>>1PFI:HELIX    2   2 GLN A   16  ALA A   46  1                                  31    
QGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 2 2 GLN A 16 ALA A 46 1 31 ATOM 198 N GLN A 16 15.593 -24.199 39.548 1.00 0.00 N ATOM 199 CA GLN A 16 14.318 -23.644 39.102 1.00 0.00 C ATOM 200 C GLN A 16 14.519 -22.682 37.956 1.00 0.00 C ATOM 201 O GLN A 16 13.572 -22.163 37.366 1.00 0.00 O ATOM 202 CB GLN A 16 13.634 -22.947 40.299 1.00 0.00 C ATOM 203 CG GLN A 16 12.223 -22.328 40.024 1.00 0.00 C ATOM 204 CD GLN A 16 11.509 -21.565 41.145 1.00 0.00 C ATOM 205 OE1 GLN A 16 10.426 -21.034 40.957 1.00 0.00 O ATOM 206 NE2 GLN A 16 12.072 -21.454 42.321 1.00 0.00 N ATOM 207 H GLN A 16 16.015 -23.908 40.360 1.00 0.00 H ATOM 208 HA GLN A 16 13.681 -24.469 38.736 1.00 0.00 H ATOM 209 HB2 GLN A 16 13.542 -23.671 41.129 1.00 0.00 H ATOM 210 HB3 GLN A 16 14.309 -22.148 40.675 1.00 0.00 H ATOM 211 HG2 GLN A 16 12.279 -21.602 39.191 1.00 0.00 H ATOM 212 HG3 GLN A 16 11.528 -23.109 39.658 1.00 0.00 H ATOM 213 HE21 GLN A 16 13.006 -21.860 42.394 1.00 0.00 H ATOM 214 HE22 GLN A 16 11.561 -20.880 42.992 1.00 0.00 H ATOM 215 N GLY A 17 15.920 -22.396 37.587 1.00 0.00 N ATOM 216 CA GLY A 17 16.267 -21.486 36.499 1.00 0.00 C ATOM 217 C GLY A 17 15.907 -22.083 35.157 1.00 0.00 C ATOM 218 O GLY A 17 15.768 -21.390 34.153 1.00 0.00 O ATOM 219 H GLY A 17 16.676 -22.902 38.168 1.00 0.00 H ATOM 220 HA2 GLY A 17 15.731 -20.525 36.621 1.00 0.00 H ATOM 221 HA3 GLY A 17 17.345 -21.258 36.518 1.00 0.00 H ATOM 222 N ASP A 18 15.735 -23.551 35.129 1.00 0.00 N ATOM 223 CA ASP A 18 15.388 -24.266 33.903 1.00 0.00 C ATOM 224 C ASP A 18 14.011 -23.875 33.423 1.00 0.00 C ATOM 225 O ASP A 18 13.752 -23.703 32.189 1.00 0.00 O ATOM 226 CB ASP A 18 15.513 -25.794 34.118 1.00 0.00 C ATOM 227 CG ASP A 18 15.880 -26.264 35.535 1.00 0.00 C ATOM 228 OD1 ASP A 18 17.025 -26.249 35.965 1.00 0.00 O ATOM 229 OD2 ASP A 18 14.795 -26.679 36.253 1.00 0.00 O ATOM 230 H ASP A 18 15.882 -24.066 36.068 1.00 0.00 H ATOM 231 HA ASP A 18 16.104 -23.930 33.129 1.00 0.00 H ATOM 232 HB2 ASP A 18 14.584 -26.314 33.829 1.00 0.00 H ATOM 233 HB3 ASP A 18 16.283 -26.200 33.428 1.00 0.00 H ATOM 234 HD2 ASP A 18 14.718 -26.197 37.074 1.00 0.00 H ATOM 235 N MET A 19 12.984 -23.702 34.471 1.00 0.00 N ATOM 236 CA MET A 19 11.609 -23.325 34.151 1.00 0.00 C ATOM 237 C MET A 19 11.554 -21.936 33.560 1.00 0.00 C ATOM 238 O MET A 19 10.798 -21.656 32.615 1.00 0.00 O ATOM 239 CB MET A 19 10.725 -23.422 35.423 1.00 0.00 C ATOM 240 CG MET A 19 10.172 -22.084 35.961 1.00 0.00 C ATOM 241 SD MET A 19 8.449 -22.289 36.444 1.00 0.00 S ATOM 242 CE MET A 19 8.375 -24.085 36.412 1.00 0.00 C ATOM 243 H MET A 19 13.308 -23.869 35.486 1.00 0.00 H ATOM 244 HA MET A 19 11.222 -24.022 33.383 1.00 0.00 H ATOM 245 HB2 MET A 19 9.872 -24.110 35.238 1.00 0.00 H ATOM 246 HB3 MET A 19 11.303 -23.902 36.237 1.00 0.00 H ATOM 247 HG2 MET A 19 10.752 -21.725 36.828 1.00 0.00 H ATOM 248 HG3 MET A 19 10.243 -21.303 35.182 1.00 0.00 H ATOM 249 HE1 MET A 19 8.269 -24.460 35.378 1.00 0.00 H ATOM 250 HE2 MET A 19 9.298 -24.515 36.845 1.00 0.00 H ATOM 251 HE3 MET A 19 7.518 -24.449 37.005 1.00 0.00 H ATOM 252 N LYS A 20 12.421 -20.880 34.123 1.00 0.00 N ATOM 253 CA LYS A 20 12.420 -19.517 33.600 1.00 0.00 C ATOM 254 C LYS A 20 12.926 -19.482 32.179 1.00 0.00 C ATOM 255 O LYS A 20 12.408 -18.755 31.314 1.00 0.00 O ATOM 256 CB LYS A 20 13.283 -18.610 34.519 1.00 0.00 C ATOM 257 CG LYS A 20 13.166 -18.963 36.021 1.00 0.00 C ATOM 258 CD LYS A 20 13.124 -17.758 36.967 1.00 0.00 C ATOM 259 CE LYS A 20 12.836 -18.241 38.393 1.00 0.00 C ATOM 260 NZ LYS A 20 12.964 -17.113 39.329 1.00 0.00 N ATOM 261 H LYS A 20 13.057 -21.178 34.944 1.00 0.00 H ATOM 262 HA LYS A 20 11.376 -19.149 33.593 1.00 0.00 H ATOM 263 HB2 LYS A 20 14.348 -18.677 34.212 1.00 0.00 H ATOM 264 HB3 LYS A 20 13.006 -17.545 34.357 1.00 0.00 H ATOM 265 HG2 LYS A 20 12.238 -19.537 36.210 1.00 0.00 H ATOM 266 HG3 LYS A 20 13.995 -19.640 36.309 1.00 0.00 H ATOM 267 HD2 LYS A 20 14.083 -17.207 36.911 1.00 0.00 H ATOM 268 HD3 LYS A 20 12.339 -17.049 36.635 1.00 0.00 H ATOM 269 HE2 LYS A 20 11.817 -18.682 38.454 1.00 0.00 H ATOM 270 HE3 LYS A 20 13.532 -19.052 38.688 1.00 0.00 H ATOM 271 HZ1 LYS A 20 12.613 -16.246 38.904 1.00 0.00 H ATOM 272 HZ3 LYS A 20 12.403 -17.265 40.175 1.00 0.00 H ATOM 273 N ALA A 21 14.073 -20.364 31.876 1.00 0.00 N ATOM 274 CA ALA A 21 14.665 -20.432 30.540 1.00 0.00 C ATOM 275 C ALA A 21 13.685 -20.997 29.543 1.00 0.00 C ATOM 276 O ALA A 21 13.590 -20.551 28.395 1.00 0.00 O ATOM 277 CB ALA A 21 15.954 -21.267 30.650 1.00 0.00 C ATOM 278 H ALA A 21 14.445 -20.956 32.700 1.00 0.00 H ATOM 279 HA ALA A 21 14.918 -19.408 30.215 1.00 0.00 H ATOM 280 HB1 ALA A 21 16.473 -21.352 29.676 1.00 0.00 H ATOM 281 HB2 ALA A 21 16.678 -20.820 31.360 1.00 0.00 H ATOM 282 HB3 ALA A 21 15.755 -22.300 31.000 1.00 0.00 H ATOM 283 N ILE A 22 12.851 -22.124 30.013 1.00 0.00 N ATOM 284 CA ILE A 22 11.863 -22.767 29.157 1.00 0.00 C ATOM 285 C ILE A 22 10.753 -21.810 28.800 1.00 0.00 C ATOM 286 O ILE A 22 10.259 -21.770 27.661 1.00 0.00 O ATOM 287 CB ILE A 22 11.303 -24.092 29.816 1.00 0.00 C ATOM 288 CG1 ILE A 22 9.769 -24.068 30.130 1.00 0.00 C ATOM 289 CG2 ILE A 22 12.055 -24.486 31.125 1.00 0.00 C ATOM 290 CD1 ILE A 22 9.042 -22.743 29.820 1.00 0.00 C ATOM 291 H ILE A 22 13.021 -22.445 31.033 1.00 0.00 H ATOM 292 HA ILE A 22 12.365 -23.036 28.209 1.00 0.00 H ATOM 293 HB ILE A 22 11.464 -24.910 29.080 1.00 0.00 H ATOM 294 HG12 ILE A 22 9.262 -24.910 29.629 1.00 0.00 H ATOM 295 HG13 ILE A 22 9.613 -24.253 31.212 1.00 0.00 H ATOM 296 HG21 ILE A 22 12.727 -23.685 31.478 1.00 0.00 H ATOM 297 HG22 ILE A 22 11.367 -24.719 31.955 1.00 0.00 H ATOM 298 HG23 ILE A 22 12.668 -25.401 31.015 1.00 0.00 H ATOM 299 HD11 ILE A 22 9.735 -21.942 29.505 1.00 0.00 H ATOM 300 HD12 ILE A 22 8.313 -22.870 29.001 1.00 0.00 H ATOM 301 HD13 ILE A 22 8.480 -22.368 30.697 1.00 0.00 H ATOM 302 N GLY A 23 10.289 -20.918 29.882 1.00 0.00 N ATOM 303 CA GLY A 23 9.223 -19.943 29.681 1.00 0.00 C ATOM 304 C GLY A 23 9.592 -18.954 28.606 1.00 0.00 C ATOM 305 O GLY A 23 8.746 -18.281 28.021 1.00 0.00 O ATOM 306 H GLY A 23 10.788 -21.034 30.834 1.00 0.00 H ATOM 307 HA2 GLY A 23 8.284 -20.454 29.399 1.00 0.00 H ATOM 308 HA3 GLY A 23 9.017 -19.397 30.621 1.00 0.00 H ATOM 309 N GLY A 24 11.033 -18.837 28.297 1.00 0.00 N ATOM 310 CA GLY A 24 11.536 -17.920 27.278 1.00 0.00 C ATOM 311 C GLY A 24 10.954 -18.244 25.924 1.00 0.00 C ATOM 312 O GLY A 24 10.938 -17.424 25.011 1.00 0.00 O ATOM 313 H GLY A 24 11.692 -19.473 28.870 1.00 0.00 H ATOM 314 HA2 GLY A 24 11.283 -16.877 27.544 1.00 0.00 H ATOM 315 HA3 GLY A 24 12.642 -17.978 27.224 1.00 0.00 H ATOM 316 N TYR A 25 10.406 -19.606 25.762 1.00 0.00 N ATOM 317 CA TYR A 25 9.811 -20.058 24.507 1.00 0.00 C ATOM 318 C TYR A 25 8.554 -19.278 24.194 1.00 0.00 C ATOM 319 O TYR A 25 8.288 -18.910 23.048 1.00 0.00 O ATOM 320 CB TYR A 25 9.430 -21.564 24.585 1.00 0.00 C ATOM 321 CG TYR A 25 9.032 -22.248 23.271 1.00 0.00 C ATOM 322 CD1 TYR A 25 9.173 -21.581 22.052 1.00 0.00 C ATOM 323 CD2 TYR A 25 8.528 -23.551 23.292 1.00 0.00 C ATOM 324 CE1 TYR A 25 8.819 -22.216 20.864 1.00 0.00 C ATOM 325 CE2 TYR A 25 8.177 -24.186 22.104 1.00 0.00 C ATOM 326 CZ TYR A 25 8.325 -23.518 20.890 1.00 0.00 C ATOM 327 OH TYR A 25 7.984 -24.141 19.723 1.00 0.00 O ATOM 328 H TYR A 25 10.470 -20.249 26.627 1.00 0.00 H ATOM 329 HA TYR A 25 10.531 -19.891 23.685 1.00 0.00 H ATOM 330 HB2 TYR A 25 10.260 -22.129 25.058 1.00 0.00 H ATOM 331 HB3 TYR A 25 8.590 -21.703 25.297 1.00 0.00 H ATOM 332 HD1 TYR A 25 9.564 -20.573 22.020 1.00 0.00 H ATOM 333 HD2 TYR A 25 8.421 -24.080 24.232 1.00 0.00 H ATOM 334 HE1 TYR A 25 8.938 -21.707 19.918 1.00 0.00 H ATOM 335 HE2 TYR A 25 7.797 -25.195 22.132 1.00 0.00 H ATOM 336 HH TYR A 25 7.667 -25.022 19.931 1.00 0.00 H ATOM 337 N ILE A 26 7.670 -18.980 25.340 1.00 0.00 N ATOM 338 CA ILE A 26 6.425 -18.235 25.183 1.00 0.00 C ATOM 339 C ILE A 26 6.694 -16.816 24.739 1.00 0.00 C ATOM 340 O ILE A 26 5.986 -16.246 23.899 1.00 0.00 O ATOM 341 CB ILE A 26 5.554 -18.284 26.504 1.00 0.00 C ATOM 342 CG1 ILE A 26 5.580 -16.971 27.349 1.00 0.00 C ATOM 343 CG2 ILE A 26 5.939 -19.469 27.440 1.00 0.00 C ATOM 344 CD1 ILE A 26 4.265 -16.164 27.382 1.00 0.00 C ATOM 345 H ILE A 26 7.998 -19.347 26.300 1.00 0.00 H ATOM 346 HA ILE A 26 5.850 -18.713 24.370 1.00 0.00 H ATOM 347 HB ILE A 26 4.500 -18.435 26.183 1.00 0.00 H ATOM 348 HG12 ILE A 26 5.920 -17.184 28.380 1.00 0.00 H ATOM 349 HG13 ILE A 26 6.345 -16.284 26.942 1.00 0.00 H ATOM 350 HG21 ILE A 26 5.833 -20.457 26.955 1.00 0.00 H ATOM 351 HG22 ILE A 26 6.978 -19.394 27.805 1.00 0.00 H ATOM 352 HG23 ILE A 26 5.289 -19.529 28.333 1.00 0.00 H ATOM 353 HD11 ILE A 26 4.461 -15.079 27.298 1.00 0.00 H ATOM 354 HD12 ILE A 26 3.597 -16.439 26.543 1.00 0.00 H ATOM 355 HD13 ILE A 26 3.700 -16.312 28.320 1.00 0.00 H ATOM 356 N VAL A 27 7.856 -16.150 25.369 1.00 0.00 N ATOM 357 CA VAL A 27 8.237 -14.779 25.038 1.00 0.00 C ATOM 358 C VAL A 27 8.681 -14.678 23.597 1.00 0.00 C ATOM 359 O VAL A 27 8.374 -13.713 22.886 1.00 0.00 O ATOM 360 CB VAL A 27 9.376 -14.289 26.015 1.00 0.00 C ATOM 361 CG1 VAL A 27 10.275 -13.133 25.500 1.00 0.00 C ATOM 362 CG2 VAL A 27 8.862 -13.819 27.399 1.00 0.00 C ATOM 363 H VAL A 27 8.405 -16.737 26.091 1.00 0.00 H ATOM 364 HA VAL A 27 7.353 -14.128 25.152 1.00 0.00 H ATOM 365 HB VAL A 27 10.049 -15.155 26.195 1.00 0.00 H ATOM 366 HG11 VAL A 27 9.697 -12.216 25.268 1.00 0.00 H ATOM 367 HG12 VAL A 27 11.056 -12.851 26.231 1.00 0.00 H ATOM 368 HG13 VAL A 27 10.830 -13.404 24.583 1.00 0.00 H ATOM 369 HG21 VAL A 27 8.230 -12.913 27.323 1.00 0.00 H ATOM 370 HG22 VAL A 27 8.254 -14.597 27.896 1.00 0.00 H ATOM 371 HG23 VAL A 27 9.691 -13.590 28.091 1.00 0.00 H ATOM 372 N GLY A 28 9.503 -15.796 23.091 1.00 0.00 N ATOM 373 CA GLY A 28 10.003 -15.827 21.721 1.00 0.00 C ATOM 374 C GLY A 28 8.898 -16.169 20.750 1.00 0.00 C ATOM 375 O GLY A 28 9.074 -16.161 19.536 1.00 0.00 O ATOM 376 H GLY A 28 9.714 -16.586 23.796 1.00 0.00 H ATOM 377 HA2 GLY A 28 10.439 -14.850 21.447 1.00 0.00 H ATOM 378 HA3 GLY A 28 10.812 -16.578 21.626 1.00 0.00 H ATOM 379 N ALA A 29 7.589 -16.513 21.350 1.00 0.00 N ATOM 380 CA ALA A 29 6.433 -16.861 20.534 1.00 0.00 C ATOM 381 C ALA A 29 5.986 -15.686 19.696 1.00 0.00 C ATOM 382 O ALA A 29 5.602 -15.822 18.528 1.00 0.00 O ATOM 383 CB ALA A 29 5.331 -17.371 21.477 1.00 0.00 C ATOM 384 H ALA A 29 7.543 -16.488 22.427 1.00 0.00 H ATOM 385 HA ALA A 29 6.721 -17.670 19.836 1.00 0.00 H ATOM 386 HB1 ALA A 29 4.423 -17.678 20.927 1.00 0.00 H ATOM 387 HB2 ALA A 29 5.664 -18.254 22.056 1.00 0.00 H ATOM 388 HB3 ALA A 29 5.024 -16.603 22.213 1.00 0.00 H ATOM 389 N LEU A 30 6.023 -14.366 20.361 1.00 0.00 N ATOM 390 CA LEU A 30 5.621 -13.142 19.675 1.00 0.00 C ATOM 391 C LEU A 30 6.550 -12.835 18.523 1.00 0.00 C ATOM 392 O LEU A 30 6.130 -12.401 17.440 1.00 0.00 O ATOM 393 CB LEU A 30 5.559 -11.953 20.674 1.00 0.00 C ATOM 394 CG LEU A 30 4.623 -12.078 21.903 1.00 0.00 C ATOM 395 CD1 LEU A 30 4.615 -10.767 22.702 1.00 0.00 C ATOM 396 CD2 LEU A 30 3.181 -12.457 21.521 1.00 0.00 C ATOM 397 H LEU A 30 6.349 -14.360 21.332 1.00 0.00 H ATOM 398 HA LEU A 30 4.620 -13.303 19.230 1.00 0.00 H ATOM 399 HB2 LEU A 30 6.583 -11.740 21.040 1.00 0.00 H ATOM 400 HB3 LEU A 30 5.274 -11.037 20.114 1.00 0.00 H ATOM 401 HG LEU A 30 5.027 -12.875 22.565 1.00 0.00 H ATOM 402 HD11 LEU A 30 5.634 -10.482 23.031 1.00 0.00 H ATOM 403 HD12 LEU A 30 4.216 -9.921 22.112 1.00 0.00 H ATOM 404 HD13 LEU A 30 3.998 -10.848 23.615 1.00 0.00 H ATOM 405 HD21 LEU A 30 2.516 -12.501 22.403 1.00 0.00 H ATOM 406 HD22 LEU A 30 2.738 -11.744 20.803 1.00 0.00 H ATOM 407 HD23 LEU A 30 3.142 -13.461 21.058 1.00 0.00 H ATOM 408 N VAL A 31 7.987 -13.080 18.770 1.00 0.00 N ATOM 409 CA VAL A 31 8.999 -12.827 17.750 1.00 0.00 C ATOM 410 C VAL A 31 8.821 -13.750 16.568 1.00 0.00 C ATOM 411 O VAL A 31 8.967 -13.360 15.403 1.00 0.00 O ATOM 412 CB VAL A 31 10.443 -12.992 18.374 1.00 0.00 C ATOM 413 CG1 VAL A 31 11.547 -12.051 17.817 1.00 0.00 C ATOM 414 CG2 VAL A 31 10.485 -12.807 19.912 1.00 0.00 C ATOM 415 H VAL A 31 8.242 -13.458 19.751 1.00 0.00 H ATOM 416 HA VAL A 31 8.880 -11.795 17.377 1.00 0.00 H ATOM 417 HB VAL A 31 10.775 -14.031 18.162 1.00 0.00 H ATOM 418 HG11 VAL A 31 11.302 -10.982 17.960 1.00 0.00 H ATOM 419 HG12 VAL A 31 12.529 -12.231 18.292 1.00 0.00 H ATOM 420 HG13 VAL A 31 11.724 -12.203 16.734 1.00 0.00 H ATOM 421 HG21 VAL A 31 10.234 -11.773 20.213 1.00 0.00 H ATOM 422 HG22 VAL A 31 9.779 -13.480 20.427 1.00 0.00 H ATOM 423 HG23 VAL A 31 11.485 -13.034 20.326 1.00 0.00 H ATOM 424 N ILE A 32 8.455 -15.147 16.885 1.00 0.00 N ATOM 425 CA ILE A 32 8.248 -16.150 15.843 1.00 0.00 C ATOM 426 C ILE A 32 7.059 -15.801 14.987 1.00 0.00 C ATOM 427 O ILE A 32 7.063 -15.962 13.756 1.00 0.00 O ATOM 428 CB ILE A 32 8.124 -17.604 16.458 1.00 0.00 C ATOM 429 CG1 ILE A 32 9.293 -18.004 17.420 1.00 0.00 C ATOM 430 CG2 ILE A 32 7.994 -18.712 15.368 1.00 0.00 C ATOM 431 CD1 ILE A 32 9.052 -19.263 18.279 1.00 0.00 C ATOM 432 H ILE A 32 8.352 -15.383 17.934 1.00 0.00 H ATOM 433 HA ILE A 32 9.131 -16.127 15.180 1.00 0.00 H ATOM 434 HB ILE A 32 7.194 -17.615 17.062 1.00 0.00 H ATOM 435 HG12 ILE A 32 10.239 -18.105 16.854 1.00 0.00 H ATOM 436 HG13 ILE A 32 9.478 -17.182 18.136 1.00 0.00 H ATOM 437 HG21 ILE A 32 7.117 -18.572 14.711 1.00 0.00 H ATOM 438 HG22 ILE A 32 8.887 -18.765 14.718 1.00 0.00 H ATOM 439 HG23 ILE A 32 7.852 -19.718 15.805 1.00 0.00 H ATOM 440 HD11 ILE A 32 9.889 -19.435 18.981 1.00 0.00 H ATOM 441 HD12 ILE A 32 8.130 -19.174 18.889 1.00 0.00 H ATOM 442 HD13 ILE A 32 8.957 -20.181 17.670 1.00 0.00 H ATOM 443 N LEU A 33 5.881 -15.253 15.700 1.00 0.00 N ATOM 444 CA LEU A 33 4.659 -14.872 14.999 1.00 0.00 C ATOM 445 C LEU A 33 4.910 -13.708 14.070 1.00 0.00 C ATOM 446 O LEU A 33 4.399 -13.644 12.943 1.00 0.00 O ATOM 447 CB LEU A 33 3.530 -14.536 16.014 1.00 0.00 C ATOM 448 CG LEU A 33 3.042 -13.065 16.102 1.00 0.00 C ATOM 449 CD1 LEU A 33 2.000 -12.787 15.010 1.00 0.00 C ATOM 450 CD2 LEU A 33 2.454 -12.717 17.481 1.00 0.00 C ATOM 451 H LEU A 33 5.976 -15.160 16.717 1.00 0.00 H ATOM 452 HA LEU A 33 4.344 -15.715 14.361 1.00 0.00 H ATOM 453 HB2 LEU A 33 2.650 -15.177 15.791 1.00 0.00 H ATOM 454 HB3 LEU A 33 3.857 -14.853 17.022 1.00 0.00 H ATOM 455 HG LEU A 33 3.909 -12.400 15.920 1.00 0.00 H ATOM 456 HD11 LEU A 33 2.402 -12.984 13.998 1.00 0.00 H ATOM 457 HD12 LEU A 33 1.091 -13.410 15.128 1.00 0.00 H ATOM 458 HD13 LEU A 33 1.673 -11.732 15.018 1.00 0.00 H ATOM 459 HD21 LEU A 33 1.346 -12.712 17.475 1.00 0.00 H ATOM 460 HD22 LEU A 33 2.773 -13.444 18.250 1.00 0.00 H ATOM 461 HD23 LEU A 33 2.790 -11.727 17.837 1.00 0.00 H ATOM 462 N ALA A 34 5.807 -12.648 14.583 1.00 0.00 N ATOM 463 CA ALA A 34 6.139 -11.464 13.795 1.00 0.00 C ATOM 464 C ALA A 34 6.930 -11.843 12.563 1.00 0.00 C ATOM 465 O ALA A 34 6.742 -11.295 11.471 1.00 0.00 O ATOM 466 CB ALA A 34 6.894 -10.489 14.712 1.00 0.00 C ATOM 467 H ALA A 34 6.200 -12.801 15.579 1.00 0.00 H ATOM 468 HA ALA A 34 5.199 -10.993 13.449 1.00 0.00 H ATOM 469 HB1 ALA A 34 7.166 -9.557 14.185 1.00 0.00 H ATOM 470 HB2 ALA A 34 6.285 -10.195 15.588 1.00 0.00 H ATOM 471 HB3 ALA A 34 7.834 -10.928 15.104 1.00 0.00 H ATOM 472 N VAL A 35 7.952 -12.895 12.746 1.00 0.00 N ATOM 473 CA VAL A 35 8.789 -13.360 11.644 1.00 0.00 C ATOM 474 C VAL A 35 7.959 -14.042 10.584 1.00 0.00 C ATOM 475 O VAL A 35 8.177 -13.881 9.376 1.00 0.00 O ATOM 476 CB VAL A 35 9.910 -14.331 12.195 1.00 0.00 C ATOM 477 CG1 VAL A 35 10.703 -13.831 13.433 1.00 0.00 C ATOM 478 CG2 VAL A 35 9.389 -15.733 12.583 1.00 0.00 C ATOM 479 H VAL A 35 8.041 -13.300 13.744 1.00 0.00 H ATOM 480 HA VAL A 35 9.269 -12.484 11.169 1.00 0.00 H ATOM 481 HB VAL A 35 10.651 -14.468 11.381 1.00 0.00 H ATOM 482 HG11 VAL A 35 10.519 -12.760 13.650 1.00 0.00 H ATOM 483 HG12 VAL A 35 10.460 -14.393 14.349 1.00 0.00 H ATOM 484 HG13 VAL A 35 11.801 -13.902 13.288 1.00 0.00 H ATOM 485 HG21 VAL A 35 9.171 -15.818 13.663 1.00 0.00 H ATOM 486 HG22 VAL A 35 8.464 -15.996 12.042 1.00 0.00 H ATOM 487 HG23 VAL A 35 10.122 -16.527 12.335 1.00 0.00 H ATOM 488 N ALA A 36 6.870 -14.913 11.075 1.00 0.00 N ATOM 489 CA ALA A 36 5.987 -15.635 10.163 1.00 0.00 C ATOM 490 C ALA A 36 5.151 -14.679 9.346 1.00 0.00 C ATOM 491 O ALA A 36 4.911 -14.876 8.149 1.00 0.00 O ATOM 492 CB ALA A 36 5.136 -16.598 11.005 1.00 0.00 C ATOM 493 H ALA A 36 6.764 -14.981 12.148 1.00 0.00 H ATOM 494 HA ALA A 36 6.610 -16.215 9.454 1.00 0.00 H ATOM 495 HB1 ALA A 36 4.451 -17.200 10.380 1.00 0.00 H ATOM 496 HB2 ALA A 36 5.763 -17.317 11.566 1.00 0.00 H ATOM 497 HB3 ALA A 36 4.511 -16.065 11.749 1.00 0.00 H ATOM 498 N GLY A 37 4.629 -13.496 10.066 1.00 0.00 N ATOM 499 CA GLY A 37 3.805 -12.489 9.403 1.00 0.00 C ATOM 500 C GLY A 37 4.593 -11.765 8.338 1.00 0.00 C ATOM 501 O GLY A 37 4.099 -11.469 7.252 1.00 0.00 O ATOM 502 H GLY A 37 4.890 -13.425 11.112 1.00 0.00 H ATOM 503 HA2 GLY A 37 2.918 -12.961 8.944 1.00 0.00 H ATOM 504 HA3 GLY A 37 3.432 -11.754 10.142 1.00 0.00 H ATOM 505 N LEU A 38 5.996 -11.439 8.675 1.00 0.00 N ATOM 506 CA LEU A 38 6.873 -10.740 7.741 1.00 0.00 C ATOM 507 C LEU A 38 7.133 -11.581 6.512 1.00 0.00 C ATOM 508 O LEU A 38 7.170 -11.088 5.376 1.00 0.00 O ATOM 509 CB LEU A 38 8.210 -10.345 8.436 1.00 0.00 C ATOM 510 CG LEU A 38 8.161 -9.254 9.538 1.00 0.00 C ATOM 511 CD1 LEU A 38 8.718 -7.931 8.994 1.00 0.00 C ATOM 512 CD2 LEU A 38 6.744 -9.029 10.090 1.00 0.00 C ATOM 513 H LEU A 38 6.313 -11.728 9.606 1.00 0.00 H ATOM 514 HA LEU A 38 6.358 -9.830 7.389 1.00 0.00 H ATOM 515 HB2 LEU A 38 8.663 -11.258 8.875 1.00 0.00 H ATOM 516 HB3 LEU A 38 8.929 -10.025 7.659 1.00 0.00 H ATOM 517 HG LEU A 38 8.814 -9.578 10.376 1.00 0.00 H ATOM 518 HD11 LEU A 38 9.757 -8.044 8.625 1.00 0.00 H ATOM 519 HD12 LEU A 38 8.116 -7.535 8.154 1.00 0.00 H ATOM 520 HD13 LEU A 38 8.747 -7.149 9.775 1.00 0.00 H ATOM 521 HD21 LEU A 38 6.717 -8.217 10.840 1.00 0.00 H ATOM 522 HD22 LEU A 38 6.021 -8.777 9.295 1.00 0.00 H ATOM 523 HD23 LEU A 38 6.365 -9.933 10.604 1.00 0.00 H ATOM 524 N ILE A 39 7.337 -13.027 6.748 1.00 0.00 N ATOM 525 CA ILE A 39 7.600 -13.961 5.655 1.00 0.00 C ATOM 526 C ILE A 39 6.411 -14.055 4.730 1.00 0.00 C ATOM 527 O ILE A 39 6.540 -14.124 3.499 1.00 0.00 O ATOM 528 CB ILE A 39 8.038 -15.379 6.201 1.00 0.00 C ATOM 529 CG1 ILE A 39 9.280 -15.360 7.145 1.00 0.00 C ATOM 530 CG2 ILE A 39 8.310 -16.408 5.062 1.00 0.00 C ATOM 531 CD1 ILE A 39 9.903 -13.977 7.414 1.00 0.00 C ATOM 532 H ILE A 39 7.283 -13.353 7.775 1.00 0.00 H ATOM 533 HA ILE A 39 8.430 -13.546 5.055 1.00 0.00 H ATOM 534 HB ILE A 39 7.186 -15.765 6.803 1.00 0.00 H ATOM 535 HG12 ILE A 39 9.044 -15.865 8.101 1.00 0.00 H ATOM 536 HG13 ILE A 39 10.090 -15.975 6.703 1.00 0.00 H ATOM 537 HG21 ILE A 39 7.438 -16.579 4.408 1.00 0.00 H ATOM 538 HG22 ILE A 39 9.150 -16.098 4.410 1.00 0.00 H ATOM 539 HG23 ILE A 39 8.561 -17.412 5.450 1.00 0.00 H ATOM 540 HD11 ILE A 39 10.953 -14.066 7.743 1.00 0.00 H ATOM 541 HD12 ILE A 39 9.899 -13.340 6.509 1.00 0.00 H ATOM 542 HD13 ILE A 39 9.369 -13.421 8.208 1.00 0.00 H ATOM 543 N TYR A 40 5.082 -14.063 5.379 1.00 0.00 N ATOM 544 CA TYR A 40 3.843 -14.151 4.610 1.00 0.00 C ATOM 545 C TYR A 40 3.655 -12.927 3.744 1.00 0.00 C ATOM 546 O TYR A 40 3.217 -13.001 2.596 1.00 0.00 O ATOM 547 CB TYR A 40 2.611 -14.269 5.552 1.00 0.00 C ATOM 548 CG TYR A 40 1.858 -12.934 5.580 1.00 0.00 C ATOM 549 CD1 TYR A 40 1.398 -12.349 4.396 1.00 0.00 C ATOM 550 CD2 TYR A 40 1.620 -12.299 6.803 1.00 0.00 C ATOM 551 CE1 TYR A 40 0.700 -11.143 4.437 1.00 0.00 C ATOM 552 CE2 TYR A 40 0.925 -11.093 6.841 1.00 0.00 C ATOM 553 CZ TYR A 40 0.465 -10.517 5.659 1.00 0.00 C ATOM 554 OH TYR A 40 -0.219 -9.338 5.695 1.00 0.00 O ATOM 555 H TYR A 40 5.082 -13.999 6.457 1.00 0.00 H ATOM 556 HA TYR A 40 3.898 -15.031 3.943 1.00 0.00 H ATOM 557 HB2 TYR A 40 1.895 -15.089 5.334 1.00 0.00 H ATOM 558 HB3 TYR A 40 2.991 -14.371 6.587 1.00 0.00 H ATOM 559 HD1 TYR A 40 1.571 -12.832 3.445 1.00 0.00 H ATOM 560 HD2 TYR A 40 1.961 -12.746 7.726 1.00 0.00 H ATOM 561 HE1 TYR A 40 0.339 -10.695 3.526 1.00 0.00 H ATOM 562 HE2 TYR A 40 0.742 -10.615 7.791 1.00 0.00 H ATOM 563 HH TYR A 40 -0.291 -9.056 6.610 1.00 0.00 H ATOM 564 N SER A 41 4.028 -11.635 4.361 1.00 0.00 N ATOM 565 CA SER A 41 3.899 -10.370 3.644 1.00 0.00 C ATOM 566 C SER A 41 4.831 -10.323 2.457 1.00 0.00 C ATOM 567 O SER A 41 4.492 -9.839 1.377 1.00 0.00 O ATOM 568 CB SER A 41 4.126 -9.171 4.596 1.00 0.00 C ATOM 569 OG SER A 41 5.484 -9.053 5.031 1.00 0.00 O ATOM 570 H SER A 41 4.401 -11.684 5.373 1.00 0.00 H ATOM 571 HA SER A 41 2.869 -10.313 3.245 1.00 0.00 H ATOM 572 HB2 SER A 41 3.842 -8.230 4.086 1.00 0.00 H ATOM 573 HB3 SER A 41 3.459 -9.228 5.480 1.00 0.00 H ATOM 574 HG SER A 41 5.694 -9.846 5.537 1.00 0.00 H ATOM 575 N MET A 42 6.180 -10.894 2.669 1.00 0.00 N ATOM 576 CA MET A 42 7.184 -10.916 1.611 1.00 0.00 C ATOM 577 C MET A 42 6.746 -11.803 0.469 1.00 0.00 C ATOM 578 O MET A 42 6.947 -11.493 -0.714 1.00 0.00 O ATOM 579 CB MET A 42 8.546 -11.386 2.188 1.00 0.00 C ATOM 580 CG MET A 42 8.758 -12.915 2.256 1.00 0.00 C ATOM 581 SD MET A 42 10.490 -13.305 1.954 1.00 0.00 S ATOM 582 CE MET A 42 10.314 -15.069 1.649 1.00 0.00 C ATOM 583 H MET A 42 6.375 -11.292 3.654 1.00 0.00 H ATOM 584 HA MET A 42 7.293 -9.891 1.205 1.00 0.00 H ATOM 585 HB2 MET A 42 9.378 -10.938 1.608 1.00 0.00 H ATOM 586 HB3 MET A 42 8.670 -10.987 3.214 1.00 0.00 H ATOM 587 HG2 MET A 42 8.458 -13.324 3.239 1.00 0.00 H ATOM 588 HG3 MET A 42 8.130 -13.420 1.497 1.00 0.00 H ATOM 589 HE1 MET A 42 11.141 -15.635 2.117 1.00 0.00 H ATOM 590 HE2 MET A 42 9.358 -15.435 2.062 1.00 0.00 H ATOM 591 HE3 MET A 42 10.322 -15.274 0.564 1.00 0.00 H ATOM 592 N LEU A 43 6.075 -13.063 0.848 1.00 0.00 N ATOM 593 CA LEU A 43 5.600 -14.018 -0.150 1.00 0.00 C ATOM 594 C LEU A 43 4.489 -13.419 -0.984 1.00 0.00 C ATOM 595 O LEU A 43 4.411 -13.613 -2.206 1.00 0.00 O ATOM 596 CB LEU A 43 5.130 -15.333 0.532 1.00 0.00 C ATOM 597 CG LEU A 43 4.614 -16.484 -0.377 1.00 0.00 C ATOM 598 CD1 LEU A 43 3.135 -16.258 -0.723 1.00 0.00 C ATOM 599 CD2 LEU A 43 5.431 -16.632 -1.668 1.00 0.00 C ATOM 600 H LEU A 43 5.960 -13.228 1.854 1.00 0.00 H ATOM 601 HA LEU A 43 6.428 -14.235 -0.845 1.00 0.00 H ATOM 602 HB2 LEU A 43 5.963 -15.730 1.150 1.00 0.00 H ATOM 603 HB3 LEU A 43 4.335 -15.086 1.262 1.00 0.00 H ATOM 604 HG LEU A 43 4.687 -17.433 0.193 1.00 0.00 H ATOM 605 HD11 LEU A 43 2.506 -16.188 0.186 1.00 0.00 H ATOM 606 HD12 LEU A 43 2.977 -15.329 -1.301 1.00 0.00 H ATOM 607 HD13 LEU A 43 2.726 -17.093 -1.325 1.00 0.00 H ATOM 608 HD21 LEU A 43 5.026 -17.424 -2.326 1.00 0.00 H ATOM 609 HD22 LEU A 43 5.466 -15.695 -2.254 1.00 0.00 H ATOM 610 HD23 LEU A 43 6.478 -16.921 -1.450 1.00 0.00 H ATOM 611 N ARG A 44 3.505 -12.591 -0.256 1.00 0.00 N ATOM 612 CA ARG A 44 2.380 -11.952 -0.934 1.00 0.00 C ATOM 613 C ARG A 44 2.861 -10.908 -1.915 1.00 0.00 C ATOM 614 O ARG A 44 2.325 -10.747 -3.008 1.00 0.00 O ATOM 615 CB ARG A 44 1.435 -11.333 0.132 1.00 0.00 C ATOM 616 CG ARG A 44 0.811 -9.968 -0.261 1.00 0.00 C ATOM 617 CD ARG A 44 -0.054 -9.373 0.858 1.00 0.00 C ATOM 618 NE ARG A 44 -0.659 -8.113 0.360 1.00 0.00 N ATOM 619 CZ ARG A 44 -0.706 -6.965 1.029 1.00 0.00 C ATOM 620 NH1 ARG A 44 -0.220 -6.790 2.222 1.00 0.00 N ATOM 621 NH2 ARG A 44 -1.272 -5.966 0.450 1.00 0.00 N ATOM 622 H ARG A 44 3.650 -12.499 0.689 1.00 0.00 H ATOM 623 HA ARG A 44 1.840 -12.728 -1.508 1.00 0.00 H ATOM 624 HB2 ARG A 44 0.608 -12.040 0.350 1.00 0.00 H ATOM 625 HB3 ARG A 44 1.977 -11.234 1.094 1.00 0.00 H ATOM 626 HG2 ARG A 44 1.602 -9.231 -0.517 1.00 0.00 H ATOM 627 HG3 ARG A 44 0.203 -10.075 -1.182 1.00 0.00 H ATOM 628 HD2 ARG A 44 -0.845 -10.091 1.153 1.00 0.00 H ATOM 629 HD3 ARG A 44 0.565 -9.175 1.760 1.00 0.00 H ATOM 630 HH11 ARG A 44 0.212 -7.632 2.604 1.00 0.00 H ATOM 631 HH12 ARG A 44 -0.319 -5.863 2.629 1.00 0.00 H ATOM 632 HH21 ARG A 44 -1.313 -5.083 0.956 1.00 0.00 H ATOM 633 HH22 ARG A 44 -1.623 -6.209 -0.478 1.00 0.00 H ATOM 634 N LYS A 45 4.000 -10.077 -1.470 1.00 0.00 N ATOM 635 CA LYS A 45 4.570 -9.029 -2.311 1.00 0.00 C ATOM 636 C LYS A 45 5.202 -9.617 -3.552 1.00 0.00 C ATOM 637 O LYS A 45 5.096 -9.076 -4.663 1.00 0.00 O ATOM 638 CB LYS A 45 5.604 -8.211 -1.493 1.00 0.00 C ATOM 639 CG LYS A 45 5.060 -6.848 -0.997 1.00 0.00 C ATOM 640 CD LYS A 45 4.473 -5.952 -2.089 1.00 0.00 C ATOM 641 CE LYS A 45 3.912 -4.674 -1.451 1.00 0.00 C ATOM 642 NZ LYS A 45 3.504 -3.735 -2.511 1.00 0.00 N ATOM 643 H LYS A 45 4.383 -10.287 -0.483 1.00 0.00 H ATOM 644 HA LYS A 45 3.750 -8.363 -2.641 1.00 0.00 H ATOM 645 HB2 LYS A 45 5.946 -8.805 -0.624 1.00 0.00 H ATOM 646 HB3 LYS A 45 6.517 -8.050 -2.104 1.00 0.00 H ATOM 647 HG2 LYS A 45 4.254 -7.004 -0.257 1.00 0.00 H ATOM 648 HG3 LYS A 45 5.859 -6.306 -0.452 1.00 0.00 H ATOM 649 HD2 LYS A 45 5.251 -5.718 -2.844 1.00 0.00 H ATOM 650 HD3 LYS A 45 3.670 -6.494 -2.630 1.00 0.00 H ATOM 651 HE2 LYS A 45 3.053 -4.915 -0.793 1.00 0.00 H ATOM 652 HE3 LYS A 45 4.668 -4.190 -0.796 1.00 0.00 H ATOM 653 HZ1 LYS A 45 4.306 -3.484 -3.100 1.00 0.00 H ATOM 654 HZ3 LYS A 45 2.814 -4.162 -3.138 1.00 0.00 H ATOM 655 N ALA A 46 5.955 -10.873 -3.360 1.00 0.00 N ATOM 656 CA ALA A 46 6.620 -11.556 -4.468 1.00 0.00 C ATOM 657 C ALA A 46 5.613 -12.058 -5.475 1.00 0.00 C ATOM 658 O ALA A 46 4.397 -11.876 -5.334 1.00 0.00 O ATOM 659 CB ALA A 46 7.479 -12.682 -3.871 1.00 0.00 C ATOM 660 OXT ALA A 46 6.078 -12.766 -6.626 1.00 0.00 O ATOM 661 H ALA A 46 5.987 -11.259 -2.350 1.00 0.00 H ATOM 662 HA ALA A 46 7.273 -10.830 -4.988 1.00 0.00 H ATOM 663 HB1 ALA A 46 8.237 -12.295 -3.165 1.00 0.00 H ATOM 664 HB2 ALA A 46 6.871 -13.425 -3.318 1.00 0.00 H ATOM 665 HB3 ALA A 46 8.030 -13.238 -4.656 1.00 0.00 H ATOM 666 HXT ALA A 46 6.043 -12.689 -7.586 1.00 0.00 H