>>1P3F:HELIX    3   3 GLN A  485  ALA A  514  1                                  30    
QSSAVMALQEASEAYLVALFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 3 3 GLN A 485 ALA A 514 1 30 ATOM 6403 N GLN A 485 -43.464 10.059 -36.258 1.00 25.90 N ATOM 6404 CA GLN A 485 -44.318 11.154 -35.826 1.00 25.90 C ATOM 6405 C GLN A 485 -44.714 11.868 -37.116 1.00 25.90 C ATOM 6406 O GLN A 485 -43.981 11.876 -38.131 1.00 25.90 O ATOM 6407 CB GLN A 485 -43.606 12.180 -35.001 1.00 23.64 C ATOM 6408 CG GLN A 485 -42.781 11.590 -33.933 1.00 23.64 C ATOM 6409 CD GLN A 485 -42.557 12.598 -32.803 1.00 23.64 C ATOM 6410 OE1 GLN A 485 -42.218 13.781 -33.074 1.00 23.64 O ATOM 6411 NE2 GLN A 485 -42.761 12.167 -31.539 1.00 23.64 N ATOM 6412 N SER A 486 -45.874 12.484 -37.097 1.00 28.36 N ATOM 6413 CA SER A 486 -46.325 13.178 -38.217 1.00 28.36 C ATOM 6414 C SER A 486 -45.309 14.279 -38.504 1.00 28.36 C ATOM 6415 O SER A 486 -45.069 14.592 -39.667 1.00 28.36 O ATOM 6416 CB SER A 486 -47.645 13.719 -37.867 1.00 51.49 C ATOM 6417 OG SER A 486 -47.744 14.936 -38.507 1.00 51.49 O ATOM 6418 N SER A 487 -44.679 14.854 -37.475 1.00 35.42 N ATOM 6419 CA SER A 487 -43.706 15.948 -37.680 1.00 35.42 C ATOM 6420 C SER A 487 -42.421 15.510 -38.392 1.00 35.42 C ATOM 6421 O SER A 487 -41.825 16.230 -39.222 1.00 35.42 O ATOM 6422 CB SER A 487 -43.354 16.560 -36.347 1.00 67.15 C ATOM 6423 OG SER A 487 -43.022 15.538 -35.444 1.00 67.15 O ATOM 6424 N ALA A 488 -41.982 14.310 -38.058 1.00 44.01 N ATOM 6425 CA ALA A 488 -40.794 13.821 -38.673 1.00 44.01 C ATOM 6426 C ALA A 488 -41.030 13.638 -40.178 1.00 44.01 C ATOM 6427 O ALA A 488 -40.137 13.851 -40.970 1.00 44.01 O ATOM 6428 CB ALA A 488 -40.362 12.564 -37.996 1.00 26.12 C ATOM 6429 N VAL A 489 -42.223 13.275 -40.611 1.00 20.32 N ATOM 6430 CA VAL A 489 -42.366 13.143 -42.059 1.00 20.32 C ATOM 6431 C VAL A 489 -42.426 14.530 -42.655 1.00 20.32 C ATOM 6432 O VAL A 489 -41.743 14.862 -43.651 1.00 20.32 O ATOM 6433 CB VAL A 489 -43.582 12.360 -42.439 1.00 16.00 C ATOM 6434 CG1 VAL A 489 -43.582 12.119 -43.898 1.00 16.00 C ATOM 6435 CG2 VAL A 489 -43.541 11.101 -41.774 1.00 16.00 C ATOM 6436 N MET A 490 -43.237 15.348 -42.016 1.00 31.39 N ATOM 6437 CA MET A 490 -43.357 16.705 -42.471 1.00 31.39 C ATOM 6438 C MET A 490 -41.961 17.307 -42.491 1.00 31.39 C ATOM 6439 O MET A 490 -41.660 17.905 -43.469 1.00 31.39 O ATOM 6440 CB MET A 490 -44.334 17.552 -41.613 1.00 67.31 C ATOM 6441 CG MET A 490 -45.801 17.401 -41.962 1.00 67.31 C ATOM 6442 SD MET A 490 -46.013 17.000 -43.757 1.00 67.31 S ATOM 6443 CE MET A 490 -46.126 18.541 -44.524 1.00 67.31 C ATOM 6444 N ALA A 491 -41.086 17.135 -41.479 1.00 30.80 N ATOM 6445 CA ALA A 491 -39.729 17.740 -41.558 1.00 30.80 C ATOM 6446 C ALA A 491 -38.899 17.180 -42.724 1.00 30.80 C ATOM 6447 O ALA A 491 -38.310 17.940 -43.486 1.00 30.80 O ATOM 6448 CB ALA A 491 -39.004 17.567 -40.279 1.00 35.12 C ATOM 6449 N LEU A 492 -38.859 15.865 -42.852 1.00 25.26 N ATOM 6450 CA LEU A 492 -38.187 15.229 -43.954 1.00 25.26 C ATOM 6451 C LEU A 492 -38.719 15.776 -45.294 1.00 25.26 C ATOM 6452 O LEU A 492 -37.946 16.028 -46.240 1.00 25.26 O ATOM 6453 CB LEU A 492 -38.471 13.731 -43.954 1.00 17.10 C ATOM 6454 CG LEU A 492 -37.570 12.737 -43.187 1.00 17.10 C ATOM 6455 CD1 LEU A 492 -38.146 11.423 -43.275 1.00 17.10 C ATOM 6456 CD2 LEU A 492 -36.198 12.646 -43.743 1.00 17.10 C ATOM 6457 N GLN A 493 -40.038 15.930 -45.435 1.00 31.02 N ATOM 6458 CA GLN A 493 -40.521 16.397 -46.723 1.00 31.02 C ATOM 6459 C GLN A 493 -40.062 17.778 -46.953 1.00 31.02 C ATOM 6460 O GLN A 493 -39.577 18.146 -47.973 1.00 31.02 O ATOM 6461 CB GLN A 493 -42.014 16.391 -46.796 1.00 29.06 C ATOM 6462 CG GLN A 493 -42.401 16.233 -48.188 1.00 29.06 C ATOM 6463 CD GLN A 493 -43.817 16.550 -48.461 1.00 29.06 C ATOM 6464 OE1 GLN A 493 -44.690 15.961 -47.872 1.00 29.06 O ATOM 6465 NE2 GLN A 493 -44.065 17.477 -49.377 1.00 29.06 N ATOM 6466 N GLU A 494 -40.205 18.565 -45.957 1.00 25.69 N ATOM 6467 CA GLU A 494 -39.805 19.887 -46.146 1.00 25.69 C ATOM 6468 C GLU A 494 -38.339 20.054 -46.517 1.00 25.69 C ATOM 6469 O GLU A 494 -37.992 20.997 -47.196 1.00 25.69 O ATOM 6470 CB GLU A 494 -40.072 20.637 -44.899 1.00 42.17 C ATOM 6471 CG GLU A 494 -41.412 21.091 -44.839 1.00 42.17 C ATOM 6472 CD GLU A 494 -41.458 22.474 -45.257 1.00 42.17 C ATOM 6473 OE1 GLU A 494 -42.616 22.920 -45.416 1.00 42.17 O ATOM 6474 OE2 GLU A 494 -40.365 23.102 -45.430 1.00 42.17 O ATOM 6475 N ALA A 495 -37.503 19.160 -46.004 1.00 28.18 N ATOM 6476 CA ALA A 495 -36.095 19.181 -46.238 1.00 28.18 C ATOM 6477 C ALA A 495 -35.760 18.677 -47.630 1.00 28.18 C ATOM 6478 O ALA A 495 -34.824 19.193 -48.249 1.00 28.18 O ATOM 6479 CB ALA A 495 -35.365 18.348 -45.177 1.00 11.48 C ATOM 6480 N SER A 496 -36.501 17.692 -48.145 1.00 22.76 N ATOM 6481 CA SER A 496 -36.205 17.212 -49.505 1.00 22.76 C ATOM 6482 C SER A 496 -36.610 18.199 -50.552 1.00 22.76 C ATOM 6483 O SER A 496 -35.992 18.347 -51.567 1.00 22.76 O ATOM 6484 CB SER A 496 -36.954 15.970 -49.843 1.00 20.75 C ATOM 6485 OG SER A 496 -37.052 15.253 -48.686 1.00 20.75 O ATOM 6486 N GLU A 497 -37.691 18.901 -50.349 1.00 29.62 N ATOM 6487 CA GLU A 497 -38.070 19.761 -51.448 1.00 29.62 C ATOM 6488 C GLU A 497 -37.087 20.909 -51.582 1.00 29.62 C ATOM 6489 O GLU A 497 -36.678 21.283 -52.672 1.00 29.62 O ATOM 6490 CB GLU A 497 -39.518 20.211 -51.246 1.00 36.43 C ATOM 6491 CG GLU A 497 -40.520 19.024 -51.081 1.00 36.43 C ATOM 6492 CD GLU A 497 -41.968 19.442 -51.443 1.00 36.43 C ATOM 6493 OE1 GLU A 497 -42.118 20.606 -51.898 1.00 36.43 O ATOM 6494 OE2 GLU A 497 -42.960 18.667 -51.302 1.00 36.43 O ATOM 6495 N ALA A 498 -36.636 21.405 -50.450 1.00 26.70 N ATOM 6496 CA ALA A 498 -35.737 22.525 -50.474 1.00 26.70 C ATOM 6497 C ALA A 498 -34.426 22.101 -51.080 1.00 26.70 C ATOM 6498 O ALA A 498 -33.695 22.885 -51.583 1.00 26.70 O ATOM 6499 CB ALA A 498 -35.551 23.017 -49.099 1.00 11.43 C ATOM 6500 N TYR A 499 -34.156 20.819 -51.006 1.00 29.40 N ATOM 6501 CA TYR A 499 -32.947 20.261 -51.518 1.00 29.40 C ATOM 6502 C TYR A 499 -33.161 20.190 -52.975 1.00 29.40 C ATOM 6503 O TYR A 499 -32.452 20.788 -53.709 1.00 29.40 O ATOM 6504 CB TYR A 499 -32.730 18.876 -50.907 1.00 18.69 C ATOM 6505 CG TYR A 499 -31.758 18.030 -51.666 1.00 18.69 C ATOM 6506 CD1 TYR A 499 -30.400 18.159 -51.474 1.00 18.69 C ATOM 6507 CD2 TYR A 499 -32.164 17.190 -52.683 1.00 18.69 C ATOM 6508 CE1 TYR A 499 -29.468 17.502 -52.261 1.00 18.69 C ATOM 6509 CE2 TYR A 499 -31.195 16.499 -53.489 1.00 18.69 C ATOM 6510 CZ TYR A 499 -29.870 16.673 -53.239 1.00 18.69 C ATOM 6511 OH TYR A 499 -28.940 15.922 -53.886 1.00 18.69 O ATOM 6512 N LEU A 500 -34.149 19.460 -53.411 1.00 19.39 N ATOM 6513 CA LEU A 500 -34.372 19.359 -54.803 1.00 19.39 C ATOM 6514 C LEU A 500 -34.609 20.711 -55.458 1.00 19.39 C ATOM 6515 O LEU A 500 -34.145 20.906 -56.611 1.00 19.39 O ATOM 6516 CB LEU A 500 -35.561 18.499 -55.068 1.00 21.82 C ATOM 6517 CG LEU A 500 -35.338 17.053 -54.799 1.00 21.82 C ATOM 6518 CD1 LEU A 500 -36.503 16.221 -55.168 1.00 21.82 C ATOM 6519 CD2 LEU A 500 -34.196 16.668 -55.583 1.00 21.82 C ATOM 6520 N VAL A 501 -35.330 21.647 -54.803 1.00 14.27 N ATOM 6521 CA VAL A 501 -35.564 22.919 -55.474 1.00 14.27 C ATOM 6522 C VAL A 501 -34.230 23.625 -55.765 1.00 14.27 C ATOM 6523 O VAL A 501 -34.033 24.240 -56.848 1.00 14.27 O ATOM 6524 CB VAL A 501 -36.359 23.910 -54.678 1.00 12.29 C ATOM 6525 CG1 VAL A 501 -36.018 25.330 -55.226 1.00 12.29 C ATOM 6526 CG2 VAL A 501 -37.814 23.609 -54.723 1.00 12.29 C ATOM 6527 N ALA A 502 -33.331 23.581 -54.788 1.00 16.38 N ATOM 6528 CA ALA A 502 -31.994 24.142 -54.931 1.00 16.38 C ATOM 6529 C ALA A 502 -31.170 23.402 -55.955 1.00 16.38 C ATOM 6530 O ALA A 502 -30.433 24.019 -56.646 1.00 16.38 O ATOM 6531 CB ALA A 502 -31.287 24.127 -53.634 1.00 30.04 C ATOM 6532 N LEU A 503 -31.281 22.088 -56.029 1.00 22.67 N ATOM 6533 CA LEU A 503 -30.533 21.334 -57.007 1.00 22.67 C ATOM 6534 C LEU A 503 -31.059 21.696 -58.374 1.00 22.67 C ATOM 6535 O LEU A 503 -30.398 21.532 -59.432 1.00 22.67 O ATOM 6536 CB LEU A 503 -30.735 19.839 -56.818 1.00 12.76 C ATOM 6537 CG LEU A 503 -29.966 18.897 -57.781 1.00 12.76 C ATOM 6538 CD1 LEU A 503 -28.563 19.154 -57.410 1.00 12.76 C ATOM 6539 CD2 LEU A 503 -30.326 17.422 -57.691 1.00 12.76 C ATOM 6540 N PHE A 504 -32.291 22.156 -58.366 1.00 25.90 N ATOM 6541 CA PHE A 504 -32.843 22.567 -59.619 1.00 25.90 C ATOM 6542 C PHE A 504 -32.143 23.940 -60.000 1.00 25.90 C ATOM 6543 O PHE A 504 -31.659 24.103 -61.104 1.00 25.90 O ATOM 6544 CB PHE A 504 -34.391 22.557 -59.499 1.00 16.86 C ATOM 6545 CG PHE A 504 -35.028 21.216 -59.917 1.00 16.86 C ATOM 6546 CD1 PHE A 504 -35.978 20.569 -59.123 1.00 16.86 C ATOM 6547 CD2 PHE A 504 -34.584 20.543 -61.048 1.00 16.86 C ATOM 6548 CE1 PHE A 504 -36.449 19.283 -59.446 1.00 16.86 C ATOM 6549 CE2 PHE A 504 -35.076 19.231 -61.357 1.00 16.86 C ATOM 6550 CZ PHE A 504 -35.996 18.621 -60.553 1.00 16.86 C ATOM 6551 N GLU A 505 -31.995 24.878 -59.071 1.00 28.88 N ATOM 6552 CA GLU A 505 -31.260 26.111 -59.387 1.00 28.88 C ATOM 6553 C GLU A 505 -29.817 25.819 -59.844 1.00 28.88 C ATOM 6554 O GLU A 505 -29.336 26.458 -60.782 1.00 28.88 O ATOM 6555 CB GLU A 505 -31.078 26.925 -58.227 1.00 37.84 C ATOM 6556 CG GLU A 505 -32.330 27.334 -57.652 1.00 37.84 C ATOM 6557 CD GLU A 505 -32.183 28.106 -56.353 1.00 37.84 C ATOM 6558 OE1 GLU A 505 -31.070 28.675 -56.152 1.00 37.84 O ATOM 6559 OE2 GLU A 505 -33.185 28.152 -55.552 1.00 37.84 O ATOM 6560 N ASP A 506 -29.102 24.846 -59.331 1.00 23.50 N ATOM 6561 CA ASP A 506 -27.771 24.696 -59.891 1.00 23.50 C ATOM 6562 C ASP A 506 -27.839 23.964 -61.231 1.00 23.50 C ATOM 6563 O ASP A 506 -27.013 24.220 -62.119 1.00 23.50 O ATOM 6564 CB ASP A 506 -26.878 23.981 -58.931 1.00 36.88 C ATOM 6565 CG ASP A 506 -26.896 24.624 -57.580 1.00 36.88 C ATOM 6566 OD1 ASP A 506 -27.334 25.803 -57.522 1.00 36.88 O ATOM 6567 OD2 ASP A 506 -26.475 23.992 -56.555 1.00 36.88 O ATOM 6568 N THR A 507 -28.853 23.116 -61.427 1.00 25.87 N ATOM 6569 CA THR A 507 -28.954 22.433 -62.718 1.00 25.87 C ATOM 6570 C THR A 507 -29.226 23.425 -63.845 1.00 25.87 C ATOM 6571 O THR A 507 -28.518 23.461 -64.848 1.00 25.87 O ATOM 6572 CB THR A 507 -30.037 21.372 -62.645 1.00 31.86 C ATOM 6573 OG1 THR A 507 -29.669 20.369 -61.673 1.00 31.86 O ATOM 6574 CG2 THR A 507 -30.204 20.737 -63.984 1.00 31.86 C ATOM 6575 N ASN A 508 -30.222 24.274 -63.607 1.00 35.88 N ATOM 6576 CA ASN A 508 -30.616 25.275 -64.529 1.00 35.88 C ATOM 6577 C ASN A 508 -29.410 26.106 -64.877 1.00 35.88 C ATOM 6578 O ASN A 508 -29.239 26.509 -66.042 1.00 35.88 O ATOM 6579 CB ASN A 508 -31.658 26.137 -63.917 1.00 25.86 C ATOM 6580 CG ASN A 508 -32.482 26.854 -64.970 1.00 25.86 C ATOM 6581 OD1 ASN A 508 -32.688 26.314 -66.036 1.00 25.86 O ATOM 6582 ND2 ASN A 508 -32.977 28.067 -64.672 1.00 25.86 N ATOM 6583 N LEU A 509 -28.560 26.378 -63.892 1.00 21.76 N ATOM 6584 CA LEU A 509 -27.384 27.160 -64.183 1.00 21.76 C ATOM 6585 C LEU A 509 -26.480 26.303 -65.067 1.00 21.76 C ATOM 6586 O LEU A 509 -25.994 26.762 -66.109 1.00 21.76 O ATOM 6587 CB LEU A 509 -26.645 27.560 -62.927 1.00 17.21 C ATOM 6588 CG LEU A 509 -27.109 28.804 -62.097 1.00 17.21 C ATOM 6589 CD1 LEU A 509 -26.396 28.814 -60.739 1.00 17.21 C ATOM 6590 CD2 LEU A 509 -26.956 30.152 -62.871 1.00 17.21 C ATOM 6591 N CYS A 510 -26.268 25.055 -64.702 1.00 32.00 N ATOM 6592 CA CYS A 510 -25.456 24.253 -65.544 1.00 32.00 C ATOM 6593 C CYS A 510 -25.983 24.142 -66.972 1.00 32.00 C ATOM 6594 O CYS A 510 -25.204 23.975 -67.913 1.00 32.00 O ATOM 6595 CB CYS A 510 -25.331 22.884 -64.954 1.00 31.30 C ATOM 6596 SG CYS A 510 -24.308 22.950 -63.558 1.00 31.30 S ATOM 6597 N ALA A 511 -27.293 24.159 -67.156 1.00 24.70 N ATOM 6598 CA ALA A 511 -27.776 24.075 -68.507 1.00 24.70 C ATOM 6599 C ALA A 511 -27.487 25.434 -69.262 1.00 24.70 C ATOM 6600 O ALA A 511 -27.016 25.517 -70.401 1.00 24.70 O ATOM 6601 CB ALA A 511 -29.219 23.779 -68.455 1.00 61.76 C ATOM 6602 N ILE A 512 -27.759 26.519 -68.611 1.00 34.67 N ATOM 6603 CA ILE A 512 -27.502 27.737 -69.261 1.00 34.67 C ATOM 6604 C ILE A 512 -26.020 27.862 -69.564 1.00 34.67 C ATOM 6605 O ILE A 512 -25.618 28.506 -70.512 1.00 34.67 O ATOM 6606 CB ILE A 512 -27.920 28.882 -68.360 1.00 9.12 C ATOM 6607 CG1 ILE A 512 -29.415 28.749 -67.979 1.00 9.12 C ATOM 6608 CG2 ILE A 512 -27.728 30.225 -69.040 1.00 9.12 C ATOM 6609 CD1 ILE A 512 -29.925 29.950 -67.119 1.00 9.12 C ATOM 6610 N HIS A 513 -25.154 27.265 -68.794 1.00 45.09 N ATOM 6611 CA HIS A 513 -23.744 27.477 -69.110 1.00 45.09 C ATOM 6612 C HIS A 513 -23.396 26.852 -70.410 1.00 45.09 C ATOM 6613 O HIS A 513 -22.439 27.270 -71.055 1.00 45.09 O ATOM 6614 CB HIS A 513 -22.918 26.877 -67.996 1.00 13.25 C ATOM 6615 CG HIS A 513 -21.440 26.876 -68.188 1.00 13.25 C ATOM 6616 ND1 HIS A 513 -20.667 28.007 -68.023 1.00 13.25 N ATOM 6617 CD2 HIS A 513 -20.567 25.847 -68.382 1.00 13.25 C ATOM 6618 CE1 HIS A 513 -19.377 27.675 -68.116 1.00 13.25 C ATOM 6619 NE2 HIS A 513 -19.291 26.367 -68.329 1.00 13.25 N ATOM 6620 N ALA A 514 -24.201 25.857 -70.789 1.00 20.62 N ATOM 6621 CA ALA A 514 -24.006 25.030 -72.000 1.00 20.62 C ATOM 6622 C ALA A 514 -24.867 25.614 -73.057 1.00 20.62 C ATOM 6623 O ALA A 514 -25.031 25.023 -74.183 1.00 20.62 O ATOM 6624 CB ALA A 514 -24.399 23.578 -71.779 1.00 24.64 C