>>1RB4:HELIX    1   1 ARG A    1  VAL A   30  1                                  30    
RMKQLEDKVEELLSKAYHLENEVARLKKLV
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 1 1 ARG A 1 VAL A 30 1 30 ATOM 1 N ARG A 1 -16.331 35.431 11.492 1.00 34.33 N ATOM 2 CA ARG A 1 -14.875 35.589 11.673 1.00 33.04 C ATOM 3 C ARG A 1 -14.421 35.250 13.087 1.00 30.47 C ATOM 4 O ARG A 1 -13.401 34.549 13.181 1.00 30.67 O ATOM 5 CB ARG A 1 -14.317 36.989 11.409 1.00 33.62 C ATOM 6 CG ARG A 1 -13.879 37.226 9.985 1.00 35.51 C ATOM 7 CD ARG A 1 -13.635 38.694 9.798 1.00 35.28 C ATOM 8 NE ARG A 1 -12.247 39.100 9.845 1.00 34.43 N ATOM 9 CZ ARG A 1 -11.888 40.373 9.774 1.00 34.58 C ATOM 10 NH1 ARG A 1 -12.866 41.284 9.723 1.00 35.25 N ATOM 11 NH2 ARG A 1 -10.600 40.658 9.780 1.00 33.82 N ATOM 12 N MET A 2 -15.129 35.748 14.102 1.00 29.12 N ATOM 13 CA MET A 2 -14.638 35.448 15.448 1.00 28.55 C ATOM 14 C MET A 2 -14.577 33.966 15.732 1.00 26.64 C ATOM 15 O MET A 2 -13.594 33.497 16.304 1.00 24.21 O ATOM 16 CB MET A 2 -15.418 36.152 16.569 1.00 27.93 C ATOM 17 CG MET A 2 -14.874 35.836 17.962 1.00 28.02 C ATOM 18 SD MET A 2 -13.120 36.300 18.297 1.00 28.18 S ATOM 19 CE MET A 2 -13.178 37.795 17.269 1.00 17.90 C ATOM 20 N LYS A 3 -15.670 33.230 15.453 1.00 27.66 N ATOM 21 CA LYS A 3 -15.705 31.812 15.764 1.00 28.20 C ATOM 22 C LYS A 3 -14.640 31.042 14.977 1.00 25.36 C ATOM 23 O LYS A 3 -13.990 30.169 15.577 1.00 23.31 O ATOM 24 CB LYS A 3 -17.086 31.175 15.563 1.00 29.90 C ATOM 25 CG LYS A 3 -17.095 29.713 16.006 1.00 32.55 C ATOM 26 CD LYS A 3 -16.816 29.596 17.503 1.00 33.68 C ATOM 27 CE LYS A 3 -16.899 28.205 18.061 1.00 36.59 C ATOM 28 NZ LYS A 3 -16.726 27.127 17.048 1.00 38.44 N ATOM 29 N GLN A 4 -14.397 31.389 13.721 1.00 26.25 N ATOM 30 CA GLN A 4 -13.304 30.728 12.986 1.00 26.07 C ATOM 31 C GLN A 4 -11.937 31.039 13.581 1.00 23.23 C ATOM 32 O GLN A 4 -11.010 30.198 13.581 1.00 24.29 O ATOM 33 CB GLN A 4 -13.356 31.157 11.499 1.00 28.63 C ATOM 34 CG GLN A 4 -14.600 30.584 10.860 1.00 33.54 C ATOM 35 CD GLN A 4 -15.042 31.070 9.512 1.00 37.53 C ATOM 36 OE1 GLN A 4 -15.958 30.486 8.891 1.00 41.29 O ATOM 37 NE2 GLN A 4 -14.428 32.119 8.995 1.00 39.71 N ATOM 38 N LEU A 5 -11.745 32.235 14.097 1.00 20.30 N ATOM 39 CA LEU A 5 -10.491 32.648 14.716 1.00 20.26 C ATOM 40 C LEU A 5 -10.299 31.838 16.005 1.00 20.40 C ATOM 41 O LEU A 5 -9.189 31.327 16.201 1.00 20.76 O ATOM 42 CB LEU A 5 -10.440 34.135 15.003 1.00 20.66 C ATOM 43 CG LEU A 5 -9.198 34.678 15.698 1.00 20.82 C ATOM 44 CD1 LEU A 5 -7.841 34.317 15.068 1.00 19.88 C ATOM 45 CD2 LEU A 5 -9.278 36.193 15.835 1.00 18.90 C ATOM 46 N GLU A 6 -11.351 31.837 16.836 1.00 20.33 N ATOM 47 CA GLU A 6 -11.270 31.033 18.059 1.00 21.95 C ATOM 48 C GLU A 6 -10.968 29.572 17.788 1.00 21.10 C ATOM 49 O GLU A 6 -10.118 28.931 18.428 1.00 20.53 O ATOM 50 CB GLU A 6 -12.564 31.121 18.892 1.00 22.73 C ATOM 51 CG GLU A 6 -12.803 32.586 19.314 1.00 26.63 C ATOM 52 CD GLU A 6 -14.188 32.595 19.993 1.00 31.79 C ATOM 53 OE1 GLU A 6 -15.169 32.421 19.262 1.00 30.73 O ATOM 54 OE2 GLU A 6 -14.265 32.717 21.238 1.00 35.55 O ATOM 55 N ASP A 7 -11.607 29.005 16.757 1.00 20.73 N ATOM 56 CA ASP A 7 -11.370 27.610 16.403 1.00 22.06 C ATOM 57 C ASP A 7 -9.898 27.383 16.047 1.00 19.62 C ATOM 58 O ASP A 7 -9.276 26.421 16.515 1.00 21.19 O ATOM 59 CB ASP A 7 -12.233 27.171 15.201 1.00 23.63 C ATOM 60 CG ASP A 7 -13.651 26.869 15.656 1.00 26.62 C ATOM 61 OD1 ASP A 7 -13.945 26.906 16.867 1.00 29.92 O ATOM 62 OD2 ASP A 7 -14.515 26.622 14.801 1.00 29.29 O ATOM 63 N LYS A 8 -9.332 28.320 15.292 1.00 18.84 N ATOM 64 CA LYS A 8 -7.927 28.186 14.924 1.00 18.98 C ATOM 65 C LYS A 8 -7.000 28.319 16.131 1.00 16.82 C ATOM 66 O LYS A 8 -5.949 27.687 16.176 1.00 17.27 O ATOM 67 CB LYS A 8 -7.512 29.180 13.826 1.00 20.01 C ATOM 68 CG LYS A 8 -8.258 28.745 12.527 1.00 19.33 C ATOM 69 CD LYS A 8 -7.752 29.686 11.426 1.00 21.81 C ATOM 70 CE LYS A 8 -8.523 29.476 10.121 1.00 24.64 C ATOM 71 NZ LYS A 8 -9.960 29.831 10.314 1.00 25.63 N ATOM 72 N VAL A 9 -7.292 29.273 17.007 1.00 16.57 N ATOM 73 CA VAL A 9 -6.450 29.392 18.220 1.00 19.21 C ATOM 74 C VAL A 9 -6.516 28.142 19.055 1.00 18.83 C ATOM 75 O VAL A 9 -5.478 27.695 19.590 1.00 17.12 O ATOM 76 CB VAL A 9 -6.898 30.617 19.056 1.00 20.56 C ATOM 77 CG1 VAL A 9 -6.040 30.667 20.343 1.00 23.68 C ATOM 78 CG2 VAL A 9 -6.696 31.852 18.227 1.00 21.18 C ATOM 79 N GLU A 10 -7.677 27.500 19.183 1.00 17.31 N ATOM 80 CA GLU A 10 -7.713 26.258 19.977 1.00 18.17 C ATOM 81 C GLU A 10 -6.904 25.153 19.305 1.00 17.27 C ATOM 82 O GLU A 10 -6.276 24.320 19.939 1.00 18.61 O ATOM 83 CB GLU A 10 -9.141 25.851 20.302 1.00 19.37 C ATOM 84 CG GLU A 10 -9.794 26.982 21.116 1.00 22.42 C ATOM 85 CD GLU A 10 -8.978 27.345 22.363 1.00 26.42 C ATOM 86 OE1 GLU A 10 -8.664 28.533 22.588 1.00 26.89 O ATOM 87 OE2 GLU A 10 -8.609 26.396 23.076 1.00 29.04 O ATOM 88 N GLU A 11 -7.060 25.097 17.980 1.00 18.41 N ATOM 89 CA GLU A 11 -6.305 24.135 17.165 1.00 18.60 C ATOM 90 C GLU A 11 -4.816 24.316 17.454 1.00 16.21 C ATOM 91 O GLU A 11 -4.040 23.364 17.652 1.00 17.75 O ATOM 92 CB GLU A 11 -6.600 24.346 15.666 1.00 17.49 C ATOM 93 CG GLU A 11 -5.589 23.614 14.754 1.00 21.34 C ATOM 94 CD GLU A 11 -5.771 23.924 13.279 1.00 22.65 C ATOM 95 OE1 GLU A 11 -6.642 24.736 12.922 1.00 22.99 O ATOM 96 OE2 GLU A 11 -4.972 23.340 12.465 1.00 23.75 O ATOM 97 N LEU A 12 -4.322 25.539 17.355 1.00 15.15 N ATOM 98 CA LEU A 12 -2.967 25.918 17.571 1.00 15.96 C ATOM 99 C LEU A 12 -2.525 25.470 18.968 1.00 16.19 C ATOM 100 O LEU A 12 -1.458 24.861 19.169 1.00 15.68 O ATOM 101 CB LEU A 12 -2.762 27.430 17.469 1.00 16.64 C ATOM 102 CG LEU A 12 -1.373 27.955 17.874 1.00 16.87 C ATOM 103 CD1 LEU A 12 -0.249 27.382 17.004 1.00 16.48 C ATOM 104 CD2 LEU A 12 -1.394 29.455 17.823 1.00 17.33 C ATOM 105 N LEU A 13 -3.266 25.871 20.024 1.00 16.45 N ATOM 106 CA LEU A 13 -2.854 25.445 21.374 1.00 18.43 C ATOM 107 C LEU A 13 -2.819 23.945 21.545 1.00 19.41 C ATOM 108 O LEU A 13 -1.839 23.456 22.133 1.00 19.48 O ATOM 109 CB LEU A 13 -3.857 26.077 22.374 1.00 18.61 C ATOM 110 CG LEU A 13 -3.479 25.892 23.857 1.00 22.53 C ATOM 111 CD1 LEU A 13 -2.202 26.720 24.073 1.00 21.65 C ATOM 112 CD2 LEU A 13 -4.633 26.353 24.729 1.00 25.84 C ATOM 113 N SER A 14 -3.740 23.177 20.927 1.00 18.60 N ATOM 114 CA SER A 14 -3.678 21.718 21.071 1.00 18.77 C ATOM 115 C SER A 14 -2.422 21.200 20.399 1.00 20.22 C ATOM 116 O SER A 14 -1.768 20.283 20.904 1.00 20.04 O ATOM 117 CB SER A 14 -4.974 21.080 20.515 1.00 23.61 C ATOM 118 OG SER A 14 -4.813 19.661 20.362 1.00 29.52 O ATOM 119 N LYS A 15 -2.030 21.803 19.258 1.00 17.89 N ATOM 120 CA LYS A 15 -0.800 21.372 18.566 1.00 17.87 C ATOM 121 C LYS A 15 0.464 21.722 19.332 1.00 19.95 C ATOM 122 O LYS A 15 1.434 20.948 19.426 1.00 20.60 O ATOM 123 CB LYS A 15 -0.753 21.999 17.160 1.00 17.68 C ATOM 124 CG LYS A 15 -1.775 21.356 16.233 1.00 17.75 C ATOM 125 CD LYS A 15 -1.728 22.040 14.861 1.00 21.62 C ATOM 126 CE LYS A 15 -2.663 21.292 13.903 1.00 21.75 C ATOM 127 NZ LYS A 15 -2.169 21.455 12.512 1.00 25.44 N ATOM 128 N ALA A 16 0.469 22.919 19.962 1.00 18.28 N ATOM 129 CA ALA A 16 1.640 23.309 20.761 1.00 19.40 C ATOM 130 C ALA A 16 1.773 22.342 21.948 1.00 20.48 C ATOM 131 O ALA A 16 2.906 21.988 22.324 1.00 20.23 O ATOM 132 CB ALA A 16 1.510 24.738 21.273 1.00 18.45 C ATOM 133 N TYR A 17 0.645 22.037 22.609 1.00 18.29 N ATOM 134 CA TYR A 17 0.785 21.071 23.742 1.00 20.91 C ATOM 135 C TYR A 17 1.245 19.694 23.251 1.00 20.18 C ATOM 136 O TYR A 17 2.113 19.087 23.908 1.00 23.03 O ATOM 137 CB TYR A 17 -0.507 20.947 24.492 1.00 19.42 C ATOM 138 CG TYR A 17 -0.784 21.998 25.538 1.00 18.97 C ATOM 139 CD1 TYR A 17 0.092 22.198 26.594 1.00 18.78 C ATOM 140 CD2 TYR A 17 -1.958 22.748 25.482 1.00 20.33 C ATOM 141 CE1 TYR A 17 -0.199 23.127 27.607 1.00 20.04 C ATOM 142 CE2 TYR A 17 -2.237 23.682 26.463 1.00 19.95 C ATOM 143 CZ TYR A 17 -1.366 23.860 27.514 1.00 20.59 C ATOM 144 OH TYR A 17 -1.667 24.773 28.496 1.00 22.16 O ATOM 145 N HIS A 18 0.768 19.218 22.113 1.00 19.30 N ATOM 146 CA HIS A 18 1.165 17.936 21.561 1.00 21.91 C ATOM 147 C HIS A 18 2.668 17.966 21.271 1.00 22.54 C ATOM 148 O HIS A 18 3.393 17.062 21.691 1.00 21.92 O ATOM 149 CB HIS A 18 0.345 17.624 20.314 1.00 24.40 C ATOM 150 CG HIS A 18 0.754 16.300 19.721 1.00 27.35 C ATOM 151 ND1 HIS A 18 1.179 16.220 18.419 1.00 29.62 N ATOM 152 CD2 HIS A 18 0.801 15.055 20.244 1.00 28.80 C ATOM 153 CE1 HIS A 18 1.469 14.950 18.138 1.00 30.55 C ATOM 154 NE2 HIS A 18 1.288 14.242 19.229 1.00 31.93 N ATOM 155 N LEU A 19 3.145 19.031 20.619 1.00 19.19 N ATOM 156 CA LEU A 19 4.577 19.202 20.381 1.00 20.55 C ATOM 157 C LEU A 19 5.382 19.238 21.681 1.00 22.74 C ATOM 158 O LEU A 19 6.441 18.594 21.790 1.00 21.47 O ATOM 159 CB LEU A 19 4.886 20.493 19.596 1.00 19.68 C ATOM 160 CG LEU A 19 4.495 20.515 18.119 1.00 20.49 C ATOM 161 CD1 LEU A 19 4.456 21.980 17.676 1.00 19.88 C ATOM 162 CD2 LEU A 19 5.545 19.778 17.294 1.00 22.53 C ATOM 163 N GLU A 20 4.901 19.939 22.717 1.00 20.88 N ATOM 164 CA GLU A 20 5.597 19.938 24.006 1.00 23.83 C ATOM 165 C GLU A 20 5.759 18.512 24.515 1.00 23.52 C ATOM 166 O GLU A 20 6.900 18.108 24.909 1.00 26.14 O ATOM 167 CB GLU A 20 4.829 20.769 25.033 1.00 25.38 C ATOM 168 CG GLU A 20 5.569 20.956 26.338 1.00 29.67 C ATOM 169 CD GLU A 20 4.896 22.022 27.193 1.00 33.59 C ATOM 170 OE1 GLU A 20 3.701 21.855 27.537 1.00 35.61 O ATOM 171 OE2 GLU A 20 5.614 23.006 27.487 1.00 36.56 O ATOM 172 N ASN A 21 4.707 17.720 24.499 1.00 22.73 N ATOM 173 CA ASN A 21 4.798 16.344 24.980 1.00 25.40 C ATOM 174 C ASN A 21 5.738 15.501 24.128 1.00 25.73 C ATOM 175 O ASN A 21 6.543 14.690 24.621 1.00 24.68 O ATOM 176 CB ASN A 21 3.400 15.729 25.047 1.00 29.82 C ATOM 177 CG ASN A 21 2.604 16.401 26.164 1.00 33.73 C ATOM 178 OD1 ASN A 21 3.139 16.930 27.145 1.00 37.13 O ATOM 179 ND2 ASN A 21 1.294 16.363 26.000 1.00 36.26 N ATOM 180 N GLU A 22 5.680 15.677 22.801 1.00 24.64 N ATOM 181 CA GLU A 22 6.573 14.942 21.916 1.00 23.14 C ATOM 182 C GLU A 22 8.035 15.313 22.144 1.00 25.26 C ATOM 183 O GLU A 22 8.891 14.406 22.072 1.00 26.10 O ATOM 184 CB GLU A 22 6.238 15.247 20.447 1.00 26.34 C ATOM 185 CG GLU A 22 4.892 14.708 20.007 1.00 26.21 C ATOM 186 CD GLU A 22 4.772 14.986 18.509 1.00 29.30 C ATOM 187 OE1 GLU A 22 4.746 16.204 18.161 1.00 27.78 O ATOM 188 OE2 GLU A 22 4.749 13.997 17.761 1.00 30.05 O ATOM 189 N VAL A 23 8.336 16.577 22.399 1.00 22.12 N ATOM 190 CA VAL A 23 9.706 17.005 22.603 1.00 24.69 C ATOM 191 C VAL A 23 10.208 16.370 23.911 1.00 24.96 C ATOM 192 O VAL A 23 11.356 15.927 24.006 1.00 23.77 O ATOM 193 CB VAL A 23 9.839 18.537 22.589 1.00 25.30 C ATOM 194 CG1 VAL A 23 11.153 19.044 23.155 1.00 27.75 C ATOM 195 CG2 VAL A 23 9.650 19.020 21.145 1.00 27.71 C ATOM 196 N ALA A 24 9.329 16.305 24.908 1.00 24.09 N ATOM 197 CA ALA A 24 9.776 15.700 26.189 1.00 25.16 C ATOM 198 C ALA A 24 10.074 14.238 25.992 1.00 23.83 C ATOM 199 O ALA A 24 11.082 13.704 26.510 1.00 27.59 O ATOM 200 CB ALA A 24 8.602 15.893 27.165 1.00 23.80 C ATOM 201 N ARG A 25 9.273 13.520 25.216 1.00 24.38 N ATOM 202 CA ARG A 25 9.502 12.118 24.965 1.00 26.79 C ATOM 203 C ARG A 25 10.819 11.919 24.199 1.00 27.18 C ATOM 204 O ARG A 25 11.640 11.064 24.545 1.00 25.65 O ATOM 205 CB ARG A 25 8.348 11.461 24.237 1.00 29.32 C ATOM 206 CG ARG A 25 7.089 11.308 25.121 1.00 32.64 C ATOM 207 CD ARG A 25 6.073 10.420 24.406 1.00 36.28 C ATOM 208 NE ARG A 25 5.241 11.032 23.408 1.00 39.08 N ATOM 209 CZ ARG A 25 4.323 11.985 23.418 1.00 40.07 C ATOM 210 NH1 ARG A 25 3.962 12.661 24.501 1.00 42.96 N ATOM 211 NH2 ARG A 25 3.700 12.330 22.295 1.00 40.65 N ATOM 212 N LEU A 26 11.039 12.759 23.192 1.00 23.09 N ATOM 213 CA LEU A 26 12.298 12.619 22.408 1.00 24.74 C ATOM 214 C LEU A 26 13.509 12.917 23.259 1.00 24.93 C ATOM 215 O LEU A 26 14.566 12.244 23.176 1.00 24.44 O ATOM 216 CB LEU A 26 12.134 13.583 21.230 1.00 26.40 C ATOM 217 CG LEU A 26 11.735 13.116 19.848 1.00 29.57 C ATOM 218 CD1 LEU A 26 11.647 14.354 18.943 1.00 29.40 C ATOM 219 CD2 LEU A 26 12.695 12.105 19.218 1.00 29.88 C ATOM 220 N LYS A 27 13.471 13.974 24.084 1.00 23.40 N ATOM 221 CA LYS A 27 14.545 14.334 24.988 1.00 27.19 C ATOM 222 C LYS A 27 14.940 13.155 25.898 1.00 28.10 C ATOM 223 O LYS A 27 16.139 12.909 26.096 1.00 27.95 O ATOM 224 CB LYS A 27 14.193 15.553 25.815 1.00 28.42 C ATOM 225 CG LYS A 27 15.276 16.148 26.685 1.00 32.25 C ATOM 226 CD LYS A 27 14.799 17.427 27.371 1.00 35.15 C ATOM 227 CE LYS A 27 15.861 17.937 28.332 1.00 37.94 C ATOM 228 NZ LYS A 27 15.787 19.398 28.546 1.00 40.07 N ATOM 229 N LYS A 28 13.975 12.392 26.370 1.00 29.22 N ATOM 230 CA LYS A 28 14.268 11.201 27.190 1.00 30.25 C ATOM 231 C LYS A 28 14.893 10.111 26.328 1.00 31.29 C ATOM 232 O LYS A 28 15.770 9.362 26.798 1.00 30.72 O ATOM 233 CB LYS A 28 12.969 10.646 27.795 1.00 33.96 C ATOM 234 CG LYS A 28 13.171 9.334 28.558 1.00 36.23 C ATOM 235 CD LYS A 28 13.315 9.643 30.043 1.00 39.32 C ATOM 236 CE LYS A 28 13.932 8.487 30.822 1.00 40.34 C ATOM 237 NZ LYS A 28 15.341 8.831 31.203 1.00 42.08 N ATOM 238 N LEU A 29 14.444 9.971 25.079 1.00 28.50 N ATOM 239 CA LEU A 29 15.020 8.964 24.187 1.00 28.84 C ATOM 240 C LEU A 29 16.466 9.328 23.862 1.00 30.21 C ATOM 241 O LEU A 29 17.365 8.458 23.869 1.00 30.93 O ATOM 242 CB LEU A 29 14.232 8.845 22.881 1.00 30.15 C ATOM 243 CG LEU A 29 12.917 8.047 22.963 1.00 31.75 C ATOM 244 CD1 LEU A 29 12.237 8.025 21.608 1.00 33.19 C ATOM 245 CD2 LEU A 29 13.226 6.628 23.446 1.00 33.32 C ATOM 246 N VAL A 30 16.728 10.589 23.585 1.00 29.19 N ATOM 247 CA VAL A 30 18.076 11.043 23.257 1.00 31.37 C ATOM 248 C VAL A 30 18.980 10.977 24.497 1.00 32.03 C ATOM 249 O VAL A 30 20.176 10.645 24.252 1.00 32.50 O ATOM 250 CB VAL A 30 18.040 12.437 22.633 1.00 31.73 C ATOM 251 CG1 VAL A 30 19.432 13.007 22.400 1.00 32.83 C ATOM 252 CG2 VAL A 30 17.279 12.323 21.303 1.00 31.46 C