>>1QP7:HELIX    5   5 ALA A   55  LYS A   88  1                                  34    
AVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 5 5 ALA A 55 LYS A 88 1 34 ATOM 751 N ALA A 55 19.885 5.572 0.251 1.00 33.04 N ATOM 752 CA ALA A 55 19.046 6.733 0.354 1.00 34.30 C ATOM 753 C ALA A 55 19.717 8.050 -0.115 1.00 49.14 C ATOM 754 O ALA A 55 19.292 8.656 -1.104 1.00 61.60 O ATOM 755 CB ALA A 55 18.514 6.865 1.765 1.00 34.60 C ATOM 756 N VAL A 56 20.757 8.492 0.585 1.00 35.22 N ATOM 757 CA VAL A 56 21.442 9.738 0.263 1.00 31.31 C ATOM 758 C VAL A 56 22.138 9.871 -1.052 1.00 34.47 C ATOM 759 O VAL A 56 22.492 10.972 -1.426 1.00 34.11 O ATOM 760 CB VAL A 56 22.515 10.012 1.241 1.00 31.47 C ATOM 761 CG1 VAL A 56 21.945 9.954 2.639 1.00 27.48 C ATOM 762 CG2 VAL A 56 23.627 8.995 0.965 1.00 31.78 C ATOM 763 N ASN A 57 22.366 8.768 -1.740 1.00 36.81 N ATOM 764 CA ASN A 57 23.036 8.803 -3.045 1.00 37.29 C ATOM 765 C ASN A 57 24.510 9.094 -3.166 1.00 43.23 C ATOM 766 O ASN A 57 24.924 9.750 -4.106 1.00 44.35 O ATOM 767 CB ASN A 57 22.302 9.636 -4.077 1.00 33.35 C ATOM 768 CG ASN A 57 22.146 8.899 -5.393 1.00 92.75 C ATOM 769 OD1 ASN A 57 21.223 8.072 -5.558 1.00100.00 O ATOM 770 ND2 ASN A 57 23.063 9.162 -6.332 1.00 58.41 N ATOM 771 N HIS A 58 25.294 8.598 -2.223 1.00 44.36 N ATOM 772 CA HIS A 58 26.735 8.768 -2.244 1.00 45.29 C ATOM 773 C HIS A 58 27.308 7.838 -1.186 1.00 42.55 C ATOM 774 O HIS A 58 26.775 7.689 -0.079 1.00 44.50 O ATOM 775 CB HIS A 58 27.183 10.246 -2.179 1.00 49.89 C ATOM 776 CG HIS A 58 26.877 10.913 -0.882 1.00 56.79 C ATOM 777 ND1 HIS A 58 25.742 11.674 -0.687 1.00 60.60 N ATOM 778 CD2 HIS A 58 27.551 10.924 0.295 1.00 61.68 C ATOM 779 CE1 HIS A 58 25.727 12.120 0.562 1.00 62.54 C ATOM 780 NE2 HIS A 58 26.813 11.679 1.180 1.00 62.84 N ATOM 781 N THR A 59 28.374 7.159 -1.544 1.00 34.58 N ATOM 782 CA THR A 59 29.003 6.199 -0.631 1.00 33.44 C ATOM 783 C THR A 59 30.044 6.720 0.357 1.00 33.97 C ATOM 784 O THR A 59 30.375 6.049 1.319 1.00 29.65 O ATOM 785 CB THR A 59 29.763 5.264 -1.483 1.00 41.68 C ATOM 786 OG1 THR A 59 30.914 5.942 -2.036 1.00 39.70 O ATOM 787 CG2 THR A 59 28.864 4.837 -2.578 1.00 43.34 C ATOM 788 N LYS A 60 30.572 7.907 0.085 1.00 29.62 N ATOM 789 CA LYS A 60 31.581 8.502 0.920 1.00 28.79 C ATOM 790 C LYS A 60 32.782 7.578 0.942 1.00 33.88 C ATOM 791 O LYS A 60 33.382 7.278 1.984 1.00 39.22 O ATOM 792 CB LYS A 60 31.076 8.866 2.311 1.00 29.24 C ATOM 793 CG LYS A 60 31.549 10.260 2.828 1.00 48.76 C ATOM 794 CD LYS A 60 30.950 11.459 2.023 1.00 81.26 C ATOM 795 CE LYS A 60 30.749 12.755 2.876 1.00100.00 C ATOM 796 NZ LYS A 60 31.905 13.103 3.791 1.00100.00 N ATOM 797 N SER A 61 33.140 7.134 -0.239 1.00 24.53 N ATOM 798 CA SER A 61 34.275 6.281 -0.337 1.00 26.26 C ATOM 799 C SER A 61 34.826 6.574 -1.718 1.00 32.14 C ATOM 800 O SER A 61 34.076 6.841 -2.679 1.00 30.19 O ATOM 801 CB SER A 61 33.821 4.842 -0.214 1.00 34.56 C ATOM 802 OG SER A 61 33.082 4.476 -1.345 1.00 57.45 O ATOM 803 N ILE A 62 36.146 6.557 -1.824 1.00 32.77 N ATOM 804 CA ILE A 62 36.759 6.843 -3.118 1.00 34.79 C ATOM 805 C ILE A 62 37.695 5.721 -3.492 1.00 33.10 C ATOM 806 O ILE A 62 38.311 5.083 -2.626 1.00 29.99 O ATOM 807 CB ILE A 62 37.431 8.274 -3.234 1.00 37.88 C ATOM 808 CG1 ILE A 62 38.913 8.186 -3.035 1.00 33.76 C ATOM 809 CG2 ILE A 62 36.760 9.374 -2.402 1.00 41.46 C ATOM 810 CD1 ILE A 62 39.547 7.903 -4.363 1.00 47.92 C ATOM 811 N GLY A 63 37.780 5.454 -4.788 1.00 28.91 N ATOM 812 CA GLY A 63 38.640 4.360 -5.232 1.00 31.35 C ATOM 813 C GLY A 63 39.918 4.756 -5.978 1.00 43.31 C ATOM 814 O GLY A 63 39.926 5.665 -6.808 1.00 47.66 O ATOM 815 N LEU A 64 40.991 4.046 -5.652 1.00 38.39 N ATOM 816 CA LEU A 64 42.319 4.223 -6.216 1.00 34.16 C ATOM 817 C LEU A 64 42.550 3.077 -7.150 1.00 36.24 C ATOM 818 O LEU A 64 42.723 1.912 -6.704 1.00 33.30 O ATOM 819 CB LEU A 64 43.348 4.048 -5.105 1.00 33.20 C ATOM 820 CG LEU A 64 44.769 4.589 -5.291 1.00 36.76 C ATOM 821 CD1 LEU A 64 44.971 5.356 -6.533 1.00 34.18 C ATOM 822 CD2 LEU A 64 45.082 5.459 -4.120 1.00 42.13 C ATOM 823 N LEU A 65 42.546 3.408 -8.434 1.00 27.43 N ATOM 824 CA LEU A 65 42.782 2.410 -9.449 1.00 25.28 C ATOM 825 C LEU A 65 44.255 2.566 -9.800 1.00 30.67 C ATOM 826 O LEU A 65 44.650 3.302 -10.701 1.00 31.99 O ATOM 827 CB LEU A 65 41.917 2.688 -10.652 1.00 25.89 C ATOM 828 CG LEU A 65 42.378 1.780 -11.785 1.00 30.44 C ATOM 829 CD1 LEU A 65 42.631 0.446 -11.173 1.00 29.91 C ATOM 830 CD2 LEU A 65 41.347 1.694 -12.909 1.00 22.18 C ATOM 831 N ALA A 66 45.070 1.858 -9.049 1.00 26.89 N ATOM 832 CA ALA A 66 46.508 1.892 -9.192 1.00 24.32 C ATOM 833 C ALA A 66 47.105 0.905 -10.128 1.00 32.88 C ATOM 834 O ALA A 66 46.425 0.279 -10.887 1.00 36.48 O ATOM 835 CB ALA A 66 47.103 1.632 -7.844 1.00 25.22 C ATOM 836 N THR A 67 48.420 0.760 -10.016 1.00 34.76 N ATOM 837 CA THR A 67 49.195 -0.169 -10.827 1.00 31.72 C ATOM 838 C THR A 67 49.702 -1.294 -9.928 1.00 29.18 C ATOM 839 O THR A 67 49.255 -2.412 -9.990 1.00 25.58 O ATOM 840 CB THR A 67 50.346 0.575 -11.478 1.00 28.74 C ATOM 841 OG1 THR A 67 49.825 1.549 -12.402 1.00 53.69 O ATOM 842 CG2 THR A 67 51.181 -0.373 -12.246 1.00 18.18 C ATOM 843 N SER A 68 50.642 -0.956 -9.074 1.00 28.28 N ATOM 844 CA SER A 68 51.237 -1.868 -8.122 1.00 29.29 C ATOM 845 C SER A 68 51.256 -1.000 -6.847 1.00 36.33 C ATOM 846 O SER A 68 51.178 0.213 -6.911 1.00 41.49 O ATOM 847 CB SER A 68 52.687 -2.261 -8.551 1.00 33.00 C ATOM 848 OG SER A 68 53.529 -2.629 -7.418 1.00 44.70 O ATOM 849 N SER A 69 51.372 -1.603 -5.685 1.00 29.27 N ATOM 850 CA SER A 69 51.371 -0.822 -4.487 1.00 27.36 C ATOM 851 C SER A 69 52.569 -1.105 -3.585 1.00 33.39 C ATOM 852 O SER A 69 52.676 -0.501 -2.531 1.00 33.58 O ATOM 853 CB SER A 69 50.045 -1.107 -3.725 1.00 35.62 C ATOM 854 OG SER A 69 50.031 -2.345 -2.980 1.00 39.97 O ATOM 855 N GLU A 70 53.449 -2.042 -3.948 1.00 28.82 N ATOM 856 CA GLU A 70 54.587 -2.335 -3.073 1.00 27.43 C ATOM 857 C GLU A 70 55.717 -1.348 -3.351 1.00 30.86 C ATOM 858 O GLU A 70 56.362 -0.829 -2.451 1.00 36.83 O ATOM 859 CB GLU A 70 55.061 -3.766 -3.258 1.00 30.49 C ATOM 860 CG GLU A 70 56.058 -4.217 -2.195 1.00 47.76 C ATOM 861 CD GLU A 70 57.500 -4.100 -2.658 1.00 73.85 C ATOM 862 OE1 GLU A 70 57.664 -3.920 -3.896 1.00 50.42 O ATOM 863 OE2 GLU A 70 58.442 -4.168 -1.801 1.00 65.08 O ATOM 864 N ALA A 71 55.942 -1.090 -4.623 1.00 20.04 N ATOM 865 CA ALA A 71 56.952 -0.152 -5.081 1.00 13.66 C ATOM 866 C ALA A 71 56.971 1.153 -4.285 1.00 22.26 C ATOM 867 O ALA A 71 55.946 1.905 -4.198 1.00 18.87 O ATOM 868 CB ALA A 71 56.641 0.178 -6.527 1.00 13.93 C ATOM 869 N ALA A 72 58.150 1.427 -3.734 1.00 20.27 N ATOM 870 CA ALA A 72 58.337 2.610 -2.910 1.00 19.50 C ATOM 871 C ALA A 72 57.584 3.816 -3.371 1.00 23.61 C ATOM 872 O ALA A 72 56.779 4.404 -2.618 1.00 20.81 O ATOM 873 CB ALA A 72 59.770 2.939 -2.819 1.00 19.21 C ATOM 874 N TYR A 73 57.865 4.156 -4.626 1.00 17.65 N ATOM 875 CA TYR A 73 57.282 5.317 -5.212 1.00 19.55 C ATOM 876 C TYR A 73 55.791 5.246 -5.007 1.00 25.52 C ATOM 877 O TYR A 73 55.185 6.070 -4.293 1.00 24.68 O ATOM 878 CB TYR A 73 57.706 5.345 -6.644 1.00 25.42 C ATOM 879 CG TYR A 73 57.129 6.452 -7.416 1.00 31.87 C ATOM 880 CD1 TYR A 73 55.942 6.302 -8.022 1.00 37.13 C ATOM 881 CD2 TYR A 73 57.780 7.654 -7.557 1.00 36.82 C ATOM 882 CE1 TYR A 73 55.399 7.318 -8.768 1.00 41.98 C ATOM 883 CE2 TYR A 73 57.222 8.718 -8.298 1.00 43.39 C ATOM 884 CZ TYR A 73 56.026 8.522 -8.905 1.00 48.84 C ATOM 885 OH TYR A 73 55.410 9.479 -9.674 1.00 46.79 O ATOM 886 N PHE A 74 55.213 4.209 -5.581 1.00 19.57 N ATOM 887 CA PHE A 74 53.798 4.017 -5.426 1.00 20.46 C ATOM 888 C PHE A 74 53.367 3.969 -3.999 1.00 22.55 C ATOM 889 O PHE A 74 52.450 4.654 -3.563 1.00 21.24 O ATOM 890 CB PHE A 74 53.420 2.701 -6.020 1.00 23.01 C ATOM 891 CG PHE A 74 53.525 2.716 -7.471 1.00 23.57 C ATOM 892 CD1 PHE A 74 53.339 3.873 -8.123 1.00 22.09 C ATOM 893 CD2 PHE A 74 53.825 1.595 -8.171 1.00 24.22 C ATOM 894 CE1 PHE A 74 53.437 3.893 -9.433 1.00 26.28 C ATOM 895 CE2 PHE A 74 53.929 1.627 -9.520 1.00 23.30 C ATOM 896 CZ PHE A 74 53.752 2.754 -10.151 1.00 20.39 C ATOM 897 N ALA A 75 54.022 3.113 -3.264 1.00 19.89 N ATOM 898 CA ALA A 75 53.643 2.997 -1.881 1.00 20.47 C ATOM 899 C ALA A 75 53.536 4.334 -1.139 1.00 31.63 C ATOM 900 O ALA A 75 52.577 4.570 -0.376 1.00 31.75 O ATOM 901 CB ALA A 75 54.576 2.059 -1.177 1.00 18.51 C ATOM 902 N GLU A 76 54.506 5.206 -1.396 1.00 27.98 N ATOM 903 CA GLU A 76 54.491 6.465 -0.729 1.00 29.87 C ATOM 904 C GLU A 76 53.276 7.283 -1.126 1.00 35.62 C ATOM 905 O GLU A 76 52.593 7.855 -0.261 1.00 31.12 O ATOM 906 CB GLU A 76 55.777 7.183 -0.981 1.00 32.41 C ATOM 907 CG GLU A 76 56.949 6.525 -0.338 1.00 52.21 C ATOM 908 CD GLU A 76 58.124 7.467 -0.217 1.00 64.02 C ATOM 909 OE1 GLU A 76 57.886 8.690 0.048 1.00 41.31 O ATOM 910 OE2 GLU A 76 59.264 6.966 -0.400 1.00 39.02 O ATOM 911 N ILE A 77 52.983 7.338 -2.420 1.00 31.45 N ATOM 912 CA ILE A 77 51.808 8.108 -2.815 1.00 30.37 C ATOM 913 C ILE A 77 50.535 7.590 -2.145 1.00 31.65 C ATOM 914 O ILE A 77 49.748 8.329 -1.561 1.00 33.19 O ATOM 915 CB ILE A 77 51.534 8.009 -4.288 1.00 31.97 C ATOM 916 CG1 ILE A 77 52.469 8.905 -5.018 1.00 27.57 C ATOM 917 CG2 ILE A 77 50.160 8.503 -4.563 1.00 40.79 C ATOM 918 CD1 ILE A 77 53.016 8.225 -6.146 1.00 31.00 C ATOM 919 N ILE A 78 50.316 6.301 -2.266 1.00 22.96 N ATOM 920 CA ILE A 78 49.141 5.747 -1.696 1.00 24.21 C ATOM 921 C ILE A 78 48.966 6.071 -0.228 1.00 26.26 C ATOM 922 O ILE A 78 47.897 6.562 0.186 1.00 24.11 O ATOM 923 CB ILE A 78 49.138 4.307 -1.919 1.00 29.61 C ATOM 924 CG1 ILE A 78 48.702 4.042 -3.356 1.00 29.83 C ATOM 925 CG2 ILE A 78 48.253 3.665 -0.948 1.00 29.50 C ATOM 926 CD1 ILE A 78 49.383 2.802 -3.926 1.00 22.07 C ATOM 927 N GLU A 79 50.018 5.821 0.546 1.00 18.17 N ATOM 928 CA GLU A 79 49.957 6.112 1.973 1.00 16.03 C ATOM 929 C GLU A 79 49.455 7.532 2.157 1.00 22.82 C ATOM 930 O GLU A 79 48.652 7.817 3.045 1.00 25.15 O ATOM 931 CB GLU A 79 51.317 5.992 2.654 1.00 15.58 C ATOM 932 CG GLU A 79 51.192 5.893 4.151 1.00 26.11 C ATOM 933 CD GLU A 79 52.457 5.465 4.888 1.00 50.00 C ATOM 934 OE1 GLU A 79 52.733 4.241 5.059 1.00 39.01 O ATOM 935 OE2 GLU A 79 53.144 6.390 5.366 1.00 41.92 O ATOM 936 N ALA A 80 49.907 8.419 1.282 1.00 19.16 N ATOM 937 CA ALA A 80 49.483 9.822 1.365 1.00 16.61 C ATOM 938 C ALA A 80 47.992 9.906 1.139 1.00 27.04 C ATOM 939 O ALA A 80 47.233 10.347 2.041 1.00 28.16 O ATOM 940 CB ALA A 80 50.229 10.732 0.345 1.00 12.56 C ATOM 941 N VAL A 81 47.600 9.477 -0.061 1.00 18.22 N ATOM 942 CA VAL A 81 46.220 9.493 -0.444 1.00 19.89 C ATOM 943 C VAL A 81 45.339 9.076 0.711 1.00 31.42 C ATOM 944 O VAL A 81 44.484 9.826 1.122 1.00 33.30 O ATOM 945 CB VAL A 81 45.970 8.557 -1.565 1.00 24.37 C ATOM 946 CG1 VAL A 81 44.476 8.366 -1.691 1.00 23.22 C ATOM 947 CG2 VAL A 81 46.539 9.164 -2.846 1.00 26.25 C ATOM 948 N GLU A 82 45.589 7.904 1.275 1.00 30.45 N ATOM 949 CA GLU A 82 44.772 7.443 2.385 1.00 31.46 C ATOM 950 C GLU A 82 44.598 8.439 3.490 1.00 36.19 C ATOM 951 O GLU A 82 43.471 8.638 3.953 1.00 38.02 O ATOM 952 CB GLU A 82 45.286 6.122 2.984 1.00 34.60 C ATOM 953 CG GLU A 82 46.050 6.265 4.339 1.00 65.57 C ATOM 954 CD GLU A 82 45.160 5.950 5.521 1.00 68.53 C ATOM 955 OE1 GLU A 82 44.038 5.475 5.259 1.00 18.31 O ATOM 956 OE2 GLU A 82 45.552 6.195 6.680 1.00 62.45 O ATOM 957 N LYS A 83 45.709 9.039 3.918 1.00 31.90 N ATOM 958 CA LYS A 83 45.681 9.998 5.022 1.00 32.39 C ATOM 959 C LYS A 83 44.616 11.034 4.743 1.00 33.59 C ATOM 960 O LYS A 83 43.792 11.369 5.579 1.00 30.93 O ATOM 961 CB LYS A 83 47.037 10.699 5.162 1.00 37.62 C ATOM 962 CG LYS A 83 48.140 9.909 5.892 1.00 76.26 C ATOM 963 CD LYS A 83 49.110 10.844 6.692 1.00 92.32 C ATOM 964 CE LYS A 83 50.619 10.533 6.439 1.00100.00 C ATOM 965 NZ LYS A 83 51.556 10.669 7.621 1.00100.00 N ATOM 966 N ASN A 84 44.644 11.521 3.522 1.00 28.96 N ATOM 967 CA ASN A 84 43.710 12.514 3.116 1.00 30.43 C ATOM 968 C ASN A 84 42.296 12.042 3.169 1.00 37.71 C ATOM 969 O ASN A 84 41.462 12.713 3.730 1.00 42.92 O ATOM 970 CB ASN A 84 44.121 13.078 1.774 1.00 42.31 C ATOM 971 CG ASN A 84 45.252 14.075 1.905 1.00 78.41 C ATOM 972 OD1 ASN A 84 45.030 15.262 2.181 1.00 79.18 O ATOM 973 ND2 ASN A 84 46.476 13.591 1.767 1.00 82.11 N ATOM 974 N CYS A 85 42.022 10.884 2.601 1.00 34.41 N ATOM 975 CA CYS A 85 40.678 10.355 2.657 1.00 35.19 C ATOM 976 C CYS A 85 40.207 10.272 4.118 1.00 37.42 C ATOM 977 O CYS A 85 39.130 10.739 4.469 1.00 30.19 O ATOM 978 CB CYS A 85 40.683 8.928 2.139 1.00 35.52 C ATOM 979 SG CYS A 85 40.901 8.818 0.344 1.00 40.66 S ATOM 980 N PHE A 86 41.020 9.654 4.963 1.00 36.02 N ATOM 981 CA PHE A 86 40.646 9.499 6.365 1.00 37.34 C ATOM 982 C PHE A 86 40.168 10.730 7.036 1.00 41.23 C ATOM 983 O PHE A 86 39.147 10.768 7.715 1.00 38.57 O ATOM 984 CB PHE A 86 41.853 9.115 7.190 1.00 37.93 C ATOM 985 CG PHE A 86 41.518 8.834 8.623 1.00 39.74 C ATOM 986 CD1 PHE A 86 40.526 7.907 8.942 1.00 48.02 C ATOM 987 CD2 PHE A 86 42.169 9.480 9.645 1.00 44.13 C ATOM 988 CE1 PHE A 86 40.202 7.604 10.264 1.00 49.40 C ATOM 989 CE2 PHE A 86 41.858 9.200 10.984 1.00 50.39 C ATOM 990 CZ PHE A 86 40.876 8.255 11.292 1.00 49.96 C ATOM 991 N GLN A 87 41.009 11.717 6.849 1.00 41.44 N ATOM 992 CA GLN A 87 40.863 13.023 7.407 1.00 45.93 C ATOM 993 C GLN A 87 39.605 13.747 7.021 1.00 51.33 C ATOM 994 O GLN A 87 39.166 14.614 7.754 1.00 60.54 O ATOM 995 CB GLN A 87 42.099 13.826 7.016 1.00 50.50 C ATOM 996 CG GLN A 87 42.381 15.044 7.847 1.00 95.85 C ATOM 997 CD GLN A 87 42.776 16.225 6.969 1.00100.00 C ATOM 998 OE1 GLN A 87 43.832 16.201 6.293 1.00100.00 O ATOM 999 NE2 GLN A 87 41.904 17.259 6.937 1.00100.00 N ATOM 1000 N LYS A 88 39.036 13.398 5.876 1.00 40.54 N ATOM 1001 CA LYS A 88 37.813 14.026 5.381 1.00 37.44 C ATOM 1002 C LYS A 88 36.734 12.968 5.300 1.00 38.35 C ATOM 1003 O LYS A 88 35.875 12.982 4.398 1.00 43.24 O ATOM 1004 CB LYS A 88 38.051 14.605 3.974 1.00 38.19 C ATOM 1005 CG LYS A 88 39.307 15.410 3.870 1.00 51.35 C ATOM 1006 CD LYS A 88 38.995 16.877 3.623 1.00 74.76 C ATOM 1007 CE LYS A 88 40.261 17.735 3.652 1.00100.00 C ATOM 1008 NZ LYS A 88 39.981 19.050 4.323 1.00100.00 N