>>1SO2:HELIX   87  87 ILE D  995  GLY D 1007  1                                  13    
IVGPLCNSYDAAGLLPGQWLEAERRIFCQLMHHLTENHKIWK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 87 87 ILE D 995 GLY D 1007 1 13 ATOM 11369 N ILE D 995 39.120 44.473 56.765 1.00 55.16 N ATOM 11370 CA ILE D 995 37.815 44.699 56.168 1.00 54.89 C ATOM 11371 C ILE D 995 36.818 45.303 57.151 1.00 54.85 C ATOM 11372 O ILE D 995 36.583 46.510 57.110 1.00 56.04 O ATOM 11373 CB ILE D 995 37.241 43.398 55.530 1.00 54.29 C ATOM 11374 CG1 ILE D 995 38.074 42.985 54.320 1.00 54.08 C ATOM 11375 CG2 ILE D 995 35.860 43.632 55.007 1.00 54.51 C ATOM 11376 CD1 ILE D 995 39.290 42.212 54.640 1.00 52.85 C ATOM 11377 N VAL D 996 36.250 44.498 58.047 1.00 54.56 N ATOM 11378 CA VAL D 996 35.257 45.024 58.983 1.00 55.13 C ATOM 11379 C VAL D 996 35.690 46.309 59.704 1.00 55.65 C ATOM 11380 O VAL D 996 35.012 47.333 59.637 1.00 55.47 O ATOM 11381 CB VAL D 996 34.863 43.979 60.042 1.00 54.09 C ATOM 11382 CG1 VAL D 996 33.760 44.532 60.899 1.00 54.19 C ATOM 11383 CG2 VAL D 996 34.364 42.713 59.380 1.00 54.54 C ATOM 11384 N GLY D 997 36.819 46.257 60.392 1.00 56.25 N ATOM 11385 CA GLY D 997 37.275 47.430 61.106 1.00 56.97 C ATOM 11386 C GLY D 997 37.177 48.750 60.349 1.00 57.79 C ATOM 11387 O GLY D 997 36.443 49.658 60.758 1.00 57.57 O ATOM 11388 N PRO D 998 37.916 48.902 59.243 1.00 58.18 N ATOM 11389 CA PRO D 998 37.872 50.153 58.472 1.00 57.44 C ATOM 11390 C PRO D 998 36.498 50.549 57.933 1.00 57.53 C ATOM 11391 O PRO D 998 36.185 51.737 57.807 1.00 55.99 O ATOM 11392 CB PRO D 998 38.904 49.923 57.369 1.00 57.79 C ATOM 11393 CG PRO D 998 39.113 48.438 57.362 1.00 58.57 C ATOM 11394 CD PRO D 998 38.992 48.023 58.771 1.00 57.37 C ATOM 11395 N LEU D 999 35.681 49.556 57.614 1.00 56.83 N ATOM 11396 CA LEU D 999 34.365 49.858 57.116 1.00 56.67 C ATOM 11397 C LEU D 999 33.623 50.648 58.206 1.00 58.55 C ATOM 11398 O LEU D 999 33.111 51.747 57.959 1.00 59.11 O ATOM 11399 CB LEU D 999 33.611 48.572 56.779 1.00 54.49 C ATOM 11400 CG LEU D 999 32.250 48.780 56.096 1.00 53.81 C ATOM 11401 CD1 LEU D 999 32.469 49.564 54.797 1.00 53.52 C ATOM 11402 CD2 LEU D 999 31.568 47.443 55.821 1.00 50.92 C ATOM 11403 N CYS D1000 33.592 50.099 59.416 1.00 59.33 N ATOM 11404 CA CYS D1000 32.899 50.737 60.533 1.00 60.38 C ATOM 11405 C CYS D1000 33.449 52.066 60.979 1.00 60.91 C ATOM 11406 O CYS D1000 32.693 52.944 61.394 1.00 61.74 O ATOM 11407 CB CYS D1000 32.868 49.812 61.745 1.00 60.88 C ATOM 11408 SG CYS D1000 31.854 48.369 61.494 1.00 64.96 S ATOM 11409 N ASN D1001 34.761 52.223 60.936 1.00 60.80 N ATOM 11410 CA ASN D1001 35.321 53.486 61.372 1.00 61.73 C ATOM 11411 C ASN D1001 34.845 54.528 60.388 1.00 61.99 C ATOM 11412 O ASN D1001 34.564 55.666 60.768 1.00 62.85 O ATOM 11413 CB ASN D1001 36.849 53.434 61.401 1.00 61.99 C ATOM 11414 CG ASN D1001 37.373 52.371 62.354 1.00 63.59 C ATOM 11415 OD1 ASN D1001 37.013 52.339 63.536 1.00 63.57 O ATOM 11416 ND2 ASN D1001 38.230 51.497 61.845 1.00 64.96 N ATOM 11417 N SER D1002 34.731 54.118 59.128 1.00 61.66 N ATOM 11418 CA SER D1002 34.293 55.009 58.067 1.00 61.03 C ATOM 11419 C SER D1002 32.816 55.383 58.242 1.00 60.63 C ATOM 11420 O SER D1002 32.479 56.562 58.394 1.00 60.74 O ATOM 11421 CB SER D1002 34.523 54.349 56.709 1.00 60.50 C ATOM 11422 OG SER D1002 34.021 55.170 55.662 1.00 61.27 O ATOM 11423 N TYR D1003 31.952 54.375 58.228 1.00 59.55 N ATOM 11424 CA TYR D1003 30.522 54.578 58.399 1.00 59.78 C ATOM 11425 C TYR D1003 30.207 55.304 59.696 1.00 60.45 C ATOM 11426 O TYR D1003 29.172 55.953 59.828 1.00 60.28 O ATOM 11427 CB TYR D1003 29.819 53.247 58.442 1.00 59.23 C ATOM 11428 CG TYR D1003 28.326 53.330 58.307 1.00 59.52 C ATOM 11429 CD1 TYR D1003 27.738 53.379 57.044 1.00 60.17 C ATOM 11430 CD2 TYR D1003 27.490 53.240 59.427 1.00 58.89 C ATOM 11431 CE1 TYR D1003 26.353 53.314 56.886 1.00 60.05 C ATOM 11432 CE2 TYR D1003 26.102 53.175 59.285 1.00 59.55 C ATOM 11433 CZ TYR D1003 25.545 53.203 57.999 1.00 60.13 C ATOM 11434 OH TYR D1003 24.196 53.048 57.801 1.00 62.10 O ATOM 11435 N ASP D1004 31.090 55.170 60.673 1.00 61.14 N ATOM 11436 CA ASP D1004 30.860 55.818 61.948 1.00 61.11 C ATOM 11437 C ASP D1004 31.303 57.263 61.851 1.00 60.85 C ATOM 11438 O ASP D1004 30.567 58.178 62.231 1.00 60.72 O ATOM 11439 CB ASP D1004 31.620 55.094 63.055 1.00 61.51 C ATOM 11440 CG ASP D1004 31.502 55.796 64.394 1.00 61.96 C ATOM 11441 OD1 ASP D1004 32.441 56.552 64.755 1.00 62.13 O ATOM 11442 OD2 ASP D1004 30.462 55.601 65.077 1.00 60.66 O ATOM 11443 N ALA D1005 32.507 57.458 61.328 1.00 60.44 N ATOM 11444 CA ALA D1005 33.057 58.798 61.154 1.00 61.13 C ATOM 11445 C ALA D1005 32.056 59.679 60.382 1.00 61.93 C ATOM 11446 O ALA D1005 31.943 60.886 60.626 1.00 61.38 O ATOM 11447 CB ALA D1005 34.384 58.721 60.385 1.00 59.81 C ATOM 11448 N ALA D1006 31.336 59.052 59.452 1.00 62.01 N ATOM 11449 CA ALA D1006 30.370 59.755 58.637 1.00 61.79 C ATOM 11450 C ALA D1006 29.271 60.296 59.552 1.00 62.29 C ATOM 11451 O ALA D1006 28.703 61.360 59.303 1.00 63.29 O ATOM 11452 CB ALA D1006 29.799 58.810 57.587 1.00 61.31 C ATOM 11453 N GLY D1007 28.995 59.565 60.624 1.00 61.92 N ATOM 11454 CA GLY D1007 27.975 59.975 61.574 1.00 60.93 C ATOM 11455 C GLY D1007 26.656 59.252 61.386 1.00 61.18 C ATOM 11456 O GLY D1007 25.621 59.662 61.934 1.00 62.05 O ATOM 11457 N LEU D1008 26.670 58.154 60.639 1.00 60.81 N ATOM 11458 CA LEU D1008 25.419 57.451 60.395 1.00 61.32 C ATOM 11459 C LEU D1008 25.167 56.276 61.328 1.00 61.77 C ATOM 11460 O LEU D1008 24.229 55.498 61.127 1.00 61.99 O ATOM 11461 CB LEU D1008 25.366 56.996 58.936 1.00 60.59 C ATOM 11462 CG LEU D1008 26.145 57.867 57.929 1.00 61.97 C ATOM 11463 CD1 LEU D1008 25.617 57.534 56.549 1.00 61.29 C ATOM 11464 CD2 LEU D1008 25.993 59.375 58.192 1.00 60.81 C ATOM 11465 N LEU D1009 25.984 56.155 62.367 1.00 62.54 N ATOM 11466 CA LEU D1009 25.805 55.049 63.290 1.00 63.54 C ATOM 11467 C LEU D1009 24.830 55.315 64.425 1.00 64.31 C ATOM 11468 O LEU D1009 24.966 56.297 65.169 1.00 64.39 O ATOM 11469 CB LEU D1009 27.152 54.611 63.880 1.00 63.70 C ATOM 11470 CG LEU D1009 27.798 53.435 63.125 1.00 64.00 C ATOM 11471 CD1 LEU D1009 29.086 53.051 63.809 1.00 64.23 C ATOM 11472 CD2 LEU D1009 26.851 52.235 63.086 1.00 63.18 C ATOM 11473 N PRO D1010 23.830 54.433 64.572 1.00 65.03 N ATOM 11474 CA PRO D1010 22.811 54.545 65.623 1.00 65.87 C ATOM 11475 C PRO D1010 23.344 54.266 67.035 1.00 67.17 C ATOM 11476 O PRO D1010 24.217 53.414 67.224 1.00 67.64 O ATOM 11477 CB PRO D1010 21.728 53.553 65.170 1.00 65.64 C ATOM 11478 CG PRO D1010 22.472 52.563 64.308 1.00 64.62 C ATOM 11479 CD PRO D1010 23.446 53.438 63.554 1.00 65.06 C ATOM 11480 N GLY D1011 22.825 54.997 68.022 1.00 68.67 N ATOM 11481 CA GLY D1011 23.277 54.818 69.397 1.00 69.40 C ATOM 11482 C GLY D1011 22.679 55.776 70.426 1.00 70.01 C ATOM 11483 O GLY D1011 21.455 55.965 70.470 1.00 69.60 O ATOM 11484 N GLN D1012 23.539 56.375 71.257 1.00 69.84 N ATOM 11485 CA GLN D1012 23.081 57.296 72.294 1.00 70.78 C ATOM 11486 C GLN D1012 24.182 58.183 72.876 1.00 69.96 C ATOM 11487 O GLN D1012 25.357 57.797 72.932 1.00 69.65 O ATOM 11488 CB GLN D1012 22.412 56.520 73.432 1.00 71.84 C ATOM 11489 CG GLN D1012 23.331 55.496 74.095 1.00 74.99 C ATOM 11490 CD GLN D1012 22.875 55.117 75.505 1.00 76.69 C ATOM 11491 OE1 GLN D1012 21.745 54.637 75.710 1.00 76.93 O ATOM 11492 NE2 GLN D1012 23.757 55.332 76.487 1.00 76.76 N ATOM 11493 N TRP D1013 23.774 59.373 73.322 1.00 70.20 N ATOM 11494 CA TRP D1013 24.688 60.360 73.902 1.00 69.92 C ATOM 11495 C TRP D1013 24.976 60.038 75.360 1.00 70.25 C ATOM 11496 O TRP D1013 24.302 59.203 75.970 1.00 70.23 O ATOM 11497 CB TRP D1013 24.083 61.781 73.846 1.00 68.30 C ATOM 11498 CG TRP D1013 23.755 62.322 72.473 1.00 66.03 C ATOM 11499 CD1 TRP D1013 22.567 62.184 71.785 1.00 65.50 C ATOM 11500 CD2 TRP D1013 24.620 63.098 71.628 1.00 65.00 C ATOM 11501 NE1 TRP D1013 22.649 62.831 70.567 1.00 64.72 N ATOM 11502 CE2 TRP D1013 23.894 63.397 70.445 1.00 64.25 C ATOM 11503 CE3 TRP D1013 25.938 63.568 71.756 1.00 64.41 C ATOM 11504 CZ2 TRP D1013 24.446 64.150 69.396 1.00 64.27 C ATOM 11505 CZ3 TRP D1013 26.487 64.317 70.715 1.00 63.64 C ATOM 11506 CH2 TRP D1013 25.741 64.601 69.549 1.00 63.20 C ATOM 11507 N LEU D1014 25.966 60.730 75.917 1.00 71.23 N ATOM 11508 CA LEU D1014 26.347 60.556 77.321 1.00 72.70 C ATOM 11509 C LEU D1014 26.428 61.915 78.041 1.00 73.28 C ATOM 11510 O LEU D1014 25.909 62.923 77.535 1.00 73.37 O ATOM 11511 CB LEU D1014 27.696 59.829 77.408 1.00 71.95 C ATOM 11512 CG LEU D1014 27.675 58.352 76.987 1.00 71.19 C ATOM 11513 CD1 LEU D1014 29.102 57.804 77.065 1.00 69.94 C ATOM 11514 CD2 LEU D1014 26.717 57.550 77.891 1.00 69.78 C ATOM 11515 N GLU D1015 27.074 61.936 79.212 1.00 74.30 N ATOM 11516 CA GLU D1015 27.231 63.166 80.006 1.00 75.21 C ATOM 11517 C GLU D1015 27.694 64.347 79.138 1.00 75.98 C ATOM 11518 O GLU D1015 27.778 64.246 77.907 1.00 76.25 O ATOM 11519 CB GLU D1015 28.255 62.966 81.140 1.00 74.96 C ATOM 11520 CG GLU D1015 27.967 61.818 82.124 1.00 75.38 C ATOM 11521 CD GLU D1015 28.766 60.536 81.801 1.00 75.64 C ATOM 11522 OE1 GLU D1015 30.019 60.612 81.711 1.00 75.44 O ATOM 11523 OE2 GLU D1015 28.143 59.456 81.646 1.00 74.79 O ATOM 11524 N ALA D1016 28.001 65.465 79.793 1.00 76.66 N ATOM 11525 CA ALA D1016 28.470 66.674 79.108 1.00 77.22 C ATOM 11526 C ALA D1016 29.022 67.694 80.120 1.00 77.95 C ATOM 11527 O ALA D1016 28.415 67.943 81.174 1.00 78.50 O ATOM 11528 CB ALA D1016 27.324 67.297 78.290 1.00 77.49 C ATOM 11529 N GLU D1017 30.174 68.278 79.794 1.00 78.01 N ATOM 11530 CA GLU D1017 30.822 69.261 80.658 1.00 78.14 C ATOM 11531 C GLU D1017 32.090 69.752 79.962 1.00 78.71 C ATOM 11532 O GLU D1017 32.168 69.632 78.709 1.00 78.81 O ATOM 11533 CB GLU D1017 31.167 68.637 82.037 1.00 77.13 C ATOM 11534 N ARG D1055 30.245 66.364 71.258 1.00 73.61 N ATOM 11535 CA ARG D1055 30.110 65.605 72.545 1.00 74.18 C ATOM 11536 C ARG D1055 30.486 64.107 72.371 1.00 74.03 C ATOM 11537 O ARG D1055 30.797 63.653 71.250 1.00 74.06 O ATOM 11538 CB ARG D1055 28.670 65.753 73.082 1.00 73.22 C ATOM 11539 CG ARG D1055 28.436 65.063 74.426 1.00 73.23 C ATOM 11540 CD ARG D1055 27.192 65.581 75.133 1.00 72.13 C ATOM 11541 NE ARG D1055 26.088 65.758 74.195 1.00 71.49 N ATOM 11542 CZ ARG D1055 24.814 65.583 74.514 1.00 70.99 C ATOM 11543 NH1 ARG D1055 24.484 65.219 75.751 1.00 70.61 N ATOM 11544 NH2 ARG D1055 23.874 65.777 73.595 1.00 71.00 N ATOM 11545 N ARG D1056 30.465 63.351 73.473 1.00 73.34 N ATOM 11546 CA ARG D1056 30.803 61.926 73.429 1.00 72.35 C ATOM 11547 C ARG D1056 29.577 61.001 73.438 1.00 70.93 C ATOM 11548 O ARG D1056 28.639 61.179 74.229 1.00 70.39 O ATOM 11549 CB ARG D1056 31.723 61.558 74.602 1.00 73.86 C ATOM 11550 CG ARG D1056 33.043 62.330 74.664 1.00 75.11 C ATOM 11551 CD ARG D1056 34.090 61.535 75.464 1.00 76.41 C ATOM 11552 NE ARG D1056 33.547 61.017 76.729 1.00 77.49 N ATOM 11553 CZ ARG D1056 34.026 59.959 77.390 1.00 77.56 C ATOM 11554 NH1 ARG D1056 35.074 59.278 76.918 1.00 77.23 N ATOM 11555 NH2 ARG D1056 33.446 59.580 78.529 1.00 77.45 N ATOM 11556 N ILE D1057 29.617 60.003 72.556 1.00 69.98 N ATOM 11557 CA ILE D1057 28.538 59.021 72.417 1.00 68.92 C ATOM 11558 C ILE D1057 28.968 57.557 72.605 1.00 68.05 C ATOM 11559 O ILE D1057 30.158 57.208 72.548 1.00 67.33 O ATOM 11560 CB ILE D1057 27.834 59.190 71.048 1.00 68.67 C ATOM 11561 CG1 ILE D1057 28.804 59.820 70.036 1.00 67.36 C ATOM 11562 CG2 ILE D1057 26.585 60.060 71.214 1.00 68.85 C ATOM 11563 CD1 ILE D1057 28.131 60.346 68.770 1.00 66.02 C ATOM 11564 N PHE D1058 27.988 56.696 72.828 1.00 67.32 N ATOM 11565 CA PHE D1058 28.286 55.294 73.063 1.00 67.12 C ATOM 11566 C PHE D1058 27.742 54.399 71.972 1.00 66.70 C ATOM 11567 O PHE D1058 26.533 54.136 71.908 1.00 66.79 O ATOM 11568 CB PHE D1058 27.714 54.862 74.416 1.00 66.99 C ATOM 11569 CG PHE D1058 27.557 53.375 74.567 1.00 68.24 C ATOM 11570 CD1 PHE D1058 28.677 52.539 74.611 1.00 68.47 C ATOM 11571 CD2 PHE D1058 26.281 52.800 74.649 1.00 68.84 C ATOM 11572 CE1 PHE D1058 28.528 51.136 74.733 1.00 68.94 C ATOM 11573 CE2 PHE D1058 26.119 51.403 74.770 1.00 69.25 C ATOM 11574 CZ PHE D1058 27.243 50.569 74.812 1.00 68.65 C ATOM 11575 N CYS D1059 28.639 53.924 71.114 1.00 65.99 N ATOM 11576 CA CYS D1059 28.231 53.041 70.027 1.00 64.73 C ATOM 11577 C CYS D1059 28.497 51.566 70.386 1.00 63.64 C ATOM 11578 O CYS D1059 29.641 51.107 70.405 1.00 62.75 O ATOM 11579 CB CYS D1059 28.960 53.418 68.728 1.00 63.92 C ATOM 11580 SG CYS D1059 28.344 52.478 67.303 1.00 63.43 S ATOM 11581 N GLN D1060 27.412 50.849 70.657 1.00 62.69 N ATOM 11582 CA GLN D1060 27.456 49.448 71.026 1.00 62.76 C ATOM 11583 C GLN D1060 28.327 48.581 70.106 1.00 62.91 C ATOM 11584 O GLN D1060 29.390 48.087 70.517 1.00 62.88 O ATOM 11585 CB GLN D1060 26.034 48.883 71.094 1.00 62.31 C ATOM 11586 CG GLN D1060 25.970 47.403 71.422 1.00 64.25 C ATOM 11587 CD GLN D1060 24.550 46.901 71.622 1.00 65.98 C ATOM 11588 OE1 GLN D1060 23.636 47.265 70.873 1.00 67.52 O ATOM 11589 NE2 GLN D1060 24.355 46.047 72.633 1.00 66.74 N ATOM 11590 N LEU D1061 27.903 48.411 68.861 1.00 62.13 N ATOM 11591 CA LEU D1061 28.668 47.579 67.938 1.00 61.81 C ATOM 11592 C LEU D1061 30.092 48.100 67.699 1.00 61.50 C ATOM 11593 O LEU D1061 30.990 47.345 67.306 1.00 61.01 O ATOM 11594 CB LEU D1061 27.899 47.405 66.614 1.00 60.07 C ATOM 11595 CG LEU D1061 27.651 48.595 65.697 1.00 58.92 C ATOM 11596 CD1 LEU D1061 28.975 49.097 65.119 1.00 57.64 C ATOM 11597 CD2 LEU D1061 26.713 48.151 64.582 1.00 57.77 C ATOM 11598 N MET D1062 30.315 49.381 67.944 1.00 61.60 N ATOM 11599 CA MET D1062 31.658 49.905 67.751 1.00 62.92 C ATOM 11600 C MET D1062 32.530 49.303 68.860 1.00 63.92 C ATOM 11601 O MET D1062 33.690 48.930 68.631 1.00 64.93 O ATOM 11602 CB MET D1062 31.643 51.431 67.831 1.00 62.47 C ATOM 11603 CG MET D1062 32.869 52.124 67.271 1.00 63.13 C ATOM 11604 SD MET D1062 33.158 51.950 65.469 1.00 65.02 S ATOM 11605 CE MET D1062 31.630 51.227 64.909 1.00 63.66 C ATOM 11606 N HIS D1063 31.955 49.178 70.057 1.00 63.36 N ATOM 11607 CA HIS D1063 32.689 48.629 71.183 1.00 62.58 C ATOM 11608 C HIS D1063 32.920 47.142 71.017 1.00 61.02 C ATOM 11609 O HIS D1063 34.040 46.668 71.245 1.00 61.07 O ATOM 11610 CB HIS D1063 31.968 48.955 72.498 1.00 64.90 C ATOM 11611 CG HIS D1063 32.289 50.328 73.021 1.00 67.90 C ATOM 11612 ND1 HIS D1063 31.592 50.924 74.053 1.00 67.90 N ATOM 11613 CD2 HIS D1063 33.258 51.211 72.664 1.00 68.30 C ATOM 11614 CE1 HIS D1063 32.117 52.111 74.311 1.00 68.22 C ATOM 11615 NE2 HIS D1063 33.128 52.311 73.483 1.00 68.97 N ATOM 11616 N HIS D1064 31.875 46.417 70.610 1.00 58.78 N ATOM 11617 CA HIS D1064 31.961 44.978 70.353 1.00 56.74 C ATOM 11618 C HIS D1064 33.099 44.679 69.380 1.00 55.76 C ATOM 11619 O HIS D1064 33.850 43.715 69.552 1.00 56.99 O ATOM 11620 CB HIS D1064 30.680 44.445 69.717 1.00 56.33 C ATOM 11621 CG HIS D1064 29.503 44.425 70.636 1.00 56.93 C ATOM 11622 ND1 HIS D1064 29.627 44.289 72.000 1.00 57.44 N ATOM 11623 CD2 HIS D1064 28.174 44.428 70.377 1.00 58.32 C ATOM 11624 CE1 HIS D1064 28.426 44.201 72.542 1.00 58.25 C ATOM 11625 NE2 HIS D1064 27.524 44.280 71.579 1.00 58.62 N ATOM 11626 N LEU D1065 33.208 45.503 68.346 1.00 53.19 N ATOM 11627 CA LEU D1065 34.236 45.327 67.344 1.00 51.31 C ATOM 11628 C LEU D1065 35.604 45.316 68.012 1.00 51.56 C ATOM 11629 O LEU D1065 36.453 44.485 67.696 1.00 50.18 O ATOM 11630 CB LEU D1065 34.165 46.462 66.327 1.00 50.44 C ATOM 11631 CG LEU D1065 34.808 46.203 64.964 1.00 49.78 C ATOM 11632 CD1 LEU D1065 34.063 45.076 64.235 1.00 49.85 C ATOM 11633 CD2 LEU D1065 34.760 47.480 64.148 1.00 48.79 C ATOM 11634 N THR D1066 35.811 46.254 68.933 1.00 52.26 N ATOM 11635 CA THR D1066 37.073 46.370 69.653 1.00 52.54 C ATOM 11636 C THR D1066 37.323 45.186 70.582 1.00 53.23 C ATOM 11637 O THR D1066 38.435 44.677 70.670 1.00 51.47 O ATOM 11638 CB THR D1066 37.110 47.654 70.506 1.00 53.01 C ATOM 11639 OG1 THR D1066 37.282 48.789 69.651 1.00 54.32 O ATOM 11640 CG2 THR D1066 38.267 47.611 71.491 1.00 51.91 C ATOM 11641 N GLU D1067 36.278 44.770 71.283 1.00 53.71 N ATOM 11642 CA GLU D1067 36.392 43.674 72.209 1.00 54.92 C ATOM 11643 C GLU D1067 36.722 42.407 71.462 1.00 55.15 C ATOM 11644 O GLU D1067 37.755 41.779 71.714 1.00 55.14 O ATOM 11645 CB GLU D1067 35.089 43.490 72.988 1.00 57.36 C ATOM 11646 CG GLU D1067 34.674 44.710 73.803 1.00 63.19 C ATOM 11647 CD GLU D1067 35.860 45.319 74.559 1.00 68.33 C ATOM 11648 OE1 GLU D1067 36.608 44.543 75.222 1.00 70.50 O ATOM 11649 OE2 GLU D1067 36.050 46.566 74.496 1.00 69.61 O ATOM 11650 N ASN D1068 35.842 42.035 70.537 1.00 54.02 N ATOM 11651 CA ASN D1068 36.026 40.823 69.760 1.00 52.58 C ATOM 11652 C ASN D1068 37.381 40.751 69.069 1.00 52.78 C ATOM 11653 O ASN D1068 37.933 39.666 68.862 1.00 52.55 O ATOM 11654 CB ASN D1068 34.899 40.693 68.759 1.00 51.54 C ATOM 11655 CG ASN D1068 33.582 40.412 69.431 1.00 51.76 C ATOM 11656 OD1 ASN D1068 33.536 39.721 70.460 1.00 51.72 O ATOM 11657 ND2 ASN D1068 32.495 40.926 68.857 1.00 50.88 N ATOM 11658 N HIS D1069 37.932 41.907 68.735 1.00 51.50 N ATOM 11659 CA HIS D1069 39.230 41.935 68.108 1.00 50.48 C ATOM 11660 C HIS D1069 40.275 41.408 69.097 1.00 51.34 C ATOM 11661 O HIS D1069 41.163 40.637 68.720 1.00 51.70 O ATOM 11662 CB HIS D1069 39.570 43.355 67.690 1.00 51.51 C ATOM 11663 CG HIS D1069 40.782 43.453 66.826 1.00 52.61 C ATOM 11664 ND1 HIS D1069 40.846 42.890 65.569 1.00 54.52 N ATOM 11665 CD2 HIS D1069 41.991 44.017 67.046 1.00 54.21 C ATOM 11666 CE1 HIS D1069 42.044 43.101 65.054 1.00 53.75 C ATOM 11667 NE2 HIS D1069 42.758 43.783 65.930 1.00 54.79 N ATOM 11668 N LYS D1070 40.173 41.818 70.361 1.00 50.29 N ATOM 11669 CA LYS D1070 41.131 41.381 71.399 1.00 49.75 C ATOM 11670 C LYS D1070 41.273 39.853 71.513 1.00 47.35 C ATOM 11671 O LYS D1070 42.336 39.355 71.877 1.00 46.33 O ATOM 11672 CB LYS D1070 40.734 41.953 72.768 1.00 52.72 C ATOM 11673 CG LYS D1070 40.891 43.461 72.890 1.00 56.87 C ATOM 11674 CD LYS D1070 40.241 44.015 74.170 1.00 60.81 C ATOM 11675 CE LYS D1070 40.555 45.513 74.356 1.00 61.97 C ATOM 11676 NZ LYS D1070 40.136 46.009 75.704 1.00 62.94 N ATOM 11677 N ILE D1071 40.197 39.127 71.208 1.00 44.12 N ATOM 11678 CA ILE D1071 40.205 37.684 71.260 1.00 40.82 C ATOM 11679 C ILE D1071 41.272 37.091 70.351 1.00 42.45 C ATOM 11680 O ILE D1071 41.907 36.081 70.700 1.00 42.81 O ATOM 11681 CB ILE D1071 38.866 37.082 70.789 1.00 39.02 C ATOM 11682 CG1 ILE D1071 37.713 37.592 71.633 1.00 37.58 C ATOM 11683 CG2 ILE D1071 38.926 35.561 70.851 1.00 35.64 C ATOM 11684 CD1 ILE D1071 36.383 36.973 71.218 1.00 36.16 C ATOM 11685 N TRP D1072 41.464 37.708 69.182 1.00 42.43 N ATOM 11686 CA TRP D1072 42.421 37.188 68.208 1.00 42.23 C ATOM 11687 C TRP D1072 43.716 37.936 67.958 1.00 43.81 C ATOM 11688 O TRP D1072 44.570 37.464 67.204 1.00 43.60 O ATOM 11689 CB TRP D1072 41.739 36.972 66.860 1.00 40.68 C ATOM 11690 CG TRP D1072 40.278 36.674 66.942 1.00 38.99 C ATOM 11691 CD1 TRP D1072 39.252 37.572 66.826 1.00 39.06 C ATOM 11692 CD2 TRP D1072 39.672 35.389 67.100 1.00 38.00 C ATOM 11693 NE1 TRP D1072 38.046 36.923 66.897 1.00 38.60 N ATOM 11694 CE2 TRP D1072 38.269 35.582 67.067 1.00 37.53 C ATOM 11695 CE3 TRP D1072 40.173 34.094 67.265 1.00 35.99 C ATOM 11696 CZ2 TRP D1072 37.361 34.526 67.188 1.00 36.63 C ATOM 11697 CZ3 TRP D1072 39.272 33.043 67.384 1.00 35.61 C ATOM 11698 CH2 TRP D1072 37.880 33.265 67.346 1.00 36.54 C ATOM 11699 N LYS D1073 43.886 39.098 68.557 1.00 46.07 N ATOM 11700 CA LYS D1073 45.126 39.833 68.327 1.00 50.09 C ATOM 11701 C LYS D1073 46.226 39.193 69.191 1.00 51.12 C ATOM 11702 O LYS D1073 47.312 38.850 68.656 1.00 49.38 O ATOM 11703 CB LYS D1073 44.955 41.301 68.717 1.00 52.18 C ATOM 11704 CG LYS D1073 45.986 42.234 68.102 1.00 55.63 C ATOM 11705 CD LYS D1073 45.610 42.623 66.667 1.00 58.84 C ATOM 11706 CE LYS D1073 46.596 43.645 66.084 1.00 60.51 C ATOM 11707 NZ LYS D1073 46.648 44.890 66.910 1.00 60.56 N ATOM 11708 OXT LYS D1073 45.963 39.057 70.413 1.00 53.01 O TER 11709 LYS D1073 HETATM11710 MG MG A 471 55.575 4.022 17.837 1.00 34.73 MG HETATM11711 MG MG A 472 58.294 6.798 18.279 1.00 32.69 MG HETATM11712 MG MG A 479 59.608 17.871 -4.657 1.00 39.12 MG HETATM11713 C9 HG9 A 453 50.888 -3.551 1.182 1.00 42.57 C HETATM11714 C12 HG9 A 453 50.928 -2.328 0.247 1.00 43.84 C HETATM11715 C15 HG9 A 453 51.794 -1.182 0.808 1.00 46.32 C HETATM11716 C18 HG9 A 453 52.544 -0.430 -0.294 1.00 46.87 C HETATM11717 C21 HG9 A 453 51.981 0.969 -0.547 1.00 48.30 C HETATM11718 C24 HG9 A 453 52.724 1.683 -1.685 1.00 47.46 C HETATM11719 C27 HG9 A 453 52.123 3.056 -1.957 1.00 47.91 C HETATM11720 C30 HG9 A 453 52.783 3.827 -3.195 1.00 48.99 C HETATM11721 N33 HG9 A 453 52.253 5.077 -3.532 1.00 51.08 N HETATM11722 O34 HG9 A 453 53.719 3.310 -3.838 1.00 49.28 O HETATM11723 C35 HG9 A 453 52.859 5.728 -4.742 1.00 52.16 C HETATM11724 C36 HG9 A 453 51.132 5.766 -2.791 1.00 54.07 C HETATM11725 C37 HG9 A 453 51.151 6.832 -1.635 1.00 57.92 C HETATM11726 C40 HG9 A 453 50.266 8.086 -1.870 1.00 60.39 C HETATM11727 C41 HG9 A 453 48.730 7.845 -1.707 1.00 63.22 C HETATM11728 C42 HG9 A 453 47.901 9.130 -1.973 1.00 64.75 C HETATM11729 C43 HG9 A 453 46.373 8.951 -1.864 1.00 65.63 C HETATM11730 O44 HG9 A 453 45.779 10.217 -2.138 1.00 66.33 O HETATM11731 O47 HG9 A 453 52.486 7.245 -1.480 1.00 56.50 O HETATM11732 O49 HG9 A 453 50.496 8.522 -3.195 1.00 62.73 O HETATM11733 O51 HG9 A 453 48.439 7.425 -0.367 1.00 62.32 O HETATM11734 O53 HG9 A 453 48.111 9.639 -3.275 1.00 67.62 O HETATM11735 C60 HG9 A 453 54.013 6.697 -4.614 1.00 53.40 C HETATM11736 O63 HG9 A 453 54.324 7.124 -5.919 1.00 57.54 O HETATM11737 C9 HG9 A 454 51.021 -7.253 -0.941 1.00 46.51 C HETATM11738 C12 HG9 A 454 52.159 -7.006 -1.937 1.00 48.83 C HETATM11739 C15 HG9 A 454 52.900 -8.299 -2.295 1.00 49.22 C HETATM11740 C18 HG9 A 454 54.368 -8.048 -2.650 1.00 50.15 C HETATM11741 C21 HG9 A 454 55.200 -9.339 -2.618 1.00 51.25 C HETATM11742 C24 HG9 A 454 56.680 -9.106 -2.961 1.00 53.13 C HETATM11743 C27 HG9 A 454 57.500 -10.418 -2.925 1.00 56.43 C HETATM11744 C30 HG9 A 454 59.055 -10.197 -3.273 1.00 57.54 C HETATM11745 N33 HG9 A 454 59.905 -11.300 -3.295 1.00 60.54 N HETATM11746 O34 HG9 A 454 59.479 -9.064 -3.526 1.00 56.94 O HETATM11747 C35 HG9 A 454 61.336 -10.948 -3.669 1.00 60.27 C HETATM11748 C36 HG9 A 454 59.481 -12.745 -3.017 1.00 62.38 C HETATM11749 C37 HG9 A 454 59.099 -13.908 -4.006 1.00 65.71 C HETATM11750 C40 HG9 A 454 59.271 -15.401 -3.535 1.00 67.29 C HETATM11751 C41 HG9 A 454 58.085 -15.919 -2.649 1.00 70.04 C HETATM11752 C42 HG9 A 454 58.280 -17.386 -2.199 1.00 70.88 C HETATM11753 C43 HG9 A 454 57.152 -17.949 -1.316 1.00 72.78 C HETATM11754 O44 HG9 A 454 57.500 -19.292 -0.992 1.00 74.87 O HETATM11755 O47 HG9 A 454 59.859 -13.707 -5.164 1.00 65.16 O HETATM11756 O49 HG9 A 454 60.469 -15.506 -2.778 1.00 67.39 O HETATM11757 O51 HG9 A 454 56.873 -15.840 -3.397 1.00 71.33 O HETATM11758 O53 HG9 A 454 59.447 -17.538 -1.428 1.00 71.21 O HETATM11759 C60 HG9 A 454 62.497 -11.652 -3.004 1.00 61.23 C HETATM11760 O63 HG9 A 454 63.672 -11.122 -3.569 1.00 64.00 O HETATM11761 C1 666 A 461 64.638 1.781 7.477 1.00 55.22 C HETATM11762 C2 666 A 461 64.433 2.414 8.749 1.00 54.10 C HETATM11763 C3 666 A 461 64.686 1.700 9.998 1.00 53.10 C HETATM11764 C4 666 A 461 65.156 0.326 9.912 1.00 57.45 C HETATM11765 C5 666 A 461 65.374 -0.347 8.608 1.00 60.87 C HETATM11766 C6 666 A 461 65.108 0.405 7.412 1.00 59.87 C HETATM11767 C11 666 A 461 64.464 2.395 11.356 1.00 51.19 C HETATM11768 C12 666 A 461 63.216 3.292 11.369 1.00 49.16 C HETATM11769 C15 666 A 461 61.944 2.897 11.570 1.00 47.00 C HETATM11770 C16 666 A 461 60.949 3.621 12.524 1.00 46.86 C HETATM11771 C17 666 A 461 60.938 5.195 12.273 1.00 47.36 C HETATM11772 C18 666 A 461 62.577 5.644 12.441 1.00 47.43 C HETATM11773 C19 666 A 461 63.650 4.551 12.222 1.00 49.32 C HETATM11774 N26 666 A 461 61.580 1.690 10.775 1.00 43.26 N HETATM11775 C27 666 A 461 60.478 0.921 10.633 1.00 41.19 C HETATM11776 C28 666 A 461 59.432 0.888 11.599 1.00 40.86 C HETATM11777 C29 666 A 461 58.320 0.061 11.453 1.00 37.07 C HETATM11778 C30 666 A 461 58.208 -0.788 10.309 1.00 37.48 C HETATM11779 C31 666 A 461 59.242 -0.772 9.301 1.00 37.96 C HETATM11780 C32 666 A 461 60.382 0.090 9.465 1.00 40.58 C HETATM11781 C37 666 A 461 57.061 -1.694 10.226 1.00 35.71 C HETATM11782 N38 666 A 461 56.959 -2.625 9.207 1.00 35.28 N HETATM11783 N39 666 A 461 56.028 -3.479 9.097 1.00 36.84 N HETATM11784 C40 666 A 461 54.833 -3.474 9.771 1.00 33.89 C HETATM11785 C41 666 A 461 54.620 -2.290 10.739 1.00 33.69 C HETATM11786 C42 666 A 461 55.932 -1.722 11.330 1.00 34.53 C HETATM11787 O45 666 A 461 64.733 4.700 12.705 1.00 51.87 O HETATM11788 O46 666 A 461 54.010 -4.315 9.643 1.00 37.57 O HETATM11789 C47 666 A 461 56.401 -2.590 12.549 1.00 32.18 C HETATM11790 I54 666 A 461 66.077 -2.383 8.497 1.00 73.01 I HETATM11791 MG MG B 473 81.260 23.758 36.034 1.00 23.62 MG HETATM11792 MG MG B 474 77.825 22.586 35.428 1.00 33.40 MG HETATM11793 C9 HG9 B 451 86.973 30.698 52.926 1.00 37.36 C HETATM11794 C12 HG9 B 451 85.722 30.273 53.691 1.00 41.17 C HETATM11795 C15 HG9 B 451 84.443 30.622 52.934 1.00 41.79 C HETATM11796 C18 HG9 B 451 83.241 30.821 53.851 1.00 40.86 C HETATM11797 C21 HG9 B 451 82.309 31.912 53.318 1.00 41.79 C HETATM11798 C24 HG9 B 451 81.084 32.138 54.221 1.00 42.61 C HETATM11799 C27 HG9 B 451 80.157 33.255 53.692 1.00 43.39 C HETATM11800 C30 HG9 B 451 78.917 33.530 54.653 1.00 46.52 C HETATM11801 N33 HG9 B 451 77.990 34.560 54.307 1.00 49.79 N HETATM11802 O34 HG9 B 451 78.789 32.850 55.694 1.00 44.30 O HETATM11803 C35 HG9 B 451 76.854 34.782 55.295 1.00 48.38 C HETATM11804 C36 HG9 B 451 78.059 35.436 53.055 1.00 52.71 C HETATM11805 C37 HG9 B 451 77.248 35.414 51.697 1.00 58.93 C HETATM11806 C40 HG9 B 451 76.657 36.784 51.159 1.00 63.54 C HETATM11807 C41 HG9 B 451 77.740 37.720 50.523 1.00 67.49 C HETATM11808 C42 HG9 B 451 77.214 39.070 49.989 1.00 68.83 C HETATM11809 C43 HG9 B 451 78.328 39.966 49.402 1.00 69.47 C HETATM11810 O44 HG9 B 451 77.727 41.170 48.944 1.00 69.95 O HETATM11811 O47 HG9 B 451 76.199 34.478 51.857 1.00 57.60 O HETATM11812 O49 HG9 B 451 76.072 37.482 52.248 1.00 65.38 O HETATM11813 O51 HG9 B 451 78.325 37.065 49.418 1.00 70.84 O HETATM11814 O53 HG9 B 451 76.620 39.835 51.000 1.00 70.98 O HETATM11815 C60 HG9 B 451 75.842 33.668 55.488 1.00 49.72 C HETATM11816 O63 HG9 B 451 74.889 34.095 56.415 1.00 56.01 O HETATM11817 C9 HG9 B 452 90.010 29.725 56.178 1.00 48.38 C HETATM11818 C12 HG9 B 452 89.307 28.482 56.709 1.00 50.07 C HETATM11819 C15 HG9 B 452 89.271 28.471 58.230 1.00 49.80 C HETATM11820 C18 HG9 B 452 88.239 27.496 58.817 1.00 48.97 C HETATM11821 C21 HG9 B 452 88.833 26.131 59.181 1.00 49.58 C HETATM11822 C24 HG9 B 452 87.765 25.210 59.788 1.00 50.47 C HETATM11823 C27 HG9 B 452 88.323 23.835 60.182 1.00 51.89 C HETATM11824 C30 HG9 B 452 87.218 22.863 60.831 1.00 52.24 C HETATM11825 N33 HG9 B 452 87.619 21.575 61.221 1.00 53.25 N HETATM11826 O34 HG9 B 452 86.048 23.263 60.973 1.00 54.12 O HETATM11827 C35 HG9 B 452 86.544 20.696 61.835 1.00 54.46 C HETATM11828 C36 HG9 B 452 89.013 21.050 61.074 1.00 56.28 C HETATM11829 C37 HG9 B 452 90.207 20.982 62.068 1.00 60.79 C HETATM11830 C40 HG9 B 452 91.142 19.749 61.911 1.00 63.76 C HETATM11831 C41 HG9 B 452 92.496 19.850 62.667 1.00 65.45 C HETATM11832 C42 HG9 B 452 93.344 18.563 62.417 1.00 66.76 C HETATM11833 C43 HG9 B 452 94.710 18.507 63.093 1.00 68.80 C HETATM11834 O44 HG9 B 452 95.287 17.261 62.719 1.00 70.20 O HETATM11835 O47 HG9 B 452 89.665 21.001 63.366 1.00 60.32 O HETATM11836 O49 HG9 B 452 91.420 19.591 60.521 1.00 68.02 O HETATM11837 O51 HG9 B 452 92.219 19.989 64.068 1.00 64.52 O HETATM11838 O53 HG9 B 452 93.659 18.379 61.051 1.00 68.93 O HETATM11839 C60 HG9 B 452 86.994 19.432 62.582 1.00 53.68 C HETATM11840 O63 HG9 B 452 85.871 18.789 63.081 1.00 56.60 O HETATM11841 C1 666 B 462 76.540 18.649 48.357 1.00 50.80 C HETATM11842 C2 666 B 462 76.361 18.677 46.914 1.00 49.90 C HETATM11843 C3 666 B 462 77.145 17.784 46.037 1.00 52.99 C HETATM11844 C4 666 B 462 78.090 16.891 46.674 1.00 58.59 C HETATM11845 C5 666 B 462 78.267 16.860 48.141 1.00 62.35 C HETATM11846 C6 666 B 462 77.491 17.739 48.953 1.00 60.08 C HETATM11847 C11 666 B 462 76.947 17.792 44.499 1.00 49.24 C HETATM11848 C12 666 B 462 76.825 19.205 43.918 1.00 48.77 C HETATM11849 C15 666 B 462 77.826 20.051 43.580 1.00 45.31 C HETATM11850 C16 666 B 462 77.864 20.858 42.253 1.00 47.74 C HETATM11851 C17 666 B 462 76.476 21.585 41.975 1.00 46.68 C HETATM11852 C18 666 B 462 75.326 20.304 42.018 1.00 47.67 C HETATM11853 C19 666 B 462 75.692 19.044 42.827 1.00 48.59 C HETATM11854 N26 666 B 462 78.892 20.140 44.611 1.00 43.87 N HETATM11855 C27 666 B 462 80.073 20.809 44.741 1.00 42.95 C HETATM11856 C28 666 B 462 80.739 21.448 43.652 1.00 41.11 C HETATM11857 C29 666 B 462 81.977 22.077 43.827 1.00 40.61 C HETATM11858 C30 666 B 462 82.610 22.084 45.115 1.00 40.73 C HETATM11859 C31 666 B 462 81.948 21.464 46.229 1.00 39.66 C HETATM11860 C32 666 B 462 80.689 20.829 46.042 1.00 41.46 C HETATM11861 C37 666 B 462 83.947 22.697 45.248 1.00 39.93 C HETATM11862 N38 666 B 462 84.617 22.724 46.462 1.00 40.42 N HETATM11863 N39 666 B 462 85.798 23.205 46.641 1.00 39.35 N HETATM11864 C40 666 B 462 86.483 24.028 45.794 1.00 38.33 C HETATM11865 C41 666 B 462 85.717 24.409 44.498 1.00 39.39 C HETATM11866 C42 666 B 462 84.717 23.299 44.016 1.00 39.77 C HETATM11867 O45 666 B 462 75.131 18.017 42.598 1.00 51.16 O HETATM11868 O46 666 B 462 87.594 24.418 46.012 1.00 37.94 O HETATM11869 C47 666 B 462 85.479 22.156 43.264 1.00 36.45 C HETATM11870 I54 666 B 462 79.653 15.499 49.033 1.00 68.15 I HETATM11871 MG MG C 475 30.189 44.952 16.791 1.00 28.21 MG HETATM11872 MG MG C 476 28.020 44.299 19.721 1.00 37.19 MG HETATM11873 C1 666 C 463 21.022 55.360 17.292 1.00 68.59 C HETATM11874 C2 666 C 463 21.696 54.331 18.049 1.00 65.68 C HETATM11875 C3 666 C 463 22.947 54.594 18.760 1.00 65.76 C HETATM11876 C4 666 C 463 23.482 55.964 18.668 1.00 71.03 C HETATM11877 C5 666 C 463 22.795 57.041 17.892 1.00 74.08 C HETATM11878 C6 666 C 463 21.570 56.698 17.219 1.00 72.60 C HETATM11879 C11 666 C 463 23.674 53.462 19.588 1.00 61.39 C HETATM11880 C12 666 C 463 23.472 52.058 18.956 1.00 57.76 C HETATM11881 C15 666 C 463 24.156 51.543 17.927 1.00 56.15 C HETATM11882 C16 666 C 463 24.708 50.092 17.891 1.00 56.34 C HETATM11883 C17 666 C 463 23.582 49.054 18.299 1.00 55.26 C HETATM11884 C18 666 C 463 23.113 49.578 19.851 1.00 55.00 C HETATM11885 C19 666 C 463 23.320 51.062 20.178 1.00 56.44 C HETATM11886 N26 666 C 463 24.346 52.511 16.823 1.00 53.53 N HETATM11887 C27 666 C 463 24.965 52.500 15.628 1.00 51.74 C HETATM11888 C28 666 C 463 25.810 51.438 15.185 1.00 48.85 C HETATM11889 C29 666 C 463 26.466 51.499 13.953 1.00 47.50 C HETATM11890 C30 666 C 463 26.294 52.651 13.106 1.00 47.51 C HETATM11891 C31 666 C 463 25.433 53.729 13.532 1.00 48.87 C HETATM11892 C32 666 C 463 24.768 53.655 14.790 1.00 50.69 C HETATM11893 C37 666 C 463 27.039 52.727 11.852 1.00 45.22 C HETATM11894 N38 666 C 463 26.710 53.613 10.864 1.00 43.13 N HETATM11895 N39 666 C 463 27.355 53.762 9.770 1.00 41.74 N HETATM11896 C40 666 C 463 28.267 52.914 9.229 1.00 41.59 C HETATM11897 C41 666 C 463 28.515 51.623 10.061 1.00 42.64 C HETATM11898 C42 666 C 463 28.316 51.842 11.602 1.00 42.87 C HETATM11899 O45 666 C 463 23.369 51.397 21.319 1.00 57.72 O HETATM11900 O46 666 C 463 28.852 53.139 8.199 1.00 42.74 O HETATM11901 C47 666 C 463 29.543 52.569 12.230 1.00 39.49 C HETATM11902 I54 666 C 463 23.579 59.036 17.796 1.00 85.50 I HETATM11903 MG MG D 477 26.103 37.621 52.682 1.00 34.58 MG HETATM11904 MG MG D 478 27.032 36.863 49.291 1.00 31.08 MG HETATM11905 C1 666 D 464 39.698 34.732 53.317 1.00 61.98 C HETATM11906 C2 666 D 464 38.628 35.248 52.513 1.00 59.15 C HETATM11907 C3 666 D 464 38.264 36.666 52.523 1.00 61.28 C HETATM11908 C4 666 D 464 39.044 37.538 53.391 1.00 64.19 C HETATM11909 C5 666 D 464 40.159 37.009 54.228 1.00 65.52 C HETATM11910 C6 666 D 464 40.453 35.607 54.165 1.00 65.85 C HETATM11911 C11 666 D 464 37.081 37.180 51.642 1.00 56.57 C HETATM11912 C12 666 D 464 35.945 36.143 51.673 1.00 54.16 C HETATM11913 C15 666 D 464 34.927 36.042 52.566 1.00 53.29 C HETATM11914 C16 666 D 464 33.436 35.764 52.174 1.00 54.10 C HETATM11915 C17 666 D 464 33.300 34.602 51.077 1.00 53.76 C HETATM11916 C18 666 D 464 34.382 35.049 49.829 1.00 53.34 C HETATM11917 C19 666 D 464 35.529 36.020 50.174 1.00 53.98 C HETATM11918 N26 666 D 464 35.374 36.242 53.976 1.00 50.60 N HETATM11919 C27 666 D 464 34.782 36.276 55.207 1.00 49.52 C HETATM11920 C28 666 D 464 33.412 36.614 55.386 1.00 48.52 C HETATM11921 C29 666 D 464 32.829 36.689 56.663 1.00 48.40 C HETATM11922 C30 666 D 464 33.611 36.428 57.838 1.00 47.99 C HETATM11923 C31 666 D 464 35.009 36.075 57.689 1.00 46.76 C HETATM11924 C32 666 D 464 35.594 35.998 56.377 1.00 48.61 C HETATM11925 C37 666 D 464 32.980 36.566 59.163 1.00 47.18 C HETATM11926 N38 666 D 464 33.744 36.493 60.308 1.00 47.58 N HETATM11927 N39 666 D 464 33.315 36.647 61.510 1.00 46.77 N HETATM11928 C40 666 D 464 32.019 36.626 61.928 1.00 46.00 C HETATM11929 C41 666 D 464 30.976 36.380 60.795 1.00 47.61 C HETATM11930 C42 666 D 464 31.445 36.880 59.381 1.00 48.12 C HETATM11931 O45 666 D 464 36.045 36.639 49.310 1.00 57.07 O HETATM11932 O46 666 D 464 31.691 36.790 63.080 1.00 47.47 O HETATM11933 C47 666 D 464 31.208 38.416 59.266 1.00 46.63 C HETATM11934 I54 666 D 464 41.318 38.270 55.488 1.00 82.72 I HETATM11935 O HOH A 11 57.773 4.537 18.567 1.00 30.18 O HETATM11936 O HOH A 12 60.312 5.816 18.803 1.00 26.53 O HETATM11937 O HOH A 13 59.586 8.589 18.171 1.00 23.73 O HETATM11938 O HOH A 14 58.478 6.875 20.589 1.00 31.17 O HETATM11939 O HOH A 15 58.814 5.715 16.362 1.00 26.84 O HETATM11940 O HOH A 16 57.938 3.099 15.408 1.00 57.02 O HETATM11941 O HOH A 51 58.726 16.813 -6.136 1.00 26.05 O HETATM11942 O HOH A 52 57.728 17.618 -3.580 1.00 46.74 O HETATM11943 O HOH A 53 59.845 16.002 -3.617 1.00 33.75 O HETATM11944 O HOH A 54 59.393 19.895 -5.745 1.00 35.81 O HETATM11945 O HOH A 101 68.032 11.357 18.184 1.00 27.96 O HETATM11946 O HOH A 102 53.143 -1.970 14.097 1.00 34.60 O HETATM11947 O HOH A 105 57.301 -17.374 25.377 1.00 35.69 O HETATM11948 O HOH A 106 71.589 -0.163 20.370 1.00 34.86 O HETATM11949 O HOH A 107 47.177 17.931 22.450 1.00 29.15 O HETATM11950 O HOH A 108 63.594 4.182 -1.810 1.00 44.60 O HETATM11951 O HOH A 109 56.944 0.293 34.715 1.00 38.90 O HETATM11952 O HOH A 113 67.642 12.745 6.312 1.00 32.26 O HETATM11953 O HOH A 114 66.809 7.150 16.889 1.00 34.39 O HETATM11954 O HOH A 116 59.602 9.107 7.970 1.00 21.49 O HETATM11955 O HOH A 118 48.811 3.500 -0.152 1.00 33.56 O HETATM11956 O HOH A 119 47.453 16.383 11.931 1.00 41.71 O HETATM11957 O HOH A 126 53.364 9.190 0.667 1.00 30.50 O HETATM11958 O HOH A 128 38.977 0.055 37.572 1.00 52.84 O HETATM11959 O HOH A 130 66.674 7.939 12.867 1.00 38.85 O HETATM11960 O HOH A 131 75.590 14.994 18.141 1.00 47.16 O HETATM11961 O HOH A 133 44.638 9.496 41.345 1.00 39.34 O HETATM11962 O HOH A 135 52.347 19.874 25.353 1.00 33.45 O HETATM11963 O HOH A 137 58.645 -1.763 35.805 1.00 39.39 O HETATM11964 O HOH A 138 66.112 2.618 -3.491 1.00 47.64 O HETATM11965 O HOH A 139 51.111 22.097 26.106 1.00 46.78 O HETATM11966 O HOH A 145 71.449 18.762 15.073 1.00 38.82 O HETATM11967 O HOH A 147 49.368 -3.641 14.720 1.00 66.42 O HETATM11968 O HOH A 148 66.527 5.956 10.706 1.00 52.96 O HETATM11969 O HOH A 150 47.976 -4.744 19.281 1.00 42.86 O HETATM11970 O HOH A 152 44.947 -10.313 34.121 1.00 42.62 O HETATM11971 O HOH A 154 74.994 14.143 20.449 1.00 32.94 O HETATM11972 O HOH A 158 66.423 24.609 19.545 1.00 33.84 O HETATM11973 O HOH A 161 59.809 19.452 23.803 1.00 38.32 O HETATM11974 O HOH A 162 50.733 -11.981 30.520 1.00 40.17 O HETATM11975 O HOH A 164 46.690 19.487 20.426 1.00 44.62 O HETATM11976 O HOH A 165 40.307 -4.278 11.028 1.00 42.25 O HETATM11977 O HOH A 172 40.278 17.505 27.283 1.00 34.18 O HETATM11978 O HOH A 178 49.636 -5.970 38.324 1.00 34.38 O HETATM11979 O HOH A 179 58.928 8.255 10.091 1.00 34.80 O HETATM11980 O HOH A 180 60.550 1.223 19.277 1.00 31.32 O HETATM11981 O HOH A 186 72.740 21.042 20.704 1.00 34.05 O HETATM11982 O HOH A 187 51.227 -0.625 15.095 1.00 44.77 O HETATM11983 O HOH A 192 69.390 13.148 4.304 1.00 53.23 O HETATM11984 O HOH A 196 66.510 5.130 5.649 1.00 37.88 O HETATM11985 O HOH A 198 46.714 -3.868 14.109 1.00 48.25 O HETATM11986 O HOH A 200 64.121 7.740 14.123 1.00 39.45 O HETATM11987 O HOH A 203 68.878 9.220 18.797 1.00 38.76 O HETATM11988 O HOH A 210 47.214 3.964 9.800 1.00 44.47 O HETATM11989 O HOH A 214 69.045 15.416 25.358 1.00 46.08 O HETATM11990 O HOH A 226 60.004 9.943 -1.891 1.00 38.40 O HETATM11991 O HOH A 229 69.414 9.748 24.267 1.00 47.76 O HETATM11992 O HOH A 232 36.850 16.055 28.268 1.00 39.39 O HETATM11993 O HOH A 235 41.144 -6.806 11.122 1.00 43.80 O HETATM11994 O HOH A 236 50.505 -14.056 3.320 1.00 34.61 O HETATM11995 O HOH A 238 65.784 -6.592 -3.564 1.00 56.44 O HETATM11996 O HOH A 239 57.289 17.226 16.742 1.00 44.32 O HETATM11997 O HOH A 244 49.944 12.643 5.498 1.00 50.98 O HETATM11998 O HOH A 245 59.946 -16.421 1.733 1.00 48.19 O HETATM11999 O HOH A 246 51.710 12.434 15.443 1.00 29.83 O HETATM12000 O HOH A 249 54.445 14.848 0.260 1.00 41.61 O HETATM12001 O HOH A 254 66.337 5.996 -1.416 1.00 40.70 O HETATM12002 O HOH A 255 67.501 -7.361 16.956 1.00 38.21 O HETATM12003 O HOH A 257 54.351 14.027 7.228 1.00 45.53 O HETATM12004 O HOH A 259 66.088 9.061 8.082 1.00 32.81 O HETATM12005 O HOH A 260 58.679 18.498 8.542 1.00 41.38 O HETATM12006 O HOH A 262 39.439 13.723 21.611 1.00 42.89 O HETATM12007 O HOH A 263 56.563 17.315 9.367 1.00 42.37 O HETATM12008 O HOH A 264 51.325 19.235 21.191 1.00 34.40 O HETATM12009 O HOH A 268 66.907 -13.369 19.636 1.00 49.26 O HETATM12010 O HOH A 269 56.798 0.723 15.093 1.00 37.84 O HETATM12011 O HOH A 275 66.767 6.356 8.338 1.00 35.16 O HETATM12012 O HOH A 277 58.379 20.175 28.145 1.00 44.58 O HETATM12013 O HOH A 278 68.730 13.414 27.110 1.00 40.62 O HETATM12014 O HOH A 279 68.494 10.917 7.547 1.00 42.18 O HETATM12015 O HOH A 280 62.282 7.654 16.297 1.00 60.98 O HETATM12016 O HOH A 283 41.893 -8.930 12.443 1.00 52.50 O HETATM12017 O HOH A 290 72.217 16.150 -2.624 1.00 43.52 O HETATM12018 O HOH A 292 66.235 -1.936 34.633 1.00 50.98 O HETATM12019 O HOH A 293 63.655 -8.258 -2.021 1.00 50.49 O HETATM12020 O HOH A 298 34.868 11.543 37.612 1.00 53.20 O HETATM12021 O HOH A 301 46.793 5.410 -0.422 1.00 37.33 O HETATM12022 O HOH A 303 36.487 6.562 37.363 1.00 46.22 O HETATM12023 O HOH A 306 71.573 9.719 28.270 1.00 45.91 O HETATM12024 O HOH A 307 70.772 8.649 20.739 1.00 39.25 O HETATM12025 O HOH A 308 67.809 6.319 27.026 1.00 46.77 O HETATM12026 O HOH A 313 62.436 -4.367 -2.863 1.00 48.87 O HETATM12027 O HOH A 316 66.469 7.000 -4.059 1.00 37.29 O HETATM12028 O HOH A 319 44.772 22.290 27.240 1.00 35.23 O HETATM12029 O HOH A 329 56.361 15.906 2.496 1.00 46.20 O HETATM12030 O HOH A 331 74.819 -3.766 21.989 1.00 48.60 O HETATM12031 O HOH A 335 70.167 8.408 26.557 1.00 49.67 O HETATM12032 O HOH A 343 60.506 4.007 15.922 1.00 36.41 O HETATM12033 O HOH A 344 60.061 6.647 15.066 1.00 27.91 O HETATM12034 O HOH A 350 46.100 11.103 14.827 1.00 40.72 O HETATM12035 O HOH A 352 71.340 -7.302 20.779 1.00 53.13 O HETATM12036 O HOH A 355 65.088 0.545 21.429 1.00 38.05 O HETATM12037 O HOH A 358 68.525 10.945 -3.317 1.00 46.20 O HETATM12038 O HOH A 361 53.138 16.783 10.493 1.00 51.10 O HETATM12039 O HOH A 367 64.706 8.400 33.189 1.00 37.82 O HETATM12040 O HOH A 369 66.892 1.385 -0.972 1.00 43.23 O HETATM12041 O HOH A 378 53.830 -11.053 27.545 1.00 45.38 O HETATM12042 O HOH A 379 41.620 -12.465 25.368 1.00 40.32 O HETATM12043 O HOH A 380 36.557 10.427 24.423 1.00 53.04 O HETATM12044 O HOH A 382 45.497 -3.271 18.321 1.00 42.60 O HETATM12045 O HOH A 383 70.490 10.601 14.306 1.00 41.13 O HETATM12046 O HOH A 384 36.635 -6.125 31.189 1.00 38.10 O HETATM12047 O HOH A 388 46.217 -9.915 1.570 1.00 35.94 O HETATM12048 O HOH A 393 69.987 0.368 26.757 1.00 41.75 O HETATM12049 O HOH A 394 63.380 4.866 16.738 1.00 39.41 O HETATM12050 O HOH A 408 45.807 16.689 15.038 1.00 54.06 O HETATM12051 O HOH A 411 72.714 -7.902 17.800 1.00 47.53 O HETATM12052 O HOH A 425 56.932 19.747 -4.675 1.00 47.54 O HETATM12053 O HOH A 428 60.942 -1.409 19.631 1.00 46.77 O HETATM12054 O HOH B 21 79.613 21.906 35.893 1.00 26.44 O HETATM12055 O HOH B 22 77.659 20.126 35.626 1.00 23.06 O HETATM12056 O HOH B 23 75.855 22.232 35.075 1.00 19.92 O HETATM12057 O HOH B 24 77.806 21.490 33.550 1.00 32.13 O HETATM12058 O HOH B 25 80.283 23.156 39.160 1.00 43.79 O HETATM12059 O HOH B 26 77.763 22.482 37.564 1.00 22.35 O HETATM12060 O HOH B 100 68.867 16.321 36.113 1.00 25.59 O HETATM12061 O HOH B 103 76.651 17.873 38.616 1.00 30.54 O HETATM12062 O HOH B 104 74.745 13.164 31.433 1.00 33.43 O HETATM12063 O HOH B 110 96.721 17.517 19.470 1.00 35.09 O HETATM12064 O HOH B 112 92.688 29.186 36.339 1.00 41.15 O HETATM12065 O HOH B 115 73.018 26.118 44.456 1.00 32.57 O HETATM12066 O HOH B 117 79.816 12.893 35.872 1.00 38.43 O HETATM12067 O HOH B 120 82.256 24.066 59.357 1.00 40.15 O HETATM12068 O HOH B 122 67.166 24.240 26.523 1.00 24.23 O HETATM12069 O HOH B 125 87.867 12.775 21.967 1.00 32.97 O HETATM12070 O HOH B 127 86.876 27.328 10.595 1.00 33.57 O HETATM12071 O HOH B 129 65.749 21.148 46.366 1.00 35.31 O HETATM12072 O HOH B 136 92.762 17.127 14.165 1.00 35.64 O HETATM12073 O HOH B 140 71.522 17.464 41.699 1.00 43.32 O HETATM12074 O HOH B 141 80.977 33.484 9.066 1.00 43.54 O HETATM12075 O HOH B 142 73.173 19.032 39.999 1.00 49.20 O HETATM12076 O HOH B 146 75.632 31.411 34.723 1.00 40.10 O HETATM12077 O HOH B 149 83.650 16.166 37.440 1.00 30.59 O HETATM12078 O HOH B 153 78.424 7.112 31.386 1.00 55.07 O HETATM12079 O HOH B 156 73.651 23.690 55.743 1.00 41.44 O HETATM12080 O HOH B 157 74.818 25.250 42.147 1.00 38.77 O HETATM12081 O HOH B 159 81.218 20.806 4.154 1.00 33.18 O HETATM12082 O HOH B 163 77.222 7.820 39.052 1.00 35.58 O HETATM12083 O HOH B 166 72.677 16.148 38.633 1.00 36.93 O HETATM12084 O HOH B 169 70.588 29.496 53.173 1.00 36.47 O HETATM12085 O HOH B 175 81.739 35.579 51.116 1.00 36.01 O HETATM12086 O HOH B 176 86.548 26.474 39.213 1.00 33.61 O HETATM12087 O HOH B 177 76.348 21.914 38.885 1.00 25.27 O HETATM12088 O HOH B 181 58.711 15.460 31.092 1.00 32.84 O HETATM12089 O HOH B 183 84.179 33.238 41.549 1.00 49.79 O HETATM12090 O HOH B 184 67.923 10.650 26.057 1.00 46.20 O HETATM12091 O HOH B 188 86.830 24.745 41.059 1.00 43.94 O HETATM12092 O HOH B 190 69.770 20.176 45.666 1.00 29.15 O HETATM12093 O HOH B 191 83.165 22.123 61.666 1.00 52.19 O HETATM12094 O HOH B 193 86.913 15.262 22.202 1.00 39.37 O HETATM12095 O HOH B 195 87.380 22.250 4.406 1.00 39.43 O HETATM12096 O HOH B 201 81.618 18.227 37.307 1.00 31.39 O HETATM12097 O HOH B 202 84.556 9.515 42.940 1.00 47.32 O HETATM12098 O HOH B 204 85.329 38.387 49.140 1.00 44.26 O HETATM12099 O HOH B 205 81.327 21.122 59.229 1.00 36.93 O HETATM12100 O HOH B 206 101.464 17.680 20.766 1.00 51.35 O HETATM12101 O HOH B 207 71.691 21.797 55.637 1.00 29.67 O HETATM12102 O HOH B 209 76.282 31.724 57.985 1.00 38.24 O HETATM12103 O HOH B 212 86.695 10.537 20.388 1.00 46.96 O HETATM12104 O HOH B 213 85.105 17.537 58.723 1.00 37.16 O HETATM12105 O HOH B 215 80.620 35.086 46.568 1.00 46.14 O HETATM12106 O HOH B 217 94.713 31.316 53.514 1.00 40.19 O HETATM12107 O HOH B 218 82.211 40.297 25.950 1.00 46.82 O HETATM12108 O HOH B 220 68.394 24.967 21.716 1.00 40.13 O HETATM12109 O HOH B 221 64.933 25.689 27.146 1.00 36.06 O HETATM12110 O HOH B 223 78.851 30.264 56.558 1.00 36.47 O HETATM12111 O HOH B 225 70.740 30.591 23.101 1.00 47.22 O HETATM12112 O HOH B 231 86.458 37.595 9.414 1.00 45.47 O HETATM12113 O HOH B 237 82.140 22.372 40.074 1.00 42.50 O HETATM12114 O HOH B 247 102.769 24.342 37.475 1.00 42.71 O HETATM12115 O HOH B 248 71.173 12.054 31.108 1.00 42.92 O HETATM12116 O HOH B 251 99.600 10.218 35.964 1.00 43.94 O HETATM12117 O HOH B 256 74.845 33.813 49.464 1.00 40.15 O HETATM12118 O HOH B 258 72.520 19.144 49.313 1.00 37.58 O HETATM12119 O HOH B 267 69.316 29.086 15.993 1.00 41.38 O HETATM12120 O HOH B 270 58.894 22.721 29.739 1.00 37.84 O HETATM12121 O HOH B 272 73.538 20.252 57.078 1.00 37.84 O HETATM12122 O HOH B 273 96.416 15.041 31.960 1.00 48.46 O HETATM12123 O HOH B 281 92.830 25.816 35.971 1.00 38.03 O HETATM12124 O HOH B 282 84.763 23.112 3.615 1.00 35.68 O HETATM12125 O HOH B 286 99.598 16.279 28.939 1.00 43.90 O HETATM12126 O HOH B 289 82.059 7.542 26.732 1.00 44.25 O HETATM12127 O HOH B 291 63.440 10.641 34.286 1.00 38.52 O HETATM12128 O HOH B 299 68.854 28.055 33.194 1.00 34.75 O HETATM12129 O HOH B 300 73.104 37.882 35.976 1.00 39.80 O HETATM12130 O HOH B 302 80.599 12.920 10.943 1.00 56.21 O HETATM12131 O HOH B 304 89.897 22.188 8.015 1.00 49.51 O HETATM12132 O HOH B 309 80.313 8.142 25.138 1.00 52.71 O HETATM12133 O HOH B 312 75.965 12.678 22.361 1.00 43.04 O HETATM12134 O HOH B 317 96.577 23.519 51.180 1.00 44.98 O HETATM12135 O HOH B 318 70.011 12.048 35.118 1.00 32.38 O HETATM12136 O HOH B 322 81.323 24.009 9.470 1.00 44.49 O HETATM12137 O HOH B 325 76.840 30.786 12.936 1.00 44.64 O HETATM12138 O HOH B 326 74.558 19.634 37.941 1.00 41.71 O HETATM12139 O HOH B 328 80.352 25.742 59.121 1.00 48.97 O HETATM12140 O HOH B 330 115.846 11.764 25.367 1.00 49.07 O HETATM12141 O HOH B 333 64.503 22.700 56.548 1.00 39.67 O HETATM12142 O HOH B 338 65.327 4.694 28.478 1.00 37.48 O HETATM12143 O HOH B 339 61.272 11.847 35.983 1.00 45.43 O HETATM12144 O HOH B 345 78.739 20.557 38.912 1.00 41.68 O HETATM12145 O HOH B 347 74.352 23.214 40.071 1.00 43.14 O HETATM12146 O HOH B 348 79.531 35.108 34.538 1.00 39.42 O HETATM12147 O HOH B 349 74.857 18.486 56.414 1.00 46.88 O HETATM12148 O HOH B 357 99.647 22.717 49.208 1.00 58.34 O HETATM12149 O HOH B 359 106.348 44.486 29.030 1.00 49.71 O HETATM12150 O HOH B 362 72.098 17.651 56.583 1.00 43.49 O HETATM12151 O HOH B 363 75.847 11.157 29.756 1.00 46.56 O HETATM12152 O HOH B 366 70.766 14.344 36.393 1.00 31.87 O HETATM12153 O HOH B 368 94.147 28.520 38.594 1.00 46.27 O HETATM12154 O HOH B 374 87.030 39.710 23.841 1.00 38.03 O HETATM12155 O HOH B 375 78.079 38.979 19.643 1.00 50.78 O HETATM12156 O HOH B 385 80.642 37.788 50.206 1.00 44.88 O HETATM12157 O HOH B 386 113.844 13.634 31.978 1.00 53.96 O HETATM12158 O HOH B 387 103.684 25.112 31.925 1.00 41.50 O HETATM12159 O HOH B 391 78.009 36.487 46.841 1.00 46.20 O HETATM12160 O HOH B 395 97.996 12.046 10.239 1.00 44.14 O HETATM12161 O HOH B 400 70.331 33.237 42.902 1.00 61.25 O HETATM12162 O HOH B 405 60.129 17.323 37.119 1.00 40.88 O HETATM12163 O HOH B 409 81.766 11.311 15.095 1.00 50.48 O HETATM12164 O HOH B 415 64.131 20.343 48.187 1.00 44.57 O HETATM12165 O HOH B 420 62.400 25.416 25.217 1.00 41.79 O HETATM12166 O HOH B 422 66.677 30.748 17.601 1.00 52.24 O HETATM12167 O HOH B 429 60.916 23.602 23.787 1.00 41.67 O HETATM12168 O HOH B 431 73.788 16.299 49.851 1.00 40.17 O HETATM12169 O HOH C 31 29.441 45.060 18.554 1.00 38.83 O HETATM12170 O HOH C 32 28.412 45.644 21.157 1.00 29.50 O HETATM12171 O HOH C 33 26.793 43.658 21.286 1.00 26.81 O HETATM12172 O HOH C 34 29.805 43.190 21.293 1.00 38.93 O HETATM12173 O HOH C 35 27.978 47.425 16.275 1.00 51.75 O HETATM12174 O HOH C 36 26.248 46.216 19.095 1.00 35.69 O HETATM12175 O HOH C 121 32.115 51.475 24.734 1.00 39.91 O HETATM12176 O HOH C 123 16.777 50.845 21.288 1.00 42.85 O HETATM12177 O HOH C 124 50.784 25.767 33.558 1.00 37.03 O HETATM12178 O HOH C 132 48.670 26.870 21.916 1.00 30.91 O HETATM12179 O HOH C 143 47.030 44.400 29.471 1.00 37.80 O HETATM12180 O HOH C 144 36.944 27.299 6.997 1.00 47.80 O HETATM12181 O HOH C 151 47.145 35.035 35.072 1.00 41.11 O HETATM12182 O HOH C 155 45.555 51.429 2.819 1.00 47.76 O HETATM12183 O HOH C 171 16.640 37.225 26.174 1.00 41.60 O HETATM12184 O HOH C 173 33.899 44.865 -1.470 1.00 44.97 O HETATM12185 O HOH C 174 24.478 48.108 28.830 1.00 40.21 O HETATM12186 O HOH C 182 22.339 46.445 18.991 1.00 46.18 O HETATM12187 O HOH C 185 31.989 27.660 9.370 1.00 45.08 O HETATM12188 O HOH C 194 10.202 50.322 11.388 1.00 44.66 O HETATM12189 O HOH C 197 53.254 25.333 29.611 1.00 46.39 O HETATM12190 O HOH C 208 53.290 42.207 18.935 1.00 41.66 O HETATM12191 O HOH C 228 21.442 65.827 8.963 1.00 45.91 O HETATM12192 O HOH C 230 53.262 29.874 24.525 1.00 42.18 O HETATM12193 O HOH C 240 53.703 37.389 24.183 1.00 43.26 O HETATM12194 O HOH C 243 17.223 62.408 8.305 1.00 39.92 O HETATM12195 O HOH C 250 51.191 26.819 11.426 1.00 51.62 O HETATM12196 O HOH C 252 51.056 24.380 28.414 1.00 41.01 O HETATM12197 O HOH C 261 44.419 37.310 34.770 1.00 56.42 O HETATM12198 O HOH C 265 28.939 53.037 -3.441 1.00 41.72 O HETATM12199 O HOH C 271 30.698 46.636 29.534 1.00 50.30 O HETATM12200 O HOH C 274 54.803 32.055 24.796 1.00 46.15 O HETATM12201 O HOH C 276 34.985 58.340 0.733 1.00 54.29 O HETATM12202 O HOH C 287 16.496 59.818 5.377 1.00 42.69 O HETATM12203 O HOH C 288 18.118 46.665 1.338 1.00 52.24 O HETATM12204 O HOH C 294 20.764 50.076 24.266 1.00 51.84 O HETATM12205 O HOH C 295 32.379 60.865 21.848 1.00 41.20 O HETATM12206 O HOH C 296 47.252 22.937 28.160 1.00 35.71 O HETATM12207 O HOH C 305 53.796 44.773 12.473 1.00 40.03 O HETATM12208 O HOH C 310 38.448 23.114 23.783 1.00 39.96 O HETATM12209 O HOH C 311 26.381 35.247 9.853 1.00 39.73 O HETATM12210 O HOH C 314 74.762 34.926 25.395 1.00 53.78 O HETATM12211 O HOH C 315 14.641 58.447 4.232 1.00 40.01 O HETATM12212 O HOH C 321 26.483 48.740 22.001 1.00 52.61 O HETATM12213 O HOH C 324 25.156 67.229 15.605 1.00 51.55 O HETATM12214 O HOH C 327 39.010 42.408 -4.451 1.00 47.38 O HETATM12215 O HOH C 334 21.293 36.593 21.529 1.00 50.26 O HETATM12216 O HOH C 337 38.641 46.774 8.990 1.00 51.12 O HETATM12217 O HOH C 340 9.643 38.915 27.114 1.00 44.18 O HETATM12218 O HOH C 351 46.771 44.700 26.491 1.00 47.44 O HETATM12219 O HOH C 353 29.062 49.244 14.949 1.00 48.44 O HETATM12220 O HOH C 356 42.876 27.228 38.441 1.00 49.76 O HETATM12221 O HOH C 360 45.100 42.756 25.318 1.00 46.98 O HETATM12222 O HOH C 365 27.313 48.104 19.627 1.00 51.81 O HETATM12223 O HOH C 370 17.867 40.414 36.871 1.00 47.50 O HETATM12224 O HOH C 371 22.760 46.394 28.951 1.00 42.97 O HETATM12225 O HOH C 381 30.153 56.245 28.538 1.00 51.32 O HETATM12226 O HOH C 390 50.799 22.333 17.904 1.00 47.66 O HETATM12227 O HOH C 392 45.942 39.687 33.759 1.00 50.37 O HETATM12228 O HOH C 398 48.941 21.981 13.021 1.00 46.26 O HETATM12229 O HOH C 403 39.787 62.986 30.348 1.00 56.17 O HETATM12230 O HOH C 404 17.178 54.897 19.009 1.00 37.20 O HETATM12231 O HOH C 414 5.483 56.469 5.501 1.00 46.85 O HETATM12232 O HOH C 416 39.171 21.616 26.472 1.00 40.74 O HETATM12233 O HOH C 417 50.421 49.846 14.151 1.00 52.34 O HETATM12234 O HOH C 419 44.843 55.025 7.227 1.00 50.28 O HETATM12235 O HOH C 423 16.899 41.291 13.507 1.00 44.11 O HETATM12236 O HOH C 424 36.475 65.265 18.907 1.00 49.64 O HETATM12237 O HOH C 430 27.960 55.521 -4.255 1.00 34.04 O HETATM12238 O HOH C 432 12.719 56.592 12.782 1.00 51.92 O HETATM12239 O HOH D 41 27.078 38.076 50.758 1.00 31.39 O HETATM12240 O HOH D 42 28.569 37.998 48.550 1.00 24.29 O HETATM12241 O HOH D 43 27.591 36.234 47.732 1.00 30.58 O HETATM12242 O HOH D 44 25.754 38.796 48.143 1.00 30.31 O HETATM12243 O HOH D 45 29.089 36.408 53.078 1.00 60.31 O HETATM12244 O HOH D 46 29.238 34.952 49.466 1.00 43.66 O HETATM12245 O HOH D 111 43.976 26.933 56.667 1.00 28.93 O HETATM12246 O HOH D 134 45.867 31.232 63.763 1.00 41.56 O HETATM12247 O HOH D 160 33.984 37.262 40.275 1.00 35.48 O HETATM12248 O HOH D 167 44.183 30.025 65.368 1.00 40.82 O HETATM12249 O HOH D 168 36.808 34.917 45.602 1.00 33.77 O HETATM12250 O HOH D 170 33.513 21.558 57.656 1.00 32.18 O HETATM12251 O HOH D 189 25.292 36.994 59.467 1.00 41.74 O HETATM12252 O HOH D 199 24.001 29.079 61.032 1.00 47.00 O HETATM12253 O HOH D 211 29.541 41.359 51.869 1.00 35.10 O HETATM12254 O HOH D 216 39.630 21.388 54.804 1.00 34.62 O HETATM12255 O HOH D 219 33.416 28.186 51.144 1.00 38.28 O HETATM12256 O HOH D 222 34.361 48.638 41.508 1.00 41.12 O HETATM12257 O HOH D 224 22.391 28.869 50.155 1.00 44.08 O HETATM12258 O HOH D 227 31.327 32.439 49.210 1.00 42.99 O HETATM12259 O HOH D 233 29.906 43.791 42.128 1.00 46.75 O HETATM12260 O HOH D 234 45.963 36.567 65.223 1.00 43.09 O HETATM12261 O HOH D 241 47.594 20.028 55.855 1.00 48.73 O HETATM12262 O HOH D 242 34.965 40.674 39.220 1.00 52.76 O HETATM12263 O HOH D 253 30.439 43.651 52.753 1.00 33.07 O HETATM12264 O HOH D 266 33.359 24.067 40.413 1.00 43.66 O HETATM12265 O HOH D 284 21.812 41.928 62.522 1.00 48.80 O HETATM12266 O HOH D 285 29.439 32.777 73.735 1.00 40.54 O HETATM12267 O HOH D 297 31.652 23.477 64.653 1.00 41.14 O HETATM12268 O HOH D 320 33.809 35.463 46.914 1.00 43.17 O HETATM12269 O HOH D 323 32.036 30.878 51.422 1.00 43.22 O HETATM12270 O HOH D 332 11.760 56.115 54.879 1.00 47.75 O HETATM12271 O HOH D 336 17.996 51.423 48.185 1.00 51.75 O HETATM12272 O HOH D 341 27.793 37.809 59.841 1.00 45.08 O HETATM12273 O HOH D 342 19.182 28.036 54.631 1.00 39.44 O HETATM12274 O HOH D 346 30.598 36.490 50.177 1.00 35.97 O HETATM12275 O HOH D 354 43.165 27.877 64.082 1.00 50.68 O HETATM12276 O HOH D 364 22.364 33.226 37.066 1.00 43.45 O HETATM12277 O HOH D 372 29.155 43.680 32.913 1.00 47.44 O HETATM12278 O HOH D 373 34.587 39.401 41.662 1.00 48.53 O HETATM12279 O HOH D 376 32.234 45.058 48.295 1.00 52.93 O HETATM12280 O HOH D 377 38.988 48.334 54.574 1.00 49.56 O HETATM12281 O HOH D 389 31.005 35.901 47.532 1.00 65.76 O HETATM12282 O HOH D 396 28.710 22.951 50.342 1.00 52.53 O HETATM12283 O HOH D 397 30.748 22.476 44.647 1.00 48.21 O HETATM12284 O HOH D 399 29.766 21.704 64.758 1.00 41.98 O HETATM12285 O HOH D 401 -2.969 39.988 56.363 1.00 46.93 O HETATM12286 O HOH D 402 37.632 46.561 45.839 1.00 53.29 O HETATM12287 O HOH D 406 36.122 30.683 34.693 1.00 37.44 O HETATM12288 O HOH D 407 45.644 26.520 53.592 1.00 51.22 O HETATM12289 O HOH D 410 32.626 38.841 48.648 1.00 46.91 O HETATM12290 O HOH D 412 38.974 30.630 47.345 1.00 38.69 O HETATM12291 O HOH D 413 39.614 27.504 44.441 1.00 47.52 O HETATM12292 O HOH D 418 38.911 36.061 33.732 1.00 44.57 O HETATM12293 O HOH D 421 40.766 18.507 53.377 1.00 52.53 O HETATM12294 O HOH D 426 49.513 31.507 63.051 1.00 49.18 O HETATM12295 O HOH D 427 40.339 30.144 45.328 1.00 32.45 O HETATM12296 O HOH D 433 36.894 38.480 33.453 1.00 45.02 O CONECT 68811710 CONECT 117111710 CONECT 117811711 CONECT 117911710 CONECT 211911710 CONECT 237111712 CONECT 360511791 CONECT 408111791 CONECT 408811792 CONECT 408911791 CONECT 502911791 CONECT 651911871 CONECT 704611871 CONECT 705311872 CONECT 705411871 CONECT 799411871 CONECT 799511871 CONECT 948011903 CONECT 996311903 CONECT 997011904 CONECT 997111903 CONECT1091111903 CONECT1091211903 CONECT11710 688 1171 1179 2119 CONECT1171011935 CONECT11711 1178119351193611937 CONECT117111193811939 CONECT11712 2371119411194211943 CONECT1171211944 CONECT1171311714 CONECT117141171311715 CONECT117151171411716 CONECT117161171511717 CONECT117171171611718 CONECT117181171711719 CONECT117191171811720 CONECT11720117191172111722 CONECT11721117201172311724 CONECT1172211720 CONECT117231172111735 CONECT117241172111725 CONECT11725117241172611731 CONECT11726117251172711732 CONECT11727117261172811733 CONECT11728117271172911734 CONECT117291172811730 CONECT1173011729 CONECT1173111725 CONECT1173211726 CONECT1173311727 CONECT1173411728 CONECT117351172311736 CONECT1173611735 CONECT1173711738 CONECT117381173711739 CONECT117391173811740 CONECT117401173911741 CONECT117411174011742 CONECT117421174111743 CONECT117431174211744 CONECT11744117431174511746 CONECT11745117441174711748 CONECT1174611744 CONECT117471174511759 CONECT117481174511749 CONECT11749117481175011755 CONECT11750117491175111756 CONECT11751117501175211757 CONECT11752117511175311758 CONECT117531175211754 CONECT1175411753 CONECT1175511749 CONECT1175611750 CONECT1175711751 CONECT1175811752 CONECT117591174711760 CONECT1176011759 CONECT117611176211766 CONECT117621176111763 CONECT11763117621176411767 CONECT117641176311765 CONECT11765117641176611790 CONECT117661176111765 CONECT117671176311768 CONECT11768117671176911773 CONECT11769117681177011774 CONECT117701176911771 CONECT117711177011772 CONECT117721177111773 CONECT11773117681177211787 CONECT117741176911775 CONECT11775117741177611780 CONECT117761177511777 CONECT117771177611778 CONECT11778117771177911781 CONECT117791177811780 CONECT117801177511779 CONECT11781117781178211786 CONECT117821178111783 CONECT117831178211784 CONECT11784117831178511788 CONECT117851178411786 CONECT11786117811178511789 CONECT1178711773 CONECT1178811784 CONECT1178911786 CONECT1179011765 CONECT11791 3605 4081 4089 5029 CONECT1179112054 CONECT11792 4088120541205512056 CONECT117921205712059 CONECT1179311794 CONECT117941179311795 CONECT117951179411796 CONECT117961179511797 CONECT117971179611798 CONECT117981179711799 CONECT117991179811800 CONECT11800117991180111802 CONECT11801118001180311804 CONECT1180211800 CONECT118031180111815 CONECT118041180111805 CONECT11805118041180611811 CONECT11806118051180711812 CONECT11807118061180811813 CONECT11808118071180911814 CONECT118091180811810 CONECT1181011809 CONECT1181111805 CONECT1181211806 CONECT1181311807 CONECT1181411808 CONECT118151180311816 CONECT1181611815 CONECT1181711818 CONECT118181181711819 CONECT118191181811820 CONECT118201181911821 CONECT118211182011822 CONECT118221182111823 CONECT118231182211824 CONECT11824118231182511826 CONECT11825118241182711828 CONECT1182611824 CONECT118271182511839 CONECT118281182511829 CONECT11829118281183011835 CONECT11830118291183111836 CONECT11831118301183211837 CONECT11832118311183311838 CONECT118331183211834 CONECT1183411833 CONECT1183511829 CONECT1183611830 CONECT1183711831 CONECT1183811832 CONECT118391182711840 CONECT1184011839 CONECT118411184211846 CONECT118421184111843 CONECT11843118421184411847 CONECT118441184311845 CONECT11845118441184611870 CONECT118461184111845 CONECT118471184311848 CONECT11848118471184911853 CONECT11849118481185011854 CONECT118501184911851 CONECT118511185011852 CONECT118521185111853 CONECT11853118481185211867 CONECT118541184911855 CONECT11855118541185611860 CONECT118561185511857 CONECT118571185611858 CONECT11858118571185911861 CONECT118591185811860 CONECT118601185511859 CONECT11861118581186211866 CONECT118621186111863 CONECT118631186211864 CONECT11864118631186511868 CONECT118651186411866 CONECT11866118611186511869 CONECT1186711853 CONECT1186811864 CONECT1186911866 CONECT1187011845 CONECT11871 6519 7046 7054 7994 CONECT11871 799512169 CONECT11872 7053121691217012171 CONECT118721217212174 CONECT118731187411878 CONECT118741187311875 CONECT11875118741187611879 CONECT118761187511877 CONECT11877118761187811902 CONECT118781187311877 CONECT118791187511880 CONECT11880118791188111885 CONECT11881118801188211886 CONECT118821188111883 CONECT118831188211884 CONECT118841188311885 CONECT11885118801188411899 CONECT118861188111887 CONECT11887118861188811892 CONECT118881188711889 CONECT118891188811890 CONECT11890118891189111893 CONECT118911189011892 CONECT118921188711891 CONECT11893118901189411898 CONECT118941189311895 CONECT118951189411896 CONECT11896118951189711900 CONECT118971189611898 CONECT11898118931189711901 CONECT1189911885 CONECT1190011896 CONECT1190111898 CONECT1190211877 CONECT11903 9480 9963 997110911 CONECT119031091212239 CONECT11904 9970122391224012241 CONECT119041224212244 CONECT119051190611910 CONECT119061190511907 CONECT11907119061190811911 CONECT119081190711909 CONECT11909119081191011934 CONECT119101190511909 CONECT119111190711912 CONECT11912119111191311917 CONECT11913119121191411918 CONECT119141191311915 CONECT119151191411916 CONECT119161191511917 CONECT11917119121191611931 CONECT119181191311919 CONECT11919119181192011924 CONECT119201191911921 CONECT119211192011922 CONECT11922119211192311925 CONECT119231192211924 CONECT119241191911923 CONECT11925119221192611930 CONECT119261192511927 CONECT119271192611928 CONECT11928119271192911932 CONECT119291192811930 CONECT11930119251192911933 CONECT1193111917 CONECT1193211928 CONECT1193311930 CONECT1193411909 CONECT119351171011711 CONECT1193611711 CONECT1193711711 CONECT1193811711 CONECT1193911711 CONECT1194111712 CONECT1194211712 CONECT1194311712 CONECT1194411712 CONECT120541179111792 CONECT1205511792 CONECT1205611792 CONECT1205711792 CONECT1205911792 CONECT121691187111872 CONECT1217011872 CONECT1217111872 CONECT1217211872 CONECT1217411872 CONECT122391190311904 CONECT1224011904 CONECT1224111904 CONECT1224211904 CONECT1224411904 MASTER 768 0 17 88 14 0 43 612292 4 281 132 END