>>1R49:HELIX    7   7 SER A  433  ARG A  462  1                                  30    
SRIKGEKDWQKYETARRLKKCVDKIRNQYR
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 7 7 SER A 433 ARG A 462 1 30 ATOM 2817 N SER A 433 -14.199 -5.585 1.240 1.00 55.93 N ATOM 2818 CA SER A 433 -15.130 -6.192 2.191 1.00 51.02 C ATOM 2819 C SER A 433 -15.650 -5.193 3.215 1.00 50.91 C ATOM 2820 O SER A 433 -15.073 -4.122 3.398 1.00 61.96 O ATOM 2821 CB SER A 433 -14.468 -7.369 2.908 1.00 50.09 C ATOM 2822 OG SER A 433 -13.853 -6.948 4.114 1.00 47.97 O ATOM 2823 N ARG A 434 -16.738 -5.555 3.888 1.00 46.95 N ATOM 2824 CA ARG A 434 -17.359 -4.669 4.868 1.00 50.99 C ATOM 2825 C ARG A 434 -16.571 -4.629 6.178 1.00 54.02 C ATOM 2826 O ARG A 434 -16.405 -3.570 6.781 1.00 56.30 O ATOM 2827 CB ARG A 434 -18.818 -5.075 5.116 1.00 49.94 C ATOM 2828 CG ARG A 434 -19.321 -4.781 6.519 1.00 51.82 C ATOM 2829 CD ARG A 434 -19.548 -6.021 7.373 1.00 46.64 C ATOM 2830 NE ARG A 434 -18.948 -5.886 8.696 1.00 65.37 N ATOM 2831 CZ ARG A 434 -18.721 -6.897 9.526 1.00 79.82 C ATOM 2832 NH1 ARG A 434 -19.044 -8.137 9.178 1.00 56.30 N ATOM 2833 NH2 ARG A 434 -18.170 -6.669 10.712 1.00 78.07 N ATOM 2834 N ILE A 435 -16.080 -5.785 6.612 1.00 56.66 N ATOM 2835 CA ILE A 435 -15.266 -5.858 7.821 1.00 53.82 C ATOM 2836 C ILE A 435 -14.023 -4.970 7.697 1.00 52.04 C ATOM 2837 O ILE A 435 -13.337 -4.703 8.683 1.00 56.43 O ATOM 2838 CB ILE A 435 -14.886 -7.333 8.138 1.00 54.62 C ATOM 2839 CG1 ILE A 435 -14.617 -7.519 9.636 1.00 23.98 C ATOM 2840 CG2 ILE A 435 -13.685 -7.779 7.313 1.00 52.15 C ATOM 2841 N LYS A 436 -13.749 -4.512 6.477 1.00 47.68 N ATOM 2842 CA LYS A 436 -12.646 -3.593 6.220 1.00 45.35 C ATOM 2843 C LYS A 436 -13.165 -2.197 5.884 1.00 48.79 C ATOM 2844 O LYS A 436 -12.637 -1.196 6.366 1.00 54.34 O ATOM 2845 CB LYS A 436 -11.765 -4.112 5.084 1.00 41.64 C ATOM 2846 CG LYS A 436 -11.066 -5.426 5.388 1.00 44.87 C ATOM 2847 CD LYS A 436 -9.755 -5.207 6.130 1.00 45.80 C ATOM 2848 CE LYS A 436 -9.030 -6.524 6.369 1.00 42.74 C ATOM 2849 NZ LYS A 436 -7.546 -6.389 6.255 1.00 49.60 N ATOM 2850 N GLY A 437 -14.203 -2.134 5.056 1.00 44.55 N ATOM 2851 CA GLY A 437 -14.808 -0.866 4.693 1.00 43.16 C ATOM 2852 C GLY A 437 -15.419 -0.163 5.892 1.00 43.13 C ATOM 2853 O GLY A 437 -15.245 1.045 6.081 1.00 39.65 O ATOM 2854 N GLU A 438 -16.135 -0.930 6.708 1.00 48.47 N ATOM 2855 CA GLU A 438 -16.782 -0.398 7.901 1.00 47.58 C ATOM 2856 C GLU A 438 -15.793 0.392 8.750 1.00 46.37 C ATOM 2857 O GLU A 438 -16.136 1.429 9.318 1.00 42.53 O ATOM 2858 CB GLU A 438 -17.394 -1.536 8.722 1.00 42.22 C ATOM 2859 CG GLU A 438 -18.043 -1.095 10.023 1.00 75.18 C ATOM 2860 CD GLU A 438 -19.552 -1.249 10.007 1.00 90.91 C ATOM 2861 OE1 GLU A 438 -20.180 -1.097 11.077 1.00111.56 O ATOM 2862 OE2 GLU A 438 -20.111 -1.522 8.925 1.00 81.12 O ATOM 2863 N LYS A 439 -14.561 -0.100 8.828 1.00 47.65 N ATOM 2864 CA LYS A 439 -13.540 0.556 9.631 1.00 49.68 C ATOM 2865 C LYS A 439 -12.864 1.695 8.875 1.00 51.78 C ATOM 2866 O LYS A 439 -12.392 2.657 9.481 1.00 47.55 O ATOM 2867 CB LYS A 439 -12.511 -0.459 10.135 1.00 44.37 C ATOM 2868 CG LYS A 439 -12.717 -0.849 11.599 1.00 69.65 C ATOM 2869 CD LYS A 439 -11.493 -1.546 12.182 1.00 93.49 C ATOM 2870 CE LYS A 439 -10.498 -0.548 12.767 1.00 74.09 C ATOM 2871 NZ LYS A 439 -9.087 -1.022 12.619 1.00 20.33 N ATOM 2872 N ASP A 440 -12.828 1.590 7.551 1.00 56.08 N ATOM 2873 CA ASP A 440 -12.242 2.637 6.725 1.00 58.89 C ATOM 2874 C ASP A 440 -13.159 3.855 6.672 1.00 64.50 C ATOM 2875 O ASP A 440 -12.698 4.996 6.730 1.00 63.18 O ATOM 2876 CB ASP A 440 -11.971 2.117 5.317 1.00 59.08 C ATOM 2877 CG ASP A 440 -10.696 2.678 4.729 1.00 75.74 C ATOM 2878 OD1 ASP A 440 -9.767 2.989 5.508 1.00 65.34 O ATOM 2879 OD2 ASP A 440 -10.535 2.840 3.499 1.00 80.10 O ATOM 2880 N TRP A 441 -14.461 3.602 6.562 1.00 68.12 N ATOM 2881 CA TRP A 441 -15.459 4.665 6.574 1.00 63.25 C ATOM 2882 C TRP A 441 -15.473 5.333 7.941 1.00 58.38 C ATOM 2883 O TRP A 441 -15.736 6.526 8.058 1.00 59.94 O ATOM 2884 CB TRP A 441 -16.841 4.101 6.234 1.00 64.87 C ATOM 2885 CG TRP A 441 -17.989 4.961 6.677 1.00 73.57 C ATOM 2886 CD1 TRP A 441 -18.628 5.918 5.943 1.00 73.11 C ATOM 2887 CD2 TRP A 441 -18.643 4.934 7.951 1.00 85.28 C ATOM 2888 NE1 TRP A 441 -19.634 6.493 6.682 1.00 68.08 N ATOM 2889 CE2 TRP A 441 -19.665 5.907 7.921 1.00 92.97 C ATOM 2890 CE3 TRP A 441 -18.467 4.187 9.124 1.00 76.37 C ATOM 2891 CZ2 TRP A 441 -20.501 6.151 9.011 1.00101.57 C ATOM 2892 CZ3 TRP A 441 -19.299 4.431 10.205 1.00 77.15 C ATOM 2893 CH2 TRP A 441 -20.302 5.405 10.141 1.00 96.15 C ATOM 2894 N GLN A 442 -15.172 4.550 8.971 1.00 52.38 N ATOM 2895 CA GLN A 442 -15.148 5.042 10.343 1.00 46.96 C ATOM 2896 C GLN A 442 -13.869 5.818 10.631 1.00 36.89 C ATOM 2897 O GLN A 442 -13.870 6.766 11.414 1.00 33.21 O ATOM 2898 CB GLN A 442 -15.286 3.869 11.313 1.00 53.15 C ATOM 2899 CG GLN A 442 -15.106 4.221 12.783 1.00 63.14 C ATOM 2900 CD GLN A 442 -15.343 3.018 13.682 1.00 85.44 C ATOM 2901 OE1 GLN A 442 -15.711 1.942 13.203 1.00 87.40 O ATOM 2902 NE2 GLN A 442 -15.134 3.194 14.983 1.00 90.54 N ATOM 2903 N LYS A 443 -12.780 5.408 9.989 1.00 33.57 N ATOM 2904 CA LYS A 443 -11.483 6.045 10.188 1.00 36.60 C ATOM 2905 C LYS A 443 -11.538 7.529 9.858 1.00 38.66 C ATOM 2906 O LYS A 443 -11.199 8.371 10.690 1.00 44.34 O ATOM 2907 CB LYS A 443 -10.416 5.364 9.330 1.00 34.04 C ATOM 2908 CG LYS A 443 -9.056 6.035 9.371 1.00 23.43 C ATOM 2909 CD LYS A 443 -8.014 5.200 8.628 1.00 43.53 C ATOM 2910 CE LYS A 443 -7.812 5.690 7.199 1.00 21.21 C ATOM 2911 NZ LYS A 443 -7.831 4.558 6.219 1.00 42.93 N ATOM 2912 N TYR A 444 -11.974 7.838 8.640 1.00 40.21 N ATOM 2913 CA TYR A 444 -12.042 9.216 8.170 1.00 36.72 C ATOM 2914 C TYR A 444 -13.078 10.025 8.943 1.00 36.75 C ATOM 2915 O TYR A 444 -12.924 11.232 9.131 1.00 38.54 O ATOM 2916 CB TYR A 444 -12.340 9.248 6.672 1.00 30.27 C ATOM 2917 CG TYR A 444 -11.270 8.581 5.837 1.00 51.03 C ATOM 2918 CD1 TYR A 444 -11.524 7.390 5.171 1.00 62.07 C ATOM 2919 CD2 TYR A 444 -10.003 9.137 5.724 1.00 57.61 C ATOM 2920 CE1 TYR A 444 -10.547 6.776 4.411 1.00 53.79 C ATOM 2921 CE2 TYR A 444 -9.021 8.529 4.966 1.00 52.50 C ATOM 2922 CZ TYR A 444 -9.298 7.351 4.313 1.00 49.37 C ATOM 2923 OH TYR A 444 -8.325 6.741 3.561 1.00 44.84 O ATOM 2924 N GLU A 445 -14.128 9.350 9.397 1.00 36.24 N ATOM 2925 CA GLU A 445 -15.158 9.997 10.190 1.00 38.46 C ATOM 2926 C GLU A 445 -14.582 10.446 11.526 1.00 45.29 C ATOM 2927 O GLU A 445 -14.966 11.486 12.061 1.00 55.34 O ATOM 2928 CB GLU A 445 -16.338 9.050 10.408 1.00 40.29 C ATOM 2929 CG GLU A 445 -17.286 8.956 9.223 1.00 42.23 C ATOM 2930 CD GLU A 445 -17.970 10.274 8.909 1.00 77.85 C ATOM 2931 OE1 GLU A 445 -19.062 10.526 9.466 1.00 77.94 O ATOM 2932 OE2 GLU A 445 -17.421 11.055 8.102 1.00 79.41 O ATOM 2933 N THR A 446 -13.654 9.658 12.061 1.00 46.80 N ATOM 2934 CA THR A 446 -12.973 10.017 13.299 1.00 45.92 C ATOM 2935 C THR A 446 -12.052 11.213 13.074 1.00 43.90 C ATOM 2936 O THR A 446 -11.896 12.065 13.950 1.00 44.16 O ATOM 2937 CB THR A 446 -12.180 8.817 13.850 1.00 42.24 C ATOM 2938 OG1 THR A 446 -13.084 7.748 14.160 1.00 32.71 O ATOM 2939 CG2 THR A 446 -11.577 9.151 15.203 1.00 39.84 C ATOM 2940 N ALA A 447 -11.453 11.277 11.889 1.00 39.54 N ATOM 2941 CA ALA A 447 -10.594 12.398 11.532 1.00 39.87 C ATOM 2942 C ALA A 447 -11.427 13.640 11.251 1.00 46.67 C ATOM 2943 O ALA A 447 -10.920 14.762 11.294 1.00 50.65 O ATOM 2944 CB ALA A 447 -9.743 12.053 10.335 1.00 40.36 C ATOM 2945 N ARG A 448 -12.708 13.431 10.959 1.00 46.64 N ATOM 2946 CA ARG A 448 -13.640 14.532 10.746 1.00 40.91 C ATOM 2947 C ARG A 448 -14.186 15.008 12.079 1.00 39.21 C ATOM 2948 O ARG A 448 -14.493 16.186 12.254 1.00 39.30 O ATOM 2949 CB ARG A 448 -14.785 14.102 9.831 1.00 37.57 C ATOM 2950 CG ARG A 448 -14.444 14.193 8.360 1.00 32.81 C ATOM 2951 CD ARG A 448 -15.347 13.384 7.463 1.00 48.89 C ATOM 2952 NE ARG A 448 -16.195 14.246 6.648 1.00 56.08 N ATOM 2953 CZ ARG A 448 -17.431 14.592 6.975 1.00 55.97 C ATOM 2954 NH1 ARG A 448 -17.967 14.145 8.104 1.00 58.25 N ATOM 2955 NH2 ARG A 448 -18.135 15.384 6.177 1.00 64.44 N ATOM 2956 N ARG A 449 -14.309 14.076 13.017 1.00 47.72 N ATOM 2957 CA ARG A 449 -14.718 14.410 14.370 1.00 60.01 C ATOM 2958 C ARG A 449 -13.677 15.340 14.973 1.00 60.49 C ATOM 2959 O ARG A 449 -14.007 16.316 15.649 1.00 65.80 O ATOM 2960 CB ARG A 449 -14.847 13.142 15.216 1.00 62.43 C ATOM 2961 CG ARG A 449 -16.008 13.157 16.196 1.00 77.43 C ATOM 2962 CD ARG A 449 -16.858 11.897 16.164 1.00 79.82 C ATOM 2963 NE ARG A 449 -16.096 10.739 15.709 1.00 87.35 N ATOM 2964 CZ ARG A 449 -15.580 9.820 16.514 1.00 91.21 C ATOM 2965 NH1 ARG A 449 -15.744 9.914 17.827 1.00 83.97 N ATOM 2966 NH2 ARG A 449 -14.900 8.801 16.006 1.00 98.30 N ATOM 2967 N LEU A 450 -12.412 15.027 14.708 1.00 56.81 N ATOM 2968 CA LEU A 450 -11.302 15.827 15.200 1.00 56.12 C ATOM 2969 C LEU A 450 -11.345 17.228 14.609 1.00 58.65 C ATOM 2970 O LEU A 450 -11.098 18.211 15.307 1.00 63.03 O ATOM 2971 CB LEU A 450 -9.972 15.150 14.865 1.00 55.42 C ATOM 2972 CG LEU A 450 -8.696 15.980 15.015 1.00 32.33 C ATOM 2973 CD1 LEU A 450 -8.445 16.324 16.474 1.00 67.37 C ATOM 2974 CD2 LEU A 450 -7.514 15.226 14.431 1.00 53.90 C ATOM 2975 N LYS A 451 -11.672 17.314 13.323 1.00 61.38 N ATOM 2976 CA LYS A 451 -11.721 18.595 12.628 1.00 64.40 C ATOM 2977 C LYS A 451 -12.468 19.643 13.447 1.00 61.92 C ATOM 2978 O LYS A 451 -12.127 20.826 13.415 1.00 64.87 O ATOM 2979 CB LYS A 451 -12.350 18.433 11.237 1.00 65.43 C ATOM 2980 CG LYS A 451 -13.438 19.448 10.896 1.00 81.42 C ATOM 2981 CD LYS A 451 -12.877 20.629 10.106 1.00 86.89 C ATOM 2982 CE LYS A 451 -13.734 20.937 8.886 1.00 71.63 C ATOM 2983 NZ LYS A 451 -13.315 20.128 7.703 1.00 38.18 N ATOM 2984 N LYS A 452 -13.477 19.201 14.189 1.00 59.38 N ATOM 2985 CA LYS A 452 -14.260 20.110 15.014 1.00 63.78 C ATOM 2986 C LYS A 452 -13.461 20.625 16.211 1.00 61.92 C ATOM 2987 O LYS A 452 -13.135 21.813 16.291 1.00 61.11 O ATOM 2988 CB LYS A 452 -15.547 19.431 15.484 1.00 65.26 C ATOM 2989 CG LYS A 452 -16.811 20.043 14.903 1.00 85.86 C ATOM 2990 CD LYS A 452 -17.793 18.972 14.457 1.00 94.48 C ATOM 2991 CE LYS A 452 -17.595 18.617 12.993 1.00 80.50 C ATOM 2992 NZ LYS A 452 -18.128 17.261 12.690 1.00 79.25 N ATOM 2993 N CYS A 453 -13.135 19.722 17.130 1.00 62.15 N ATOM 2994 CA CYS A 453 -12.480 20.098 18.378 1.00 68.01 C ATOM 2995 C CYS A 453 -10.961 20.230 18.252 1.00 70.40 C ATOM 2996 O CYS A 453 -10.248 20.244 19.259 1.00 70.04 O ATOM 2997 CB CYS A 453 -12.834 19.096 19.478 1.00 72.26 C ATOM 2998 SG CYS A 453 -12.831 17.373 18.933 1.00 74.89 S ATOM 2999 N VAL A 454 -10.467 20.332 17.020 1.00 69.41 N ATOM 3000 CA VAL A 454 -9.034 20.501 16.792 1.00 62.91 C ATOM 3001 C VAL A 454 -8.549 21.795 17.424 1.00 52.84 C ATOM 3002 O VAL A 454 -7.491 21.831 18.047 1.00 51.65 O ATOM 3003 CB VAL A 454 -8.670 20.486 15.283 1.00 67.90 C ATOM 3004 CG1 VAL A 454 -9.226 21.715 14.568 1.00 69.65 C ATOM 3005 CG2 VAL A 454 -7.160 20.388 15.094 1.00 68.41 C ATOM 3006 N ASP A 455 -9.339 22.852 17.267 1.00 51.81 N ATOM 3007 CA ASP A 455 -9.007 24.149 17.831 1.00 53.41 C ATOM 3008 C ASP A 455 -8.923 24.052 19.351 1.00 51.72 C ATOM 3009 O ASP A 455 -8.045 24.651 19.976 1.00 43.73 O ATOM 3010 CB ASP A 455 -10.045 25.194 17.409 1.00 54.06 C ATOM 3011 CG ASP A 455 -9.660 25.911 16.125 1.00 80.61 C ATOM 3012 OD1 ASP A 455 -9.860 25.333 15.033 1.00 92.96 O ATOM 3013 OD2 ASP A 455 -9.150 27.053 16.109 1.00103.55 O ATOM 3014 N LYS A 456 -9.836 23.287 19.939 1.00 53.79 N ATOM 3015 CA LYS A 456 -9.836 23.077 21.379 1.00 58.78 C ATOM 3016 C LYS A 456 -8.572 22.337 21.793 1.00 55.33 C ATOM 3017 O LYS A 456 -7.884 22.745 22.728 1.00 59.57 O ATOM 3018 CB LYS A 456 -11.079 22.293 21.814 1.00 62.88 C ATOM 3019 CG LYS A 456 -10.990 21.699 23.218 1.00 74.38 C ATOM 3020 CD LYS A 456 -11.740 20.373 23.307 1.00 99.13 C ATOM 3021 CE LYS A 456 -11.355 19.589 24.558 1.00104.49 C ATOM 3022 NZ LYS A 456 -11.985 18.236 24.595 1.00 83.03 N ATOM 3023 N ILE A 457 -8.266 21.257 21.081 1.00 48.20 N ATOM 3024 CA ILE A 457 -7.101 20.436 21.393 1.00 44.20 C ATOM 3025 C ILE A 457 -5.802 21.205 21.153 1.00 48.18 C ATOM 3026 O ILE A 457 -4.844 21.068 21.910 1.00 51.45 O ATOM 3027 CB ILE A 457 -7.126 19.126 20.575 1.00 46.64 C ATOM 3028 CG1 ILE A 457 -8.264 18.214 21.044 1.00 33.44 C ATOM 3029 CG2 ILE A 457 -5.799 18.405 20.679 1.00 26.30 C ATOM 3030 N ARG A 458 -5.777 22.020 20.101 1.00 53.97 N ATOM 3031 CA ARG A 458 -4.613 22.851 19.808 1.00 55.76 C ATOM 3032 C ARG A 458 -4.383 23.844 20.941 1.00 60.50 C ATOM 3033 O ARG A 458 -3.308 23.876 21.539 1.00 59.11 O ATOM 3034 CB ARG A 458 -4.790 23.591 18.481 1.00 58.64 C ATOM 3035 CG ARG A 458 -4.039 22.966 17.315 1.00 60.85 C ATOM 3036 CD ARG A 458 -4.164 23.739 16.009 1.00 78.28 C ATOM 3037 NE ARG A 458 -4.059 22.868 14.839 1.00 80.15 N ATOM 3038 CZ ARG A 458 -4.839 22.955 13.770 1.00 79.01 C ATOM 3039 NH1 ARG A 458 -5.792 23.878 13.712 1.00 81.43 N ATOM 3040 NH2 ARG A 458 -4.669 22.120 12.755 1.00 82.10 N ATOM 3041 N ASN A 459 -5.406 24.644 21.239 1.00 69.14 N ATOM 3042 CA ASN A 459 -5.340 25.597 22.343 1.00 72.45 C ATOM 3043 C ASN A 459 -5.254 24.897 23.694 1.00 66.85 C ATOM 3044 O ASN A 459 -5.142 25.545 24.729 1.00 64.36 O ATOM 3045 CB ASN A 459 -6.548 26.539 22.321 1.00 77.26 C ATOM 3046 CG ASN A 459 -6.699 27.269 20.999 1.00 87.64 C ATOM 3047 OD1 ASN A 459 -5.712 27.590 20.334 1.00100.39 O ATOM 3048 ND2 ASN A 459 -7.941 27.535 20.610 1.00 86.12 N ATOM 3049 N GLN A 460 -5.316 23.571 23.677 1.00 70.16 N ATOM 3050 CA GLN A 460 -5.215 22.788 24.901 1.00 74.79 C ATOM 3051 C GLN A 460 -3.769 22.409 25.173 1.00 73.10 C ATOM 3052 O GLN A 460 -3.221 22.747 26.221 1.00 74.81 O ATOM 3053 CB GLN A 460 -6.079 21.529 24.814 1.00 79.58 C ATOM 3054 CG GLN A 460 -6.936 21.279 26.043 1.00 85.79 C ATOM 3055 CD GLN A 460 -6.382 20.174 26.920 1.00 89.14 C ATOM 3056 OE1 GLN A 460 -6.908 19.061 26.931 1.00 69.78 O ATOM 3057 NE2 GLN A 460 -5.319 20.477 27.659 1.00 94.14 N ATOM 3058 N TYR A 461 -3.149 21.710 24.226 1.00 70.70 N ATOM 3059 CA TYR A 461 -1.763 21.290 24.396 1.00 73.77 C ATOM 3060 C TYR A 461 -0.816 22.485 24.399 1.00 77.04 C ATOM 3061 O TYR A 461 0.372 22.346 24.688 1.00 79.66 O ATOM 3062 CB TYR A 461 -1.352 20.243 23.345 1.00 73.50 C ATOM 3063 CG TYR A 461 -1.199 20.754 21.920 1.00 67.45 C ATOM 3064 CD1 TYR A 461 -1.847 20.121 20.864 1.00 50.82 C ATOM 3065 CD2 TYR A 461 -0.389 21.848 21.628 1.00 68.79 C ATOM 3066 CE1 TYR A 461 -1.706 20.575 19.563 1.00 76.85 C ATOM 3067 CE2 TYR A 461 -0.245 22.310 20.331 1.00 63.01 C ATOM 3068 CZ TYR A 461 -0.904 21.670 19.303 1.00 67.73 C ATOM 3069 OH TYR A 461 -0.759 22.128 18.013 1.00 61.13 O ATOM 3070 N ARG A 462 -1.350 23.662 24.084 1.00 79.59 N ATOM 3071 CA ARG A 462 -0.548 24.879 24.078 1.00 86.93 C ATOM 3072 C ARG A 462 -0.401 25.419 25.493 1.00 87.87 C ATOM 3073 O ARG A 462 0.519 26.182 25.784 1.00 88.52 O ATOM 3074 CB ARG A 462 -1.168 25.935 23.163 1.00 91.10 C ATOM 3075 CG ARG A 462 -0.665 25.882 21.727 1.00 92.28 C ATOM 3076 CD ARG A 462 -1.328 26.889 20.803 1.00108.20 C ATOM 3077 NE ARG A 462 -0.549 28.120 20.703 1.00129.98 N ATOM 3078 CZ ARG A 462 -0.593 29.107 21.593 1.00135.89 C ATOM 3079 NH1 ARG A 462 -1.383 29.020 22.658 1.00130.34 N ATOM 3080 NH2 ARG A 462 0.154 30.189 21.416 1.00141.03 N