>>1T65:HELIX    9   9 ASN A  848  LYS A  883  1                                  36    
NPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 9 9 ASN A 848 LYS A 883 1 36 ATOM 1467 N ASN A 848 -6.205 16.689 19.013 1.00 46.78 N ATOM 1468 CA ASN A 848 -6.995 15.488 19.268 1.00 46.88 C ATOM 1469 C ASN A 848 -6.076 14.340 19.684 1.00 45.67 C ATOM 1470 O ASN A 848 -5.100 14.036 18.999 1.00 45.55 O ATOM 1471 CB ASN A 848 -7.782 15.099 18.012 1.00 48.49 C ATOM 1472 CG ASN A 848 -8.596 13.834 18.202 1.00 49.89 C ATOM 1473 OD1 ASN A 848 -9.402 13.734 19.127 1.00 51.47 O ATOM 1474 ND2 ASN A 848 -8.393 12.861 17.321 1.00 50.37 N ATOM 1475 N PRO A 849 -6.383 13.683 20.813 1.00 44.43 N ATOM 1476 CA PRO A 849 -5.569 12.569 21.309 1.00 42.85 C ATOM 1477 C PRO A 849 -5.437 11.408 20.327 1.00 41.18 C ATOM 1478 O PRO A 849 -4.365 10.817 20.197 1.00 39.81 O ATOM 1479 CB PRO A 849 -6.288 12.166 22.595 1.00 44.17 C ATOM 1480 CG PRO A 849 -7.720 12.484 22.285 1.00 44.38 C ATOM 1481 CD PRO A 849 -7.601 13.841 21.628 1.00 44.73 C ATOM 1482 N THR A 850 -6.527 11.090 19.636 1.00 39.35 N ATOM 1483 CA THR A 850 -6.530 9.994 18.672 1.00 37.64 C ATOM 1484 C THR A 850 -5.629 10.276 17.476 1.00 35.56 C ATOM 1485 O THR A 850 -4.967 9.371 16.964 1.00 34.35 O ATOM 1486 CB THR A 850 -7.958 9.708 18.159 1.00 38.76 C ATOM 1487 OG1 THR A 850 -8.799 9.356 19.264 1.00 40.76 O ATOM 1488 CG2 THR A 850 -7.947 8.561 17.155 1.00 38.95 C ATOM 1489 N SER A 851 -5.604 11.527 17.027 1.00 33.84 N ATOM 1490 CA SER A 851 -4.772 11.894 15.890 1.00 32.20 C ATOM 1491 C SER A 851 -3.301 11.792 16.273 1.00 29.54 C ATOM 1492 O SER A 851 -2.476 11.343 15.479 1.00 28.56 O ATOM 1493 CB SER A 851 -5.096 13.315 15.419 1.00 33.82 C ATOM 1494 OG SER A 851 -4.856 14.269 16.439 1.00 37.27 O ATOM 1495 N CYS A 852 -2.979 12.206 17.495 1.00 28.15 N ATOM 1496 CA CYS A 852 -1.602 12.146 17.973 1.00 26.22 C ATOM 1497 C CYS A 852 -1.175 10.689 18.124 1.00 25.61 C ATOM 1498 O CYS A 852 -0.078 10.308 17.717 1.00 23.63 O ATOM 1499 CB CYS A 852 -1.469 12.866 19.319 1.00 28.55 C ATOM 1500 SG CYS A 852 -1.790 14.657 19.264 1.00 29.19 S ATOM 1501 N SER A 853 -2.047 9.876 18.712 1.00 23.68 N ATOM 1502 CA SER A 853 -1.749 8.459 18.905 1.00 24.27 C ATOM 1503 C SER A 853 -1.461 7.767 17.577 1.00 22.74 C ATOM 1504 O SER A 853 -0.516 6.986 17.465 1.00 23.26 O ATOM 1505 CB SER A 853 -2.921 7.757 19.600 1.00 25.16 C ATOM 1506 OG SER A 853 -3.061 8.211 20.934 1.00 29.90 O ATOM 1507 N ARG A 854 -2.275 8.058 16.570 1.00 22.44 N ATOM 1508 CA ARG A 854 -2.090 7.444 15.263 1.00 23.46 C ATOM 1509 C ARG A 854 -0.747 7.827 14.646 1.00 21.57 C ATOM 1510 O ARG A 854 -0.090 6.993 14.024 1.00 21.32 O ATOM 1511 CB ARG A 854 -3.220 7.849 14.314 1.00 26.75 C ATOM 1512 CG ARG A 854 -3.254 7.016 13.049 1.00 32.35 C ATOM 1513 CD ARG A 854 -4.333 7.472 12.086 1.00 37.66 C ATOM 1514 NE ARG A 854 -4.406 6.585 10.928 1.00 42.35 N ATOM 1515 CZ ARG A 854 -5.174 6.797 9.865 1.00 43.65 C ATOM 1516 NH1 ARG A 854 -5.944 7.876 9.803 1.00 44.38 N ATOM 1517 NH2 ARG A 854 -5.173 5.927 8.864 1.00 45.13 N ATOM 1518 N ARG A 855 -0.340 9.082 14.822 1.00 19.65 N ATOM 1519 CA ARG A 855 0.933 9.544 14.268 1.00 18.18 C ATOM 1520 C ARG A 855 2.103 8.880 14.994 1.00 17.75 C ATOM 1521 O ARG A 855 3.077 8.476 14.362 1.00 17.21 O ATOM 1522 CB ARG A 855 1.045 11.074 14.368 1.00 19.02 C ATOM 1523 CG ARG A 855 2.239 11.678 13.597 1.00 17.52 C ATOM 1524 CD ARG A 855 2.214 11.247 12.136 1.00 17.35 C ATOM 1525 NE ARG A 855 3.217 11.920 11.312 1.00 16.97 N ATOM 1526 CZ ARG A 855 3.340 11.733 10.001 1.00 16.28 C ATOM 1527 NH1 ARG A 855 2.527 10.892 9.376 1.00 16.88 N ATOM 1528 NH2 ARG A 855 4.261 12.397 9.308 1.00 14.99 N ATOM 1529 N PHE A 856 2.004 8.754 16.316 1.00 17.04 N ATOM 1530 CA PHE A 856 3.072 8.118 17.085 1.00 15.64 C ATOM 1531 C PHE A 856 3.253 6.668 16.623 1.00 16.46 C ATOM 1532 O PHE A 856 4.374 6.173 16.534 1.00 17.03 O ATOM 1533 CB PHE A 856 2.757 8.150 18.587 1.00 16.23 C ATOM 1534 CG PHE A 856 3.906 7.708 19.456 1.00 18.25 C ATOM 1535 CD1 PHE A 856 4.995 8.547 19.666 1.00 19.46 C ATOM 1536 CD2 PHE A 856 3.907 6.447 20.046 1.00 19.29 C ATOM 1537 CE1 PHE A 856 6.074 8.139 20.455 1.00 19.28 C ATOM 1538 CE2 PHE A 856 4.981 6.026 20.837 1.00 18.61 C ATOM 1539 CZ PHE A 856 6.068 6.877 21.041 1.00 18.38 C ATOM 1540 N TYR A 857 2.145 5.988 16.331 1.00 15.75 N ATOM 1541 CA TYR A 857 2.204 4.610 15.856 1.00 17.37 C ATOM 1542 C TYR A 857 2.982 4.551 14.538 1.00 17.50 C ATOM 1543 O TYR A 857 3.872 3.718 14.367 1.00 16.89 O ATOM 1544 CB TYR A 857 0.788 4.061 15.640 1.00 20.06 C ATOM 1545 CG TYR A 857 0.744 2.631 15.141 1.00 20.78 C ATOM 1546 CD1 TYR A 857 0.936 1.559 16.010 1.00 22.84 C ATOM 1547 CD2 TYR A 857 0.513 2.352 13.793 1.00 23.84 C ATOM 1548 CE1 TYR A 857 0.897 0.240 15.551 1.00 26.52 C ATOM 1549 CE2 TYR A 857 0.474 1.041 13.323 1.00 25.33 C ATOM 1550 CZ TYR A 857 0.666 -0.009 14.205 1.00 27.00 C ATOM 1551 OH TYR A 857 0.631 -1.303 13.738 1.00 29.24 O ATOM 1552 N GLN A 858 2.645 5.448 13.613 1.00 17.91 N ATOM 1553 CA GLN A 858 3.301 5.502 12.309 1.00 18.12 C ATOM 1554 C GLN A 858 4.801 5.756 12.418 1.00 17.21 C ATOM 1555 O GLN A 858 5.599 5.070 11.782 1.00 18.06 O ATOM 1556 CB GLN A 858 2.691 6.607 11.440 1.00 19.92 C ATOM 1557 CG GLN A 858 1.223 6.418 11.076 1.00 21.01 C ATOM 1558 CD GLN A 858 0.680 7.604 10.292 1.00 20.74 C ATOM 1559 OE1 GLN A 858 0.771 8.748 10.737 1.00 21.14 O ATOM 1560 NE2 GLN A 858 0.116 7.336 9.120 1.00 25.20 N ATOM 1561 N LEU A 859 5.180 6.744 13.217 1.00 17.70 N ATOM 1562 CA LEU A 859 6.595 7.087 13.367 1.00 15.47 C ATOM 1563 C LEU A 859 7.417 6.029 14.094 1.00 16.52 C ATOM 1564 O LEU A 859 8.581 5.805 13.745 1.00 15.61 O ATOM 1565 CB LEU A 859 6.745 8.448 14.063 1.00 17.00 C ATOM 1566 CG LEU A 859 6.066 9.652 13.389 1.00 16.25 C ATOM 1567 CD1 LEU A 859 6.514 10.931 14.070 1.00 19.62 C ATOM 1568 CD2 LEU A 859 6.422 9.705 11.911 1.00 19.19 C ATOM 1569 N THR A 860 6.838 5.373 15.099 1.00 15.39 N ATOM 1570 CA THR A 860 7.589 4.337 15.806 1.00 16.04 C ATOM 1571 C THR A 860 7.771 3.116 14.904 1.00 15.27 C ATOM 1572 O THR A 860 8.777 2.420 14.997 1.00 14.77 O ATOM 1573 CB THR A 860 6.906 3.918 17.139 1.00 16.12 C ATOM 1574 OG1 THR A 860 5.529 3.608 16.909 1.00 18.67 O ATOM 1575 CG2 THR A 860 7.007 5.036 18.160 1.00 17.36 C ATOM 1576 N LYS A 861 6.802 2.854 14.029 1.00 16.43 N ATOM 1577 CA LYS A 861 6.924 1.731 13.105 1.00 16.82 C ATOM 1578 C LYS A 861 8.053 2.019 12.117 1.00 15.89 C ATOM 1579 O LYS A 861 8.833 1.128 11.777 1.00 16.59 O ATOM 1580 CB LYS A 861 5.617 1.513 12.333 1.00 17.70 C ATOM 1581 CG LYS A 861 4.568 0.708 13.090 1.00 17.67 C ATOM 1582 CD LYS A 861 5.010 -0.736 13.245 1.00 22.04 C ATOM 1583 CE LYS A 861 3.978 -1.568 13.989 1.00 25.61 C ATOM 1584 NZ LYS A 861 4.398 -2.998 14.080 1.00 29.75 N ATOM 1585 N LEU A 862 8.137 3.265 11.661 1.00 16.84 N ATOM 1586 CA LEU A 862 9.178 3.657 10.712 1.00 18.12 C ATOM 1587 C LEU A 862 10.552 3.534 11.366 1.00 17.17 C ATOM 1588 O LEU A 862 11.498 3.029 10.755 1.00 18.03 O ATOM 1589 CB LEU A 862 8.953 5.095 10.230 1.00 18.91 C ATOM 1590 CG LEU A 862 9.928 5.589 9.152 1.00 21.21 C ATOM 1591 CD1 LEU A 862 9.787 4.734 7.903 1.00 22.41 C ATOM 1592 CD2 LEU A 862 9.651 7.043 8.833 1.00 22.00 C ATOM 1593 N LEU A 863 10.661 3.985 12.613 1.00 17.15 N ATOM 1594 CA LEU A 863 11.932 3.899 13.333 1.00 17.05 C ATOM 1595 C LEU A 863 12.371 2.447 13.520 1.00 16.31 C ATOM 1596 O LEU A 863 13.550 2.123 13.357 1.00 15.84 O ATOM 1597 CB LEU A 863 11.829 4.592 14.697 1.00 15.74 C ATOM 1598 CG LEU A 863 11.925 6.125 14.701 1.00 17.66 C ATOM 1599 CD1 LEU A 863 11.489 6.675 16.052 1.00 17.46 C ATOM 1600 CD2 LEU A 863 13.357 6.546 14.388 1.00 16.62 C ATOM 1601 N ASP A 864 11.436 1.571 13.875 1.00 16.25 N ATOM 1602 CA ASP A 864 11.772 0.161 14.058 1.00 16.30 C ATOM 1603 C ASP A 864 12.289 -0.439 12.751 1.00 17.03 C ATOM 1604 O ASP A 864 13.197 -1.276 12.763 1.00 17.07 O ATOM 1605 CB ASP A 864 10.546 -0.660 14.494 1.00 15.64 C ATOM 1606 CG ASP A 864 10.230 -0.535 15.978 1.00 17.97 C ATOM 1607 OD1 ASP A 864 11.000 0.095 16.731 1.00 16.92 O ATOM 1608 OD2 ASP A 864 9.192 -1.097 16.393 1.00 19.90 O ATOM 1609 N SER A 865 11.711 -0.009 11.629 1.00 15.84 N ATOM 1610 CA SER A 865 12.084 -0.551 10.322 1.00 16.31 C ATOM 1611 C SER A 865 13.542 -0.316 9.936 1.00 16.17 C ATOM 1612 O SER A 865 14.088 -1.032 9.096 1.00 17.83 O ATOM 1613 CB SER A 865 11.158 -0.005 9.221 1.00 15.99 C ATOM 1614 OG SER A 865 11.495 1.318 8.848 1.00 20.03 O ATOM 1615 N VAL A 866 14.170 0.682 10.545 1.00 16.07 N ATOM 1616 CA VAL A 866 15.570 0.983 10.256 1.00 14.77 C ATOM 1617 C VAL A 866 16.496 -0.111 10.796 1.00 16.79 C ATOM 1618 O VAL A 866 17.499 -0.460 10.166 1.00 15.94 O ATOM 1619 CB VAL A 866 15.991 2.334 10.898 1.00 15.93 C ATOM 1620 CG1 VAL A 866 17.485 2.573 10.693 1.00 15.50 C ATOM 1621 CG2 VAL A 866 15.184 3.476 10.299 1.00 15.80 C ATOM 1622 N GLN A 867 16.148 -0.664 11.956 1.00 16.17 N ATOM 1623 CA GLN A 867 16.984 -1.678 12.601 1.00 17.17 C ATOM 1624 C GLN A 867 17.289 -2.956 11.804 1.00 16.44 C ATOM 1625 O GLN A 867 18.438 -3.383 11.744 1.00 17.16 O ATOM 1626 CB GLN A 867 16.401 -2.032 13.975 1.00 17.29 C ATOM 1627 CG GLN A 867 16.261 -0.842 14.940 1.00 17.62 C ATOM 1628 CD GLN A 867 17.569 -0.108 15.214 1.00 17.74 C ATOM 1629 OE1 GLN A 867 18.658 -0.663 15.053 1.00 18.61 O ATOM 1630 NE2 GLN A 867 17.463 1.142 15.651 1.00 19.62 N ATOM 1631 N PRO A 868 16.273 -3.596 11.200 1.00 16.09 N ATOM 1632 CA PRO A 868 16.583 -4.812 10.437 1.00 17.26 C ATOM 1633 C PRO A 868 17.493 -4.516 9.244 1.00 16.84 C ATOM 1634 O PRO A 868 18.325 -5.344 8.863 1.00 16.32 O ATOM 1635 CB PRO A 868 15.206 -5.309 10.006 1.00 19.58 C ATOM 1636 CG PRO A 868 14.327 -4.859 11.135 1.00 19.00 C ATOM 1637 CD PRO A 868 14.817 -3.451 11.380 1.00 17.22 C ATOM 1638 N ILE A 869 17.326 -3.334 8.654 1.00 17.10 N ATOM 1639 CA ILE A 869 18.142 -2.928 7.515 1.00 16.22 C ATOM 1640 C ILE A 869 19.587 -2.748 7.972 1.00 15.96 C ATOM 1641 O ILE A 869 20.512 -3.252 7.338 1.00 18.13 O ATOM 1642 CB ILE A 869 17.621 -1.611 6.896 1.00 18.86 C ATOM 1643 CG1 ILE A 869 16.213 -1.837 6.329 1.00 19.68 C ATOM 1644 CG2 ILE A 869 18.573 -1.137 5.794 1.00 20.64 C ATOM 1645 CD1 ILE A 869 15.558 -0.597 5.774 1.00 20.42 C ATOM 1646 N ALA A 870 19.774 -2.047 9.087 1.00 16.78 N ATOM 1647 CA ALA A 870 21.112 -1.825 9.631 1.00 15.87 C ATOM 1648 C ALA A 870 21.789 -3.162 9.958 1.00 16.08 C ATOM 1649 O ALA A 870 22.989 -3.323 9.753 1.00 17.04 O ATOM 1650 CB ALA A 870 21.031 -0.960 10.883 1.00 16.12 C ATOM 1651 N ARG A 871 21.016 -4.122 10.463 1.00 16.92 N ATOM 1652 CA ARG A 871 21.565 -5.437 10.804 1.00 17.20 C ATOM 1653 C ARG A 871 22.107 -6.162 9.568 1.00 16.67 C ATOM 1654 O ARG A 871 23.173 -6.782 9.616 1.00 16.46 O ATOM 1655 CB ARG A 871 20.491 -6.297 11.490 1.00 19.97 C ATOM 1656 CG ARG A 871 20.939 -7.721 11.827 1.00 24.00 C ATOM 1657 CD ARG A 871 22.171 -7.738 12.725 1.00 28.30 C ATOM 1658 NE ARG A 871 22.613 -9.097 13.046 1.00 31.80 N ATOM 1659 CZ ARG A 871 22.072 -9.866 13.987 1.00 31.99 C ATOM 1660 NH1 ARG A 871 21.062 -9.419 14.720 1.00 32.25 N ATOM 1661 NH2 ARG A 871 22.539 -11.092 14.191 1.00 33.20 N ATOM 1662 N GLU A 872 21.380 -6.086 8.459 1.00 16.86 N ATOM 1663 CA GLU A 872 21.830 -6.734 7.229 1.00 17.67 C ATOM 1664 C GLU A 872 23.118 -6.100 6.718 1.00 17.25 C ATOM 1665 O GLU A 872 23.998 -6.797 6.200 1.00 16.75 O ATOM 1666 CB GLU A 872 20.758 -6.646 6.143 1.00 19.77 C ATOM 1667 CG GLU A 872 19.647 -7.660 6.287 1.00 25.29 C ATOM 1668 CD GLU A 872 18.751 -7.701 5.068 1.00 30.34 C ATOM 1669 OE1 GLU A 872 19.277 -7.856 3.947 1.00 32.09 O ATOM 1670 OE2 GLU A 872 17.520 -7.585 5.227 1.00 35.54 O ATOM 1671 N LEU A 873 23.226 -4.780 6.859 1.00 15.37 N ATOM 1672 CA LEU A 873 24.417 -4.067 6.411 1.00 15.11 C ATOM 1673 C LEU A 873 25.580 -4.378 7.349 1.00 14.90 C ATOM 1674 O LEU A 873 26.727 -4.461 6.913 1.00 14.90 O ATOM 1675 CB LEU A 873 24.145 -2.558 6.350 1.00 14.84 C ATOM 1676 CG LEU A 873 23.128 -2.144 5.272 1.00 14.13 C ATOM 1677 CD1 LEU A 873 22.727 -0.683 5.439 1.00 14.13 C ATOM 1678 CD2 LEU A 873 23.740 -2.392 3.888 1.00 14.51 C ATOM 1679 N HIS A 874 25.281 -4.547 8.634 1.00 15.03 N ATOM 1680 CA HIS A 874 26.309 -4.899 9.609 1.00 16.22 C ATOM 1681 C HIS A 874 26.931 -6.237 9.204 1.00 15.37 C ATOM 1682 O HIS A 874 28.152 -6.397 9.230 1.00 14.96 O ATOM 1683 CB HIS A 874 25.701 -5.022 11.012 1.00 15.61 C ATOM 1684 CG HIS A 874 25.512 -3.712 11.712 1.00 16.76 C ATOM 1685 ND1 HIS A 874 24.481 -3.487 12.600 1.00 19.90 N ATOM 1686 CD2 HIS A 874 26.235 -2.568 11.679 1.00 19.01 C ATOM 1687 CE1 HIS A 874 24.576 -2.260 13.081 1.00 20.65 C ATOM 1688 NE2 HIS A 874 25.632 -1.681 12.539 1.00 18.63 N ATOM 1689 N GLN A 875 26.086 -7.194 8.828 1.00 15.18 N ATOM 1690 CA GLN A 875 26.562 -8.516 8.413 1.00 16.27 C ATOM 1691 C GLN A 875 27.379 -8.418 7.128 1.00 15.07 C ATOM 1692 O GLN A 875 28.429 -9.039 6.997 1.00 15.25 O ATOM 1693 CB GLN A 875 25.382 -9.465 8.179 1.00 19.01 C ATOM 1694 CG GLN A 875 25.809 -10.901 7.893 1.00 22.12 C ATOM 1695 CD GLN A 875 26.477 -11.548 9.090 1.00 25.73 C ATOM 1696 OE1 GLN A 875 25.841 -11.771 10.122 1.00 28.21 O ATOM 1697 NE2 GLN A 875 27.769 -11.845 8.964 1.00 24.02 N ATOM 1698 N PHE A 876 26.890 -7.625 6.181 1.00 14.41 N ATOM 1699 CA PHE A 876 27.570 -7.453 4.902 1.00 14.90 C ATOM 1700 C PHE A 876 28.947 -6.809 5.032 1.00 14.21 C ATOM 1701 O PHE A 876 29.924 -7.299 4.452 1.00 14.48 O ATOM 1702 CB PHE A 876 26.695 -6.620 3.954 1.00 16.85 C ATOM 1703 CG PHE A 876 27.246 -6.503 2.557 1.00 17.23 C ATOM 1704 CD1 PHE A 876 27.983 -5.384 2.174 1.00 19.78 C ATOM 1705 CD2 PHE A 876 27.038 -7.518 1.627 1.00 21.00 C ATOM 1706 CE1 PHE A 876 28.504 -5.280 0.881 1.00 19.24 C ATOM 1707 CE2 PHE A 876 27.555 -7.425 0.333 1.00 20.39 C ATOM 1708 CZ PHE A 876 28.290 -6.302 -0.040 1.00 18.22 C ATOM 1709 N THR A 877 29.037 -5.714 5.784 1.00 12.73 N ATOM 1710 CA THR A 877 30.323 -5.040 5.924 1.00 13.33 C ATOM 1711 C THR A 877 31.294 -5.896 6.737 1.00 13.94 C ATOM 1712 O THR A 877 32.494 -5.879 6.477 1.00 13.61 O ATOM 1713 CB THR A 877 30.162 -3.618 6.545 1.00 13.92 C ATOM 1714 OG1 THR A 877 31.367 -2.863 6.330 1.00 14.91 O ATOM 1715 CG2 THR A 877 29.858 -3.693 8.036 1.00 14.29 C ATOM 1716 N PHE A 878 30.780 -6.658 7.703 1.00 14.23 N ATOM 1717 CA PHE A 878 31.646 -7.534 8.509 1.00 15.38 C ATOM 1718 C PHE A 878 32.290 -8.579 7.595 1.00 15.63 C ATOM 1719 O PHE A 878 33.501 -8.766 7.615 1.00 15.44 O ATOM 1720 CB PHE A 878 30.843 -8.256 9.598 1.00 15.41 C ATOM 1721 CG PHE A 878 31.618 -9.347 10.307 1.00 15.86 C ATOM 1722 CD1 PHE A 878 32.564 -9.034 11.281 1.00 16.36 C ATOM 1723 CD2 PHE A 878 31.414 -10.686 9.980 1.00 16.16 C ATOM 1724 CE1 PHE A 878 33.300 -10.045 11.920 1.00 16.26 C ATOM 1725 CE2 PHE A 878 32.145 -11.703 10.612 1.00 17.51 C ATOM 1726 CZ PHE A 878 33.087 -11.377 11.582 1.00 16.14 C ATOM 1727 N ASP A 879 31.472 -9.267 6.800 1.00 16.21 N ATOM 1728 CA ASP A 879 31.992 -10.277 5.881 1.00 17.64 C ATOM 1729 C ASP A 879 32.982 -9.661 4.893 1.00 17.05 C ATOM 1730 O ASP A 879 33.999 -10.280 4.551 1.00 16.10 O ATOM 1731 CB ASP A 879 30.853 -10.944 5.098 1.00 20.22 C ATOM 1732 CG ASP A 879 29.914 -11.738 5.985 1.00 24.44 C ATOM 1733 OD1 ASP A 879 30.326 -12.136 7.095 1.00 26.81 O ATOM 1734 OD2 ASP A 879 28.764 -11.981 5.562 1.00 24.83 O ATOM 1735 N LEU A 880 32.688 -8.444 4.437 1.00 15.14 N ATOM 1736 CA LEU A 880 33.557 -7.762 3.480 1.00 15.32 C ATOM 1737 C LEU A 880 34.919 -7.433 4.083 1.00 15.51 C ATOM 1738 O LEU A 880 35.943 -7.580 3.417 1.00 16.54 O ATOM 1739 CB LEU A 880 32.888 -6.476 2.967 1.00 16.51 C ATOM 1740 CG LEU A 880 33.655 -5.666 1.915 1.00 17.53 C ATOM 1741 CD1 LEU A 880 34.008 -6.549 0.732 1.00 18.13 C ATOM 1742 CD2 LEU A 880 32.802 -4.477 1.463 1.00 18.46 C ATOM 1743 N LEU A 881 34.938 -6.997 5.341 1.00 14.58 N ATOM 1744 CA LEU A 881 36.202 -6.672 5.996 1.00 14.86 C ATOM 1745 C LEU A 881 37.069 -7.924 6.113 1.00 15.07 C ATOM 1746 O LEU A 881 38.279 -7.878 5.867 1.00 15.74 O ATOM 1747 CB LEU A 881 35.955 -6.087 7.395 1.00 15.58 C ATOM 1748 CG LEU A 881 37.213 -5.797 8.227 1.00 17.36 C ATOM 1749 CD1 LEU A 881 38.075 -4.773 7.516 1.00 18.49 C ATOM 1750 CD2 LEU A 881 36.824 -5.306 9.611 1.00 18.91 C ATOM 1751 N ILE A 882 36.447 -9.041 6.488 1.00 16.21 N ATOM 1752 CA ILE A 882 37.165 -10.303 6.651 1.00 18.96 C ATOM 1753 C ILE A 882 37.825 -10.770 5.351 1.00 20.93 C ATOM 1754 O ILE A 882 38.916 -11.343 5.372 1.00 22.40 O ATOM 1755 CB ILE A 882 36.220 -11.417 7.181 1.00 19.53 C ATOM 1756 CG1 ILE A 882 35.715 -11.056 8.584 1.00 18.98 C ATOM 1757 CG2 ILE A 882 36.942 -12.761 7.203 1.00 20.44 C ATOM 1758 CD1 ILE A 882 36.809 -10.864 9.628 1.00 20.28 C ATOM 1759 N LYS A 883 37.178 -10.509 4.219 1.00 22.16 N ATOM 1760 CA LYS A 883 37.729 -10.922 2.930 1.00 24.72 C ATOM 1761 C LYS A 883 38.174 -9.741 2.071 1.00 24.79 C ATOM 1762 O LYS A 883 38.382 -9.893 0.869 1.00 24.93 O ATOM 1763 CB LYS A 883 36.691 -11.742 2.160 1.00 26.53 C ATOM 1764 CG LYS A 883 35.447 -10.962 1.780 1.00 28.87 C ATOM 1765 CD LYS A 883 34.425 -11.845 1.077 1.00 31.65 C ATOM 1766 CE LYS A 883 33.177 -11.054 0.722 1.00 33.79 C ATOM 1767 NZ LYS A 883 32.147 -11.904 0.065 1.00 36.09 N