>>1P3M:HELIX    3   3 GLN A  485  ALA A  514  1                                  30    
QSSAVMALQEASEAYLVALFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 3 3 GLN A 485 ALA A 514 1 30 ATOM 6403 N GLN A 485 96.586 44.659 -36.346 1.00 52.16 N ATOM 6404 CA GLN A 485 97.405 43.597 -35.815 1.00 51.27 C ATOM 6405 C GLN A 485 97.892 42.866 -37.059 1.00 52.03 C ATOM 6406 O GLN A 485 97.200 42.805 -38.075 1.00 50.63 O ATOM 6407 CB GLN A 485 96.589 42.630 -34.961 1.00 41.73 C ATOM 6408 CG GLN A 485 95.890 43.262 -33.798 1.00 42.18 C ATOM 6409 CD GLN A 485 95.504 42.258 -32.723 1.00 46.58 C ATOM 6410 OE1 GLN A 485 94.873 41.231 -32.994 1.00 45.06 O ATOM 6411 NE2 GLN A 485 95.879 42.558 -31.489 1.00 46.46 N ATOM 6412 N SER A 486 99.093 42.325 -36.996 1.00 43.20 N ATOM 6413 CA SER A 486 99.621 41.590 -38.115 1.00 41.48 C ATOM 6414 C SER A 486 98.548 40.581 -38.486 1.00 39.72 C ATOM 6415 O SER A 486 98.311 40.309 -39.659 1.00 39.24 O ATOM 6416 CB SER A 486 100.890 40.869 -37.685 1.00 61.72 C ATOM 6417 OG SER A 486 101.442 40.161 -38.766 1.00 70.56 O ATOM 6418 N SER A 487 97.880 40.062 -37.461 1.00 46.36 N ATOM 6419 CA SER A 487 96.847 39.052 -37.634 1.00 47.43 C ATOM 6420 C SER A 487 95.520 39.485 -38.242 1.00 46.09 C ATOM 6421 O SER A 487 94.838 38.670 -38.890 1.00 44.57 O ATOM 6422 CB SER A 487 96.575 38.386 -36.303 1.00 36.42 C ATOM 6423 OG SER A 487 96.446 39.371 -35.309 1.00 44.34 O ATOM 6424 N ALA A 488 95.132 40.740 -38.033 1.00 41.92 N ATOM 6425 CA ALA A 488 93.871 41.201 -38.595 1.00 40.27 C ATOM 6426 C ALA A 488 93.983 41.242 -40.103 1.00 40.77 C ATOM 6427 O ALA A 488 93.038 40.886 -40.814 1.00 40.18 O ATOM 6428 CB ALA A 488 93.514 42.556 -38.069 1.00 28.64 C ATOM 6429 N VAL A 489 95.142 41.669 -40.598 1.00 24.21 N ATOM 6430 CA VAL A 489 95.357 41.737 -42.048 1.00 25.03 C ATOM 6431 C VAL A 489 95.412 40.322 -42.622 1.00 27.07 C ATOM 6432 O VAL A 489 94.863 40.050 -43.685 1.00 28.96 O ATOM 6433 CB VAL A 489 96.656 42.524 -42.388 1.00 17.70 C ATOM 6434 CG1 VAL A 489 96.908 42.533 -43.868 1.00 14.85 C ATOM 6435 CG2 VAL A 489 96.516 43.953 -41.915 1.00 16.55 C ATOM 6436 N MET A 490 96.055 39.420 -41.899 1.00 38.45 N ATOM 6437 CA MET A 490 96.129 38.049 -42.348 1.00 40.15 C ATOM 6438 C MET A 490 94.718 37.454 -42.458 1.00 37.06 C ATOM 6439 O MET A 490 94.397 36.804 -43.451 1.00 36.05 O ATOM 6440 CB MET A 490 96.991 37.222 -41.394 1.00 54.87 C ATOM 6441 CG MET A 490 98.459 37.519 -41.522 1.00 65.27 C ATOM 6442 SD MET A 490 98.988 37.243 -43.222 1.00 75.01 S ATOM 6443 CE MET A 490 99.795 35.653 -43.027 1.00 75.58 C ATOM 6444 N ALA A 491 93.868 37.668 -41.455 1.00 45.30 N ATOM 6445 CA ALA A 491 92.512 37.144 -41.536 1.00 43.12 C ATOM 6446 C ALA A 491 91.818 37.756 -42.755 1.00 42.51 C ATOM 6447 O ALA A 491 91.266 37.046 -43.590 1.00 42.93 O ATOM 6448 CB ALA A 491 91.760 37.478 -40.300 1.00 21.37 C ATOM 6449 N LEU A 492 91.853 39.078 -42.862 1.00 26.31 N ATOM 6450 CA LEU A 492 91.239 39.746 -43.996 1.00 27.73 C ATOM 6451 C LEU A 492 91.649 39.140 -45.342 1.00 27.54 C ATOM 6452 O LEU A 492 90.798 38.913 -46.220 1.00 27.42 O ATOM 6453 CB LEU A 492 91.602 41.229 -43.987 1.00 32.58 C ATOM 6454 CG LEU A 492 90.765 42.230 -43.182 1.00 36.40 C ATOM 6455 CD1 LEU A 492 91.381 43.600 -43.314 1.00 36.98 C ATOM 6456 CD2 LEU A 492 89.332 42.265 -43.693 1.00 34.20 C ATOM 6457 N GLN A 493 92.945 38.887 -45.525 1.00 40.84 N ATOM 6458 CA GLN A 493 93.407 38.312 -46.793 1.00 43.30 C ATOM 6459 C GLN A 493 92.898 36.896 -46.952 1.00 40.94 C ATOM 6460 O GLN A 493 92.329 36.514 -47.973 1.00 41.84 O ATOM 6461 CB GLN A 493 94.934 38.283 -46.888 1.00 35.73 C ATOM 6462 CG GLN A 493 95.379 38.287 -48.331 1.00 36.58 C ATOM 6463 CD GLN A 493 96.865 38.206 -48.511 1.00 40.90 C ATOM 6464 OE1 GLN A 493 97.624 38.852 -47.794 1.00 39.29 O ATOM 6465 NE2 GLN A 493 97.297 37.424 -49.497 1.00 35.49 N ATOM 6466 N GLU A 494 93.123 36.111 -45.917 1.00 35.96 N ATOM 6467 CA GLU A 494 92.689 34.741 -45.928 1.00 38.20 C ATOM 6468 C GLU A 494 91.229 34.691 -46.303 1.00 37.05 C ATOM 6469 O GLU A 494 90.800 33.799 -47.014 1.00 34.93 O ATOM 6470 CB GLU A 494 92.907 34.139 -44.557 1.00 39.08 C ATOM 6471 CG GLU A 494 94.218 33.456 -44.441 1.00 45.44 C ATOM 6472 CD GLU A 494 94.175 32.127 -45.101 1.00 46.68 C ATOM 6473 OE1 GLU A 494 95.204 31.441 -45.063 1.00 47.05 O ATOM 6474 OE2 GLU A 494 93.110 31.763 -45.654 1.00 45.53 O ATOM 6475 N ALA A 495 90.473 35.670 -45.832 1.00 31.14 N ATOM 6476 CA ALA A 495 89.048 35.719 -46.108 1.00 32.71 C ATOM 6477 C ALA A 495 88.791 36.187 -47.537 1.00 31.56 C ATOM 6478 O ALA A 495 87.964 35.612 -48.252 1.00 29.24 O ATOM 6479 CB ALA A 495 88.344 36.636 -45.076 1.00 12.43 C ATOM 6480 N SER A 496 89.515 37.224 -47.937 1.00 30.44 N ATOM 6481 CA SER A 496 89.419 37.777 -49.283 1.00 31.62 C ATOM 6482 C SER A 496 89.683 36.764 -50.408 1.00 31.85 C ATOM 6483 O SER A 496 88.829 36.509 -51.255 1.00 30.22 O ATOM 6484 CB SER A 496 90.418 38.911 -49.423 1.00 31.37 C ATOM 6485 OG SER A 496 90.008 39.992 -48.633 1.00 33.80 O ATOM 6486 N GLU A 497 90.892 36.211 -50.417 1.00 49.19 N ATOM 6487 CA GLU A 497 91.280 35.253 -51.430 1.00 50.34 C ATOM 6488 C GLU A 497 90.292 34.112 -51.456 1.00 50.42 C ATOM 6489 O GLU A 497 89.860 33.671 -52.514 1.00 49.18 O ATOM 6490 CB GLU A 497 92.706 34.757 -51.160 1.00 50.06 C ATOM 6491 CG GLU A 497 93.739 35.881 -51.300 1.00 52.55 C ATOM 6492 CD GLU A 497 95.179 35.406 -51.379 1.00 54.63 C ATOM 6493 OE1 GLU A 497 95.774 35.101 -50.346 1.00 50.16 O ATOM 6494 OE2 GLU A 497 95.733 35.338 -52.484 1.00 55.23 O ATOM 6495 N ALA A 498 89.900 33.657 -50.280 1.00 29.66 N ATOM 6496 CA ALA A 498 88.950 32.556 -50.181 1.00 32.53 C ATOM 6497 C ALA A 498 87.653 32.873 -50.920 1.00 31.33 C ATOM 6498 O ALA A 498 87.156 32.059 -51.692 1.00 28.13 O ATOM 6499 CB ALA A 498 88.656 32.267 -48.730 1.00 5.52 C ATOM 6500 N TYR A 499 87.115 34.060 -50.656 1.00 27.50 N ATOM 6501 CA TYR A 499 85.885 34.538 -51.260 1.00 25.87 C ATOM 6502 C TYR A 499 86.015 34.527 -52.750 1.00 28.83 C ATOM 6503 O TYR A 499 85.135 34.053 -53.439 1.00 26.75 O ATOM 6504 CB TYR A 499 85.598 35.964 -50.793 1.00 27.17 C ATOM 6505 CG TYR A 499 84.568 36.708 -51.609 1.00 26.25 C ATOM 6506 CD1 TYR A 499 83.215 36.456 -51.467 1.00 26.11 C ATOM 6507 CD2 TYR A 499 84.947 37.654 -52.537 1.00 28.83 C ATOM 6508 CE1 TYR A 499 82.259 37.124 -52.227 1.00 27.90 C ATOM 6509 CE2 TYR A 499 83.995 38.330 -53.302 1.00 30.16 C ATOM 6510 CZ TYR A 499 82.652 38.057 -53.140 1.00 27.47 C ATOM 6511 OH TYR A 499 81.718 38.728 -53.907 1.00 26.49 O ATOM 6512 N LEU A 500 87.124 35.050 -53.245 1.00 19.53 N ATOM 6513 CA LEU A 500 87.344 35.127 -54.674 1.00 18.93 C ATOM 6514 C LEU A 500 87.454 33.762 -55.339 1.00 18.82 C ATOM 6515 O LEU A 500 86.746 33.453 -56.307 1.00 21.95 O ATOM 6516 CB LEU A 500 88.605 35.931 -54.932 1.00 21.06 C ATOM 6517 CG LEU A 500 88.415 37.403 -54.604 1.00 24.30 C ATOM 6518 CD1 LEU A 500 89.742 38.129 -54.494 1.00 24.92 C ATOM 6519 CD2 LEU A 500 87.561 37.998 -55.679 1.00 20.85 C ATOM 6520 N VAL A 501 88.365 32.948 -54.830 1.00 20.33 N ATOM 6521 CA VAL A 501 88.578 31.617 -55.382 1.00 22.33 C ATOM 6522 C VAL A 501 87.264 30.895 -55.607 1.00 21.38 C ATOM 6523 O VAL A 501 87.116 30.121 -56.547 1.00 22.09 O ATOM 6524 CB VAL A 501 89.409 30.754 -54.437 1.00 16.92 C ATOM 6525 CG1 VAL A 501 89.407 29.326 -54.922 1.00 13.76 C ATOM 6526 CG2 VAL A 501 90.813 31.307 -54.332 1.00 16.95 C ATOM 6527 N ALA A 502 86.318 31.162 -54.716 1.00 28.71 N ATOM 6528 CA ALA A 502 85.018 30.535 -54.762 1.00 28.71 C ATOM 6529 C ALA A 502 84.117 31.228 -55.750 1.00 28.36 C ATOM 6530 O ALA A 502 83.275 30.602 -56.365 1.00 28.07 O ATOM 6531 CB ALA A 502 84.412 30.559 -53.405 1.00 26.57 C ATOM 6532 N LEU A 503 84.296 32.526 -55.912 1.00 24.97 N ATOM 6533 CA LEU A 503 83.470 33.267 -56.845 1.00 25.63 C ATOM 6534 C LEU A 503 83.944 32.957 -58.265 1.00 27.44 C ATOM 6535 O LEU A 503 83.178 33.074 -59.227 1.00 28.10 O ATOM 6536 CB LEU A 503 83.539 34.784 -56.551 1.00 13.58 C ATOM 6537 CG LEU A 503 82.799 35.657 -57.565 1.00 18.23 C ATOM 6538 CD1 LEU A 503 81.319 35.316 -57.501 1.00 14.77 C ATOM 6539 CD2 LEU A 503 83.059 37.132 -57.311 1.00 13.69 C ATOM 6540 N PHE A 504 85.211 32.576 -58.404 1.00 42.46 N ATOM 6541 CA PHE A 504 85.713 32.216 -59.724 1.00 43.06 C ATOM 6542 C PHE A 504 85.126 30.823 -60.030 1.00 42.75 C ATOM 6543 O PHE A 504 84.918 30.469 -61.180 1.00 46.20 O ATOM 6544 CB PHE A 504 87.262 32.210 -59.749 1.00 15.68 C ATOM 6545 CG PHE A 504 87.878 33.545 -60.096 1.00 15.63 C ATOM 6546 CD1 PHE A 504 88.807 34.144 -59.244 1.00 16.48 C ATOM 6547 CD2 PHE A 504 87.497 34.228 -61.246 1.00 17.91 C ATOM 6548 CE1 PHE A 504 89.341 35.414 -59.533 1.00 19.31 C ATOM 6549 CE2 PHE A 504 88.027 35.494 -61.532 1.00 17.52 C ATOM 6550 CZ PHE A 504 88.943 36.081 -60.672 1.00 18.92 C ATOM 6551 N GLU A 505 84.847 30.044 -58.985 1.00 29.37 N ATOM 6552 CA GLU A 505 84.244 28.728 -59.161 1.00 30.75 C ATOM 6553 C GLU A 505 82.859 28.879 -59.777 1.00 29.20 C ATOM 6554 O GLU A 505 82.531 28.224 -60.758 1.00 31.17 O ATOM 6555 CB GLU A 505 84.150 27.991 -57.828 1.00 39.67 C ATOM 6556 CG GLU A 505 85.347 27.093 -57.580 1.00 47.30 C ATOM 6557 CD GLU A 505 85.512 26.656 -56.119 1.00 51.18 C ATOM 6558 OE1 GLU A 505 84.508 26.230 -55.508 1.00 51.01 O ATOM 6559 OE2 GLU A 505 86.651 26.726 -55.587 1.00 49.59 O ATOM 6560 N ASP A 506 82.046 29.758 -59.217 1.00 36.03 N ATOM 6561 CA ASP A 506 80.722 29.953 -59.769 1.00 36.06 C ATOM 6562 C ASP A 506 80.761 30.620 -61.155 1.00 35.35 C ATOM 6563 O ASP A 506 79.884 30.397 -61.999 1.00 36.44 O ATOM 6564 CB ASP A 506 79.871 30.806 -58.827 1.00 79.27 C ATOM 6565 CG ASP A 506 79.554 30.108 -57.522 1.00 79.85 C ATOM 6566 OD1 ASP A 506 79.218 28.904 -57.564 1.00 83.25 O ATOM 6567 OD2 ASP A 506 79.621 30.768 -56.459 1.00 84.80 O ATOM 6568 N THR A 507 81.769 31.446 -61.395 1.00 28.39 N ATOM 6569 CA THR A 507 81.840 32.123 -62.673 1.00 28.30 C ATOM 6570 C THR A 507 82.147 31.138 -63.808 1.00 29.76 C ATOM 6571 O THR A 507 81.501 31.163 -64.873 1.00 30.34 O ATOM 6572 CB THR A 507 82.886 33.286 -62.621 1.00 33.67 C ATOM 6573 OG1 THR A 507 82.449 34.287 -61.683 1.00 28.55 O ATOM 6574 CG2 THR A 507 83.039 33.943 -63.978 1.00 30.18 C ATOM 6575 N ASN A 508 83.107 30.249 -63.566 1.00 27.58 N ATOM 6576 CA ASN A 508 83.499 29.272 -64.564 1.00 27.89 C ATOM 6577 C ASN A 508 82.272 28.465 -64.902 1.00 28.57 C ATOM 6578 O ASN A 508 82.074 28.056 -66.055 1.00 25.28 O ATOM 6579 CB ASN A 508 84.601 28.365 -64.035 1.00 36.37 C ATOM 6580 CG ASN A 508 85.366 27.693 -65.150 1.00 39.98 C ATOM 6581 OD1 ASN A 508 85.810 28.351 -66.087 1.00 38.21 O ATOM 6582 ND2 ASN A 508 85.527 26.378 -65.062 1.00 40.49 N ATOM 6583 N LEU A 509 81.439 28.255 -63.890 1.00 21.50 N ATOM 6584 CA LEU A 509 80.209 27.517 -64.081 1.00 24.53 C ATOM 6585 C LEU A 509 79.278 28.309 -64.976 1.00 25.19 C ATOM 6586 O LEU A 509 78.667 27.761 -65.891 1.00 25.54 O ATOM 6587 CB LEU A 509 79.527 27.228 -62.743 1.00 16.69 C ATOM 6588 CG LEU A 509 80.123 26.041 -61.958 1.00 20.76 C ATOM 6589 CD1 LEU A 509 79.166 25.622 -60.878 1.00 19.89 C ATOM 6590 CD2 LEU A 509 80.421 24.856 -62.889 1.00 17.84 C ATOM 6591 N CYS A 510 79.180 29.609 -64.727 1.00 31.02 N ATOM 6592 CA CYS A 510 78.323 30.467 -65.541 1.00 32.69 C ATOM 6593 C CYS A 510 78.834 30.575 -66.969 1.00 35.13 C ATOM 6594 O CYS A 510 78.054 30.620 -67.920 1.00 33.76 O ATOM 6595 CB CYS A 510 78.194 31.847 -64.897 1.00 31.62 C ATOM 6596 SG CYS A 510 77.050 31.848 -63.485 1.00 33.52 S ATOM 6597 N ALA A 511 80.152 30.606 -67.105 1.00 32.14 N ATOM 6598 CA ALA A 511 80.800 30.652 -68.420 1.00 32.19 C ATOM 6599 C ALA A 511 80.485 29.353 -69.172 1.00 31.77 C ATOM 6600 O ALA A 511 80.183 29.342 -70.362 1.00 32.77 O ATOM 6601 CB ALA A 511 82.331 30.796 -68.245 1.00 29.68 C ATOM 6602 N ILE A 512 80.572 28.251 -68.450 1.00 30.73 N ATOM 6603 CA ILE A 512 80.316 26.964 -69.033 1.00 32.01 C ATOM 6604 C ILE A 512 78.852 26.803 -69.392 1.00 32.92 C ATOM 6605 O ILE A 512 78.525 26.253 -70.433 1.00 30.33 O ATOM 6606 CB ILE A 512 80.775 25.880 -68.067 1.00 17.14 C ATOM 6607 CG1 ILE A 512 82.290 26.026 -67.879 1.00 15.76 C ATOM 6608 CG2 ILE A 512 80.359 24.510 -68.547 1.00 19.07 C ATOM 6609 CD1 ILE A 512 82.967 24.847 -67.195 1.00 16.43 C ATOM 6610 N HIS A 513 77.965 27.297 -68.544 1.00 38.29 N ATOM 6611 CA HIS A 513 76.540 27.195 -68.823 1.00 38.00 C ATOM 6612 C HIS A 513 76.187 27.821 -70.180 1.00 39.42 C ATOM 6613 O HIS A 513 75.250 27.378 -70.865 1.00 37.44 O ATOM 6614 CB HIS A 513 75.761 27.900 -67.731 1.00 34.98 C ATOM 6615 CG HIS A 513 74.278 27.809 -67.889 1.00 33.93 C ATOM 6616 ND1 HIS A 513 73.590 26.620 -67.779 1.00 35.08 N ATOM 6617 CD2 HIS A 513 73.340 28.767 -68.070 1.00 32.89 C ATOM 6618 CE1 HIS A 513 72.294 26.850 -67.877 1.00 33.38 C ATOM 6619 NE2 HIS A 513 72.115 28.147 -68.052 1.00 31.86 N ATOM 6620 N ALA A 514 76.951 28.856 -70.543 1.00 21.23 N ATOM 6621 CA ALA A 514 76.783 29.607 -71.785 1.00 22.53 C ATOM 6622 C ALA A 514 77.640 29.004 -72.865 1.00 23.00 C ATOM 6623 O ALA A 514 77.893 29.623 -73.898 1.00 24.57 O ATOM 6624 CB ALA A 514 77.164 31.054 -71.580 1.00 18.98 C