>>1RB4:HELIX    2   2 ARG B    1  GLU B   32  1                                  32    
RMKQLEDKVEELLSKAYHLENEVARLKKLVGE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 2 2 ARG B 1 GLU B 32 1 32 ATOM 254 N ARG B 1 -7.524 45.157 14.248 1.00 27.24 N ATOM 255 CA ARG B 1 -7.109 44.120 15.211 1.00 26.32 C ATOM 256 C ARG B 1 -7.478 42.702 14.780 1.00 25.77 C ATOM 257 O ARG B 1 -6.656 41.778 14.951 1.00 24.98 O ATOM 258 CB ARG B 1 -7.783 44.401 16.563 1.00 27.48 C ATOM 259 CG ARG B 1 -7.257 43.494 17.666 1.00 28.65 C ATOM 260 CD ARG B 1 -5.759 43.724 17.837 1.00 30.85 C ATOM 261 NE ARG B 1 -5.309 43.149 19.090 1.00 33.39 N ATOM 262 CZ ARG B 1 -4.071 42.897 19.434 1.00 34.50 C ATOM 263 NH1 ARG B 1 -3.044 43.131 18.615 1.00 35.92 N ATOM 264 NH2 ARG B 1 -3.879 42.370 20.632 1.00 36.43 N ATOM 265 N MET B 2 -8.640 42.550 14.142 1.00 23.75 N ATOM 266 CA MET B 2 -9.061 41.204 13.804 1.00 25.58 C ATOM 267 C MET B 2 -8.168 40.507 12.777 1.00 25.00 C ATOM 268 O MET B 2 -7.780 39.323 12.951 1.00 24.23 O ATOM 269 CB MET B 2 -10.524 41.196 13.330 1.00 27.08 C ATOM 270 CG MET B 2 -10.770 39.750 12.855 1.00 30.37 C ATOM 271 SD MET B 2 -11.666 38.810 14.127 1.00 33.60 S ATOM 272 CE MET B 2 -13.168 39.823 13.626 1.00 23.29 C ATOM 273 N LYS B 3 -7.827 41.280 11.733 1.00 23.44 N ATOM 274 CA LYS B 3 -6.926 40.756 10.704 1.00 24.80 C ATOM 275 C LYS B 3 -5.533 40.541 11.303 1.00 22.57 C ATOM 276 O LYS B 3 -4.840 39.583 10.906 1.00 22.83 O ATOM 277 CB LYS B 3 -6.831 41.715 9.521 1.00 25.01 C ATOM 278 CG LYS B 3 -5.875 41.341 8.395 1.00 27.61 C ATOM 279 CD LYS B 3 -6.418 40.188 7.552 1.00 32.20 C ATOM 280 CE LYS B 3 -5.587 40.068 6.256 1.00 34.27 C ATOM 281 NZ LYS B 3 -6.483 39.419 5.244 1.00 36.44 N ATOM 282 N GLN B 4 -5.088 41.332 12.261 1.00 21.88 N ATOM 283 CA GLN B 4 -3.783 41.169 12.875 1.00 23.07 C ATOM 284 C GLN B 4 -3.755 39.783 13.560 1.00 19.88 C ATOM 285 O GLN B 4 -2.739 39.083 13.461 1.00 20.60 O ATOM 286 CB GLN B 4 -3.458 42.229 13.920 1.00 24.36 C ATOM 287 CG GLN B 4 -2.086 42.210 14.515 1.00 27.94 C ATOM 288 CD GLN B 4 -1.760 43.430 15.360 1.00 32.24 C ATOM 289 OE1 GLN B 4 -2.649 44.085 15.912 1.00 33.74 O ATOM 290 NE2 GLN B 4 -0.470 43.732 15.468 1.00 35.72 N ATOM 291 N LEU B 5 -4.848 39.449 14.242 1.00 17.86 N ATOM 292 CA LEU B 5 -4.862 38.183 14.997 1.00 19.59 C ATOM 293 C LEU B 5 -5.077 36.977 14.096 1.00 17.69 C ATOM 294 O LEU B 5 -4.446 35.910 14.285 1.00 19.12 O ATOM 295 CB LEU B 5 -5.930 38.197 16.083 1.00 20.98 C ATOM 296 CG LEU B 5 -5.680 39.327 17.087 1.00 21.29 C ATOM 297 CD1 LEU B 5 -6.835 39.298 18.102 1.00 24.23 C ATOM 298 CD2 LEU B 5 -4.328 39.260 17.754 1.00 22.63 C ATOM 299 N GLU B 6 -5.826 37.195 13.014 1.00 19.29 N ATOM 300 CA GLU B 6 -6.008 36.113 12.012 1.00 19.25 C ATOM 301 C GLU B 6 -4.653 35.814 11.382 1.00 17.65 C ATOM 302 O GLU B 6 -4.268 34.676 11.087 1.00 18.87 O ATOM 303 CB GLU B 6 -7.031 36.565 10.952 1.00 19.92 C ATOM 304 CG GLU B 6 -8.479 36.521 11.370 1.00 22.38 C ATOM 305 CD GLU B 6 -9.472 37.187 10.437 1.00 23.64 C ATOM 306 OE1 GLU B 6 -9.084 38.067 9.648 1.00 24.14 O ATOM 307 OE2 GLU B 6 -10.666 36.833 10.507 1.00 26.06 O ATOM 308 N ASP B 7 -3.871 36.859 11.042 1.00 18.23 N ATOM 309 CA ASP B 7 -2.544 36.693 10.439 1.00 18.59 C ATOM 310 C ASP B 7 -1.599 35.973 11.414 1.00 19.36 C ATOM 311 O ASP B 7 -0.859 35.037 11.024 1.00 18.62 O ATOM 312 CB ASP B 7 -1.951 38.076 10.115 1.00 20.90 C ATOM 313 CG ASP B 7 -2.501 38.709 8.834 1.00 23.37 C ATOM 314 OD1 ASP B 7 -3.266 38.101 8.097 1.00 23.48 O ATOM 315 OD2 ASP B 7 -2.077 39.876 8.631 1.00 23.93 O ATOM 316 N LYS B 8 -1.682 36.379 12.679 1.00 18.06 N ATOM 317 CA LYS B 8 -0.818 35.727 13.680 1.00 16.96 C ATOM 318 C LYS B 8 -1.154 34.257 13.835 1.00 15.21 C ATOM 319 O LYS B 8 -0.231 33.415 13.985 1.00 15.99 O ATOM 320 CB LYS B 8 -1.019 36.459 15.026 1.00 16.64 C ATOM 321 CG LYS B 8 -0.088 35.829 16.082 1.00 19.98 C ATOM 322 CD LYS B 8 1.378 35.964 15.811 1.00 20.49 C ATOM 323 CE LYS B 8 1.938 37.371 15.596 1.00 22.21 C ATOM 324 NZ LYS B 8 3.437 37.213 15.505 1.00 23.07 N ATOM 325 N VAL B 9 -2.459 33.902 13.915 1.00 14.73 N ATOM 326 CA VAL B 9 -2.755 32.486 14.104 1.00 15.64 C ATOM 327 C VAL B 9 -2.331 31.687 12.869 1.00 14.87 C ATOM 328 O VAL B 9 -1.901 30.537 13.028 1.00 15.56 O ATOM 329 CB VAL B 9 -4.231 32.220 14.426 1.00 18.18 C ATOM 330 CG1 VAL B 9 -5.141 32.174 13.195 1.00 19.47 C ATOM 331 CG2 VAL B 9 -4.365 30.891 15.151 1.00 18.65 C ATOM 332 N GLU B 10 -2.415 32.251 11.658 1.00 15.08 N ATOM 333 CA GLU B 10 -1.903 31.448 10.508 1.00 17.19 C ATOM 334 C GLU B 10 -0.386 31.328 10.540 1.00 14.23 C ATOM 335 O GLU B 10 0.175 30.253 10.252 1.00 16.89 O ATOM 336 CB GLU B 10 -2.274 32.217 9.229 1.00 18.47 C ATOM 337 CG GLU B 10 -3.780 32.177 9.076 1.00 20.13 C ATOM 338 CD GLU B 10 -4.353 33.060 7.976 1.00 24.18 C ATOM 339 OE1 GLU B 10 -3.662 33.974 7.538 1.00 23.83 O ATOM 340 OE2 GLU B 10 -5.522 32.652 7.682 1.00 27.36 O ATOM 341 N GLU B 11 0.350 32.363 10.969 1.00 16.15 N ATOM 342 CA GLU B 11 1.798 32.251 11.109 1.00 16.35 C ATOM 343 C GLU B 11 2.133 31.141 12.116 1.00 16.98 C ATOM 344 O GLU B 11 3.004 30.260 11.888 1.00 17.07 O ATOM 345 CB GLU B 11 2.363 33.549 11.719 1.00 19.20 C ATOM 346 CG GLU B 11 3.811 33.488 12.150 1.00 17.74 C ATOM 347 CD GLU B 11 4.220 34.702 12.979 1.00 25.24 C ATOM 348 OE1 GLU B 11 3.561 35.764 12.966 1.00 24.58 O ATOM 349 OE2 GLU B 11 5.227 34.503 13.702 1.00 29.26 O ATOM 350 N LEU B 12 1.475 31.193 13.299 1.00 15.05 N ATOM 351 CA LEU B 12 1.778 30.181 14.326 1.00 15.62 C ATOM 352 C LEU B 12 1.406 28.764 13.909 1.00 15.22 C ATOM 353 O LEU B 12 2.128 27.754 14.216 1.00 16.24 O ATOM 354 CB LEU B 12 1.180 30.598 15.667 1.00 15.77 C ATOM 355 CG LEU B 12 1.757 31.946 16.146 1.00 16.29 C ATOM 356 CD1 LEU B 12 1.110 32.283 17.507 1.00 14.84 C ATOM 357 CD2 LEU B 12 3.242 31.881 16.289 1.00 18.13 C ATOM 358 N LEU B 13 0.285 28.590 13.171 1.00 14.92 N ATOM 359 CA LEU B 13 -0.084 27.298 12.685 1.00 15.13 C ATOM 360 C LEU B 13 0.941 26.722 11.691 1.00 15.68 C ATOM 361 O LEU B 13 1.253 25.534 11.757 1.00 17.47 O ATOM 362 CB LEU B 13 -1.471 27.276 12.018 1.00 16.61 C ATOM 363 CG LEU B 13 -2.588 27.325 13.071 1.00 16.82 C ATOM 364 CD1 LEU B 13 -3.917 27.680 12.378 1.00 18.03 C ATOM 365 CD2 LEU B 13 -2.775 25.986 13.797 1.00 20.21 C ATOM 366 N SER B 14 1.491 27.642 10.867 1.00 15.96 N ATOM 367 CA SER B 14 2.523 27.192 9.933 1.00 16.97 C ATOM 368 C SER B 14 3.771 26.752 10.712 1.00 18.34 C ATOM 369 O SER B 14 4.300 25.665 10.448 1.00 19.28 O ATOM 370 CB SER B 14 2.890 28.350 9.005 1.00 18.30 C ATOM 371 OG SER B 14 3.975 28.011 8.167 1.00 17.41 O ATOM 372 N LYS B 15 4.144 27.587 11.695 1.00 15.38 N ATOM 373 CA LYS B 15 5.345 27.171 12.492 1.00 18.56 C ATOM 374 C LYS B 15 5.043 25.846 13.179 1.00 17.96 C ATOM 375 O LYS B 15 5.956 25.005 13.228 1.00 17.69 O ATOM 376 CB LYS B 15 5.698 28.256 13.478 1.00 21.48 C ATOM 377 CG LYS B 15 6.310 29.515 12.826 1.00 25.79 C ATOM 378 CD LYS B 15 6.508 30.555 13.903 1.00 29.18 C ATOM 379 CE LYS B 15 7.064 31.901 13.440 1.00 32.37 C ATOM 380 NZ LYS B 15 7.682 31.740 12.101 1.00 32.90 N ATOM 381 N ALA B 16 3.856 25.645 13.719 1.00 15.62 N ATOM 382 CA ALA B 16 3.492 24.390 14.374 1.00 16.79 C ATOM 383 C ALA B 16 3.611 23.192 13.429 1.00 18.34 C ATOM 384 O ALA B 16 4.158 22.127 13.798 1.00 19.73 O ATOM 385 CB ALA B 16 2.116 24.432 15.031 1.00 18.02 C ATOM 386 N TYR B 17 3.085 23.314 12.214 1.00 16.72 N ATOM 387 CA TYR B 17 3.213 22.246 11.216 1.00 18.37 C ATOM 388 C TYR B 17 4.671 21.913 10.914 1.00 16.87 C ATOM 389 O TYR B 17 5.009 20.701 10.856 1.00 19.23 O ATOM 390 CB TYR B 17 2.513 22.734 9.956 1.00 19.32 C ATOM 391 CG TYR B 17 2.579 21.803 8.767 1.00 21.12 C ATOM 392 CD1 TYR B 17 1.943 20.585 8.804 1.00 24.17 C ATOM 393 CD2 TYR B 17 3.229 22.224 7.605 1.00 24.19 C ATOM 394 CE1 TYR B 17 1.984 19.731 7.709 1.00 25.96 C ATOM 395 CE2 TYR B 17 3.278 21.367 6.495 1.00 25.88 C ATOM 396 CZ TYR B 17 2.643 20.157 6.568 1.00 28.19 C ATOM 397 OH TYR B 17 2.652 19.286 5.477 1.00 31.05 O ATOM 398 N HIS B 18 5.518 22.918 10.679 1.00 17.79 N ATOM 399 CA HIS B 18 6.925 22.623 10.377 1.00 18.49 C ATOM 400 C HIS B 18 7.639 22.015 11.568 1.00 19.46 C ATOM 401 O HIS B 18 8.531 21.157 11.388 1.00 19.85 O ATOM 402 CB HIS B 18 7.627 23.873 9.832 1.00 17.71 C ATOM 403 CG HIS B 18 6.978 24.194 8.511 1.00 20.72 C ATOM 404 ND1 HIS B 18 7.489 23.617 7.343 1.00 24.35 N ATOM 405 CD2 HIS B 18 5.926 24.935 8.122 1.00 21.16 C ATOM 406 CE1 HIS B 18 6.784 24.033 6.318 1.00 22.74 C ATOM 407 NE2 HIS B 18 5.801 24.819 6.738 1.00 22.37 N ATOM 408 N LEU B 19 7.295 22.409 12.801 1.00 18.31 N ATOM 409 CA LEU B 19 7.920 21.765 13.971 1.00 17.30 C ATOM 410 C LEU B 19 7.504 20.315 14.089 1.00 19.41 C ATOM 411 O LEU B 19 8.316 19.431 14.466 1.00 20.94 O ATOM 412 CB LEU B 19 7.568 22.555 15.262 1.00 17.09 C ATOM 413 CG LEU B 19 8.337 23.878 15.348 1.00 18.80 C ATOM 414 CD1 LEU B 19 7.703 24.663 16.528 1.00 21.26 C ATOM 415 CD2 LEU B 19 9.810 23.698 15.623 1.00 20.62 C ATOM 416 N GLU B 20 6.229 20.021 13.766 1.00 20.72 N ATOM 417 CA GLU B 20 5.773 18.625 13.786 1.00 23.66 C ATOM 418 C GLU B 20 6.581 17.821 12.755 1.00 23.64 C ATOM 419 O GLU B 20 6.903 16.654 13.018 1.00 25.00 O ATOM 420 CB GLU B 20 4.283 18.583 13.466 1.00 25.52 C ATOM 421 CG GLU B 20 3.592 17.242 13.463 1.00 30.57 C ATOM 422 CD GLU B 20 3.211 16.700 14.833 1.00 35.27 C ATOM 423 OE1 GLU B 20 4.014 16.765 15.795 1.00 33.01 O ATOM 424 OE2 GLU B 20 2.064 16.148 14.907 1.00 39.66 O ATOM 425 N ASN B 21 6.876 18.426 11.599 1.00 21.85 N ATOM 426 CA ASN B 21 7.675 17.666 10.615 1.00 23.15 C ATOM 427 C ASN B 21 9.065 17.374 11.154 1.00 23.24 C ATOM 428 O ASN B 21 9.616 16.286 10.910 1.00 23.86 O ATOM 429 CB ASN B 21 7.839 18.451 9.320 1.00 24.92 C ATOM 430 CG ASN B 21 6.585 18.527 8.489 1.00 27.82 C ATOM 431 OD1 ASN B 21 5.617 17.800 8.716 1.00 31.87 O ATOM 432 ND2 ASN B 21 6.664 19.418 7.501 1.00 31.86 N ATOM 433 N GLU B 22 9.634 18.319 11.883 1.00 21.39 N ATOM 434 CA GLU B 22 10.964 18.170 12.447 1.00 22.87 C ATOM 435 C GLU B 22 10.951 17.090 13.521 1.00 25.03 C ATOM 436 O GLU B 22 11.885 16.279 13.643 1.00 24.23 O ATOM 437 CB GLU B 22 11.511 19.495 12.933 1.00 26.24 C ATOM 438 CG GLU B 22 12.762 19.283 13.750 1.00 30.44 C ATOM 439 CD GLU B 22 13.425 20.535 14.240 1.00 34.62 C ATOM 440 OE1 GLU B 22 12.835 21.628 14.153 1.00 37.18 O ATOM 441 OE2 GLU B 22 14.563 20.376 14.752 1.00 37.11 O ATOM 442 N VAL B 23 9.910 17.099 14.344 1.00 21.63 N ATOM 443 CA VAL B 23 9.773 16.068 15.389 1.00 23.80 C ATOM 444 C VAL B 23 9.708 14.688 14.765 1.00 26.81 C ATOM 445 O VAL B 23 10.416 13.753 15.206 1.00 26.38 O ATOM 446 CB VAL B 23 8.465 16.304 16.192 1.00 24.83 C ATOM 447 CG1 VAL B 23 8.079 15.056 16.993 1.00 25.73 C ATOM 448 CG2 VAL B 23 8.702 17.525 17.068 1.00 24.86 C ATOM 449 N ALA B 24 8.869 14.585 13.734 1.00 27.04 N ATOM 450 CA ALA B 24 8.725 13.312 13.028 1.00 29.38 C ATOM 451 C ALA B 24 10.082 12.808 12.510 1.00 30.64 C ATOM 452 O ALA B 24 10.346 11.599 12.586 1.00 30.04 O ATOM 453 CB ALA B 24 7.825 13.499 11.825 1.00 28.83 C ATOM 454 N ARG B 25 10.857 13.701 11.908 1.00 29.50 N ATOM 455 CA ARG B 25 12.152 13.348 11.374 1.00 30.20 C ATOM 456 C ARG B 25 13.095 12.888 12.502 1.00 29.30 C ATOM 457 O ARG B 25 13.765 11.856 12.293 1.00 27.87 O ATOM 458 CB ARG B 25 12.849 14.487 10.664 1.00 30.83 C ATOM 459 CG ARG B 25 12.320 14.893 9.295 1.00 33.86 C ATOM 460 CD ARG B 25 13.267 15.919 8.689 1.00 34.63 C ATOM 461 NE ARG B 25 13.159 17.281 9.139 1.00 37.16 N ATOM 462 CZ ARG B 25 12.197 18.178 8.912 1.00 35.32 C ATOM 463 NH1 ARG B 25 11.134 17.873 8.192 1.00 37.34 N ATOM 464 NH2 ARG B 25 12.318 19.397 9.424 1.00 34.35 N ATOM 465 N LEU B 26 13.113 13.647 13.609 1.00 25.77 N ATOM 466 CA LEU B 26 14.050 13.259 14.682 1.00 26.78 C ATOM 467 C LEU B 26 13.625 11.973 15.364 1.00 27.97 C ATOM 468 O LEU B 26 14.479 11.167 15.780 1.00 28.75 O ATOM 469 CB LEU B 26 14.206 14.409 15.672 1.00 26.77 C ATOM 470 CG LEU B 26 14.728 15.716 15.073 1.00 28.04 C ATOM 471 CD1 LEU B 26 14.887 16.797 16.139 1.00 29.53 C ATOM 472 CD2 LEU B 26 16.054 15.480 14.342 1.00 29.57 C ATOM 473 N LYS B 27 12.319 11.724 15.459 1.00 29.28 N ATOM 474 CA LYS B 27 11.858 10.463 16.077 1.00 31.40 C ATOM 475 C LYS B 27 12.353 9.278 15.251 1.00 32.91 C ATOM 476 O LYS B 27 12.786 8.255 15.804 1.00 32.52 O ATOM 477 CB LYS B 27 10.342 10.411 16.177 1.00 33.54 C ATOM 478 CG LYS B 27 9.784 11.468 17.151 1.00 36.44 C ATOM 479 CD LYS B 27 8.327 11.733 16.782 1.00 39.56 C ATOM 480 CE LYS B 27 7.388 10.655 17.271 1.00 40.05 C ATOM 481 NZ LYS B 27 6.065 11.216 17.706 1.00 42.01 N ATOM 482 N LYS B 28 12.294 9.411 13.923 1.00 31.57 N ATOM 483 CA LYS B 28 12.756 8.375 13.020 1.00 32.74 C ATOM 484 C LYS B 28 14.248 8.145 13.224 1.00 32.02 C ATOM 485 O LYS B 28 14.702 6.995 13.233 1.00 32.67 O ATOM 486 CB LYS B 28 12.538 8.793 11.569 1.00 35.52 C ATOM 487 CG LYS B 28 12.181 7.693 10.587 1.00 37.78 C ATOM 488 CD LYS B 28 12.386 8.201 9.148 1.00 40.28 C ATOM 489 CE LYS B 28 12.839 7.028 8.285 1.00 41.80 C ATOM 490 NZ LYS B 28 13.625 7.444 7.099 1.00 44.37 N ATOM 491 N LEU B 29 15.010 9.229 13.266 1.00 31.16 N ATOM 492 CA LEU B 29 16.451 9.182 13.437 1.00 30.59 C ATOM 493 C LEU B 29 16.859 8.497 14.733 1.00 31.03 C ATOM 494 O LEU B 29 17.691 7.580 14.690 1.00 32.12 O ATOM 495 CB LEU B 29 17.111 10.545 13.401 1.00 31.72 C ATOM 496 CG LEU B 29 18.088 10.917 12.293 1.00 36.53 C ATOM 497 CD1 LEU B 29 17.659 10.374 10.934 1.00 36.05 C ATOM 498 CD2 LEU B 29 18.310 12.434 12.272 1.00 36.09 C ATOM 499 N VAL B 30 16.254 8.888 15.863 1.00 30.54 N ATOM 500 CA VAL B 30 16.670 8.248 17.118 1.00 32.24 C ATOM 501 C VAL B 30 16.170 6.824 17.226 1.00 32.89 C ATOM 502 O VAL B 30 16.753 6.062 18.033 1.00 33.90 O ATOM 503 CB VAL B 30 16.309 9.109 18.344 1.00 34.00 C ATOM 504 CG1 VAL B 30 14.808 9.128 18.556 1.00 33.75 C ATOM 505 CG2 VAL B 30 17.067 8.650 19.585 1.00 33.59 C ATOM 506 N GLY B 31 15.193 6.357 16.466 1.00 34.50 N ATOM 507 CA GLY B 31 14.799 4.957 16.610 1.00 38.17 C ATOM 508 C GLY B 31 15.464 3.982 15.661 1.00 40.20 C ATOM 509 O GLY B 31 15.181 2.780 15.810 1.00 39.11 O ATOM 510 N GLU B 32 16.281 4.380 14.684 1.00 42.17 N ATOM 511 CA GLU B 32 16.696 3.407 13.666 1.00 44.45 C ATOM 512 C GLU B 32 17.825 2.427 13.870 1.00 46.88 C ATOM 513 O GLU B 32 18.950 2.576 13.333 1.00 47.42 O ATOM 514 CB GLU B 32 16.890 4.139 12.328 1.00 45.85 C ATOM 515 CG GLU B 32 17.832 5.261 12.302 1.00 46.96 C ATOM 516 CD GLU B 32 18.838 5.444 11.198 1.00 47.96 C ATOM 517 OE1 GLU B 32 19.596 4.521 10.855 1.00 46.64 O ATOM 518 OE2 GLU B 32 18.916 6.611 10.747 1.00 47.93 O