 48685 CE2 TYR P 434 -36.026 41.292 -46.126 1.00 20.00 C ATOM 48686 CZ TYR P 434 -35.819 42.648 -45.932 1.00 20.00 C ATOM 48687 OH TYR P 434 -36.759 43.546 -46.337 1.00 20.00 O ATOM 48688 N GLU P 435 -34.017 37.542 -43.864 1.00 20.00 N ATOM 48689 CA GLU P 435 -35.032 36.535 -43.886 1.00 20.00 C ATOM 48690 C GLU P 435 -35.613 36.260 -42.556 1.00 20.00 C ATOM 48691 O GLU P 435 -36.719 36.694 -42.263 1.00 20.00 O ATOM 48692 CB GLU P 435 -34.581 35.233 -44.435 1.00 20.00 C ATOM 48693 CG GLU P 435 -35.705 34.208 -44.201 1.00 20.00 C ATOM 48694 CD GLU P 435 -35.497 32.974 -45.040 1.00 20.00 C ATOM 48695 OE1 GLU P 435 -34.267 32.580 -45.009 1.00 20.00 O ATOM 48696 OE2 GLU P 435 -36.354 32.428 -45.699 1.00 20.00 O HETATM48697 N MLY P 436 -34.837 35.576 -41.754 1.00 20.00 N HETATM48698 CA MLY P 436 -35.146 35.245 -40.352 1.00 20.00 C HETATM48699 CB MLY P 436 -33.897 35.175 -39.537 1.00 20.00 C HETATM48700 CG MLY P 436 -33.459 33.778 -39.199 1.00 20.00 C HETATM48701 CD MLY P 436 -32.421 33.293 -40.175 1.00 20.00 C HETATM48702 CE MLY P 436 -32.591 31.826 -40.486 1.00 20.00 C HETATM48703 NZ MLY P 436 -31.472 31.292 -41.285 1.00 20.00 N HETATM48704 CH1 MLY P 436 -31.706 31.485 -42.736 1.00 20.00 C HETATM48705 CH2 MLY P 436 -31.292 29.873 -40.972 1.00 20.00 C HETATM48706 C MLY P 436 -35.962 36.315 -39.669 1.00 20.00 C HETATM48707 O MLY P 436 -37.048 36.088 -39.153 1.00 20.00 O ATOM 48708 N MET P 437 -35.435 37.509 -39.756 1.00 20.00 N ATOM 48709 CA MET P 437 -36.065 38.680 -39.177 1.00 20.00 C ATOM 48710 C MET P 437 -37.465 38.786 -39.668 1.00 20.00 C ATOM 48711 O MET P 437 -38.439 38.935 -38.928 1.00 20.00 O ATOM 48712 CB MET P 437 -35.328 39.939 -39.605 1.00 20.00 C ATOM 48713 CG MET P 437 -35.994 41.202 -39.061 1.00 20.00 C ATOM 48714 SD MET P 437 -34.803 42.583 -39.102 1.00 20.00 S ATOM 48715 CE MET P 437 -35.124 43.481 -40.576 1.00 20.00 C ATOM 48716 N PHE P 438 -37.561 38.719 -40.963 1.00 20.00 N ATOM 48717 CA PHE P 438 -38.853 38.794 -41.598 1.00 20.00 C ATOM 48718 C PHE P 438 -39.755 37.753 -41.069 1.00 20.00 C ATOM 48719 O PHE P 438 -40.907 37.953 -40.824 1.00 20.00 O ATOM 48720 CB PHE P 438 -38.678 38.558 -43.064 1.00 20.00 C ATOM 48721 CG PHE P 438 -39.968 38.597 -43.795 1.00 20.00 C ATOM 48722 CD1 PHE P 438 -40.488 39.804 -44.209 1.00 20.00 C ATOM 48723 CD2 PHE P 438 -40.650 37.433 -44.112 1.00 20.00 C ATOM 48724 CE1 PHE P 438 -41.676 39.861 -44.931 1.00 20.00 C ATOM 48725 CE2 PHE P 438 -41.838 37.475 -44.841 1.00 20.00 C ATOM 48726 CZ PHE P 438 -42.346 38.695 -45.227 1.00 20.00 C ATOM 48727 N LEU P 439 -39.173 36.566 -40.854 1.00 20.00 N ATOM 48728 CA LEU P 439 -39.965 35.473 -40.314 1.00 20.00 C ATOM 48729 C LEU P 439 -40.444 35.817 -38.927 1.00 20.00 C ATOM 48730 O LEU P 439 -41.577 35.693 -38.554 1.00 20.00 O ATOM 48731 CB LEU P 439 -39.200 34.146 -40.325 1.00 20.00 C ATOM 48732 CG LEU P 439 -39.172 33.423 -41.668 1.00 20.00 C ATOM 48733 CD1 LEU P 439 -39.311 34.470 -42.719 1.00 20.00 C ATOM 48734 CD2 LEU P 439 -37.803 32.806 -41.826 1.00 20.00 C ATOM 48735 N TRP P 440 -39.528 36.320 -38.144 1.00 20.00 N ATOM 48736 CA TRP P 440 -39.802 36.700 -36.787 1.00 20.00 C ATOM 48737 C TRP P 440 -40.945 37.690 -36.699 1.00 20.00 C ATOM 48738 O TRP P 440 -41.878 37.509 -35.914 1.00 20.00 O ATOM 48739 CB TRP P 440 -38.567 37.370 -36.256 1.00 20.00 C ATOM 48740 CG TRP P 440 -38.717 37.965 -34.900 1.00 20.00 C ATOM 48741 CD1 TRP P 440 -38.962 37.292 -33.784 1.00 20.00 C ATOM 48742 CD2 TRP P 440 -38.525 39.336 -34.483 1.00 20.00 C ATOM 48743 NE1 TRP P 440 -38.987 38.151 -32.720 1.00 20.00 N ATOM 48744 CE2 TRP P 440 -38.713 39.391 -33.120 1.00 20.00 C ATOM 48745 CE3 TRP P 440 -38.255 40.522 -35.159 1.00 20.00 C ATOM 48746 CZ2 TRP P 440 -38.636 40.564 -32.435 1.00 20.00 C ATOM 48747 CZ3 TRP P 440 -38.201 41.701 -34.502 1.00 20.00 C ATOM 48748 CH2 TRP P 440 -38.365 41.707 -33.151 1.00 20.00 C ATOM 48749 N MET P 441 -40.817 38.759 -37.488 1.00 20.00 N ATOM 48750 CA MET P 441 -41.821 39.807 -37.506 1.00 20.00 C ATOM 48751 C MET P 441 -43.169 39.203 -37.675 1.00 20.00 C ATOM 48752 O MET P 441 -44.104 39.518 -36.969 1.00 20.00 O ATOM 48753 CB MET P 441 -41.543 40.730 -38.661 1.00 20.00 C ATOM 48754 CG MET P 441 -40.892 41.979 -38.213 1.00 20.00 C ATOM 48755 SD MET P 441 -40.597 43.070 -39.574 1.00 20.00 S ATOM 48756 CE MET P 441 -39.573 42.064 -40.608 1.00 20.00 C ATOM 48757 N VAL P 442 -43.219 38.270 -38.622 1.00 20.00 N ATOM 48758 CA VAL P 442 -44.483 37.597 -38.858 1.00 20.00 C ATOM 48759 C VAL P 442 -44.973 36.924 -37.604 1.00 20.00 C ATOM 48760 O VAL P 442 -46.081 37.155 -37.166 1.00 20.00 O ATOM 48761 CB VAL P 442 -44.397 36.584 -39.946 1.00 20.00 C ATOM 48762 CG1 VAL P 442 -45.670 35.843 -39.956 1.00 20.00 C ATOM 48763 CG2 VAL P 442 -44.183 37.304 -41.241 1.00 20.00 C ATOM 48764 N ILE P 443 -44.120 36.137 -36.994 1.00 20.00 N ATOM 48765 CA ILE P 443 -44.465 35.471 -35.751 1.00 20.00 C ATOM 48766 C ILE P 443 -44.959 36.442 -34.709 1.00 20.00 C ATOM 48767 O ILE P 443 -45.948 36.263 -34.061 1.00 20.00 O ATOM 48768 CB ILE P 443 -43.247 34.860 -35.126 1.00 20.00 C ATOM 48769 CG1 ILE P 443 -42.903 33.539 -35.731 1.00 20.00 C ATOM 48770 CG2 ILE P 443 -43.544 34.721 -33.681 1.00 20.00 C ATOM 48771 CD1 ILE P 443 -41.415 33.350 -35.817 1.00 20.00 C ATOM 48772 N ARG P 444 -44.205 37.475 -34.515 1.00 20.00 N ATOM 48773 CA ARG P 444 -44.583 38.443 -33.542 1.00 20.00 C ATOM 48774 C ARG P 444 -45.944 39.012 -33.846 1.00 20.00 C ATOM 48775 O ARG P 444 -46.796 39.225 -32.990 1.00 20.00 O ATOM 48776 CB ARG P 444 -43.482 39.499 -33.322 1.00 20.00 C ATOM 48777 CG ARG P 444 -42.380 38.951 -32.442 1.00 20.00 C ATOM 48778 CD ARG P 444 -42.688 39.010 -30.928 1.00 20.00 C ATOM 48779 NE ARG P 444 -42.975 40.367 -30.495 1.00 20.00 N ATOM 48780 CZ ARG P 444 -44.181 40.767 -30.094 1.00 20.00 C ATOM 48781 NH1 ARG P 444 -45.206 39.915 -30.053 1.00 20.00 N ATOM 48782 NH2 ARG P 444 -44.347 42.043 -29.739 1.00 20.00 N ATOM 48783 N ILE P 445 -46.203 39.180 -35.131 1.00 20.00 N ATOM 48784 CA ILE P 445 -47.486 39.715 -35.545 1.00 20.00 C ATOM 48785 C ILE P 445 -48.542 38.736 -35.053 1.00 20.00 C ATOM 48786 O ILE P 445 -49.375 39.042 -34.261 1.00 20.00 O ATOM 48787 CB ILE P 445 -47.499 39.851 -37.068 1.00 20.00 C ATOM 48788 CG1 ILE P 445 -46.524 40.880 -37.499 1.00 20.00 C ATOM 48789 CG2 ILE P 445 -48.794 40.268 -37.577 1.00 20.00 C ATOM 48790 CD1 ILE P 445 -46.609 41.204 -38.970 1.00 20.00 C ATOM 48791 N ASN P 446 -48.417 37.502 -35.520 1.00 20.00 N ATOM 48792 CA ASN P 446 -49.270 36.396 -35.185 1.00 20.00 C ATOM 48793 C ASN P 446 -49.547 36.389 -33.689 1.00 20.00 C ATOM 48794 O ASN P 446 -50.655 36.087 -33.221 1.00 20.00 O ATOM 48795 CB ASN P 446 -48.553 35.067 -35.453 1.00 20.00 C ATOM 48796 CG ASN P 446 -48.662 34.495 -36.845 1.00 20.00 C ATOM 48797 OD1 ASN P 446 -49.623 34.765 -37.548 1.00 20.00 O ATOM 48798 ND2 ASN P 446 -47.716 33.656 -37.247 1.00 20.00 N ATOM 48799 N GLN P 447 -48.505 36.718 -32.934 1.00 20.00 N ATOM 48800 CA GLN P 447 -48.634 36.716 -31.503 1.00 20.00 C ATOM 48801 C GLN P 447 -49.600 37.684 -30.926 1.00 20.00 C ATOM 48802 O GLN P 447 -50.353 37.451 -29.996 1.00 20.00 O ATOM 48803 CB GLN P 447 -47.561 36.087 -30.603 1.00 20.00 C ATOM 48804 CG GLN P 447 -46.271 36.897 -30.439 1.00 20.00 C ATOM 48805 CD GLN P 447 -45.042 36.050 -30.076 1.00 20.00 C ATOM 48806 OE1 GLN P 447 -44.302 36.359 -29.153 1.00 20.00 O ATOM 48807 NE2 GLN P 447 -44.748 35.032 -30.870 1.00 20.00 N ATOM 48808 N GLN P 448 -49.638 38.814 -31.553 1.00 20.00 N ATOM 48809 CA GLN P 448 -50.570 39.811 -31.118 1.00 20.00 C ATOM 48810 C GLN P 448 -51.940 39.403 -31.602 1.00 20.00 C ATOM 48811 O GLN P 448 -52.946 39.591 -30.917 1.00 20.00 O ATOM 48812 CB GLN P 448 -50.242 41.174 -31.740 1.00 20.00 C ATOM 48813 CG GLN P 448 -50.110 42.276 -30.676 1.00 20.00 C ATOM 48814 CD GLN P 448 -48.824 42.149 -29.854 1.00 20.00 C ATOM 48815 OE1 GLN P 448 -48.894 41.967 -28.617 1.00 20.00 O ATOM 48816 NE2 GLN P 448 -47.690 42.277 -30.537 1.00 20.00 N ATOM 48817 N LEU P 449 -51.957 38.866 -32.809 1.00 20.00 N ATOM 48818 CA LEU P 449 -53.191 38.444 -33.450 1.00 20.00 C ATOM 48819 C LEU P 449 -53.791 37.228 -32.772 1.00 20.00 C ATOM 48820 O LEU P 449 -54.644 36.577 -33.338 1.00 20.00 O ATOM 48821 CB LEU P 449 -52.972 38.161 -34.935 1.00 20.00 C ATOM 48822 CG LEU P 449 -53.174 39.397 -35.765 1.00 20.00 C ATOM 48823 CD1 LEU P 449 -52.864 40.567 -34.860 1.00 20.00 C ATOM 48824 CD2 LEU P 449 -52.264 39.299 -36.986 1.00 20.00 C