>>1VOM:HELIX   20  20 VAL A  411  LEU A  441  1                                  31    
VEKSSSSRDALVKALYGRLFLWLVKKINNVL
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 20 20 VAL A 411 LEU A 441 1 31 ATOM 3201 N VAL A 411 47.670 55.024 -57.125 1.00 26.42 N ATOM 3202 CA VAL A 411 47.754 55.373 -55.739 1.00 29.86 C ATOM 3203 C VAL A 411 48.416 54.260 -54.913 1.00 24.68 C ATOM 3204 O VAL A 411 49.369 54.485 -54.156 1.00 22.31 O ATOM 3205 CB VAL A 411 46.366 55.704 -55.230 1.00 23.74 C ATOM 3206 CG1 VAL A 411 46.503 55.752 -53.718 1.00 27.57 C ATOM 3207 CG2 VAL A 411 45.954 57.072 -55.768 1.00 18.48 C ATOM 3208 N GLU A 412 47.932 53.031 -55.070 1.00 24.44 N ATOM 3209 CA GLU A 412 48.480 51.892 -54.348 1.00 21.01 C ATOM 3210 C GLU A 412 49.968 51.661 -54.621 1.00 64.30 C ATOM 3211 O GLU A 412 50.746 51.539 -53.684 1.00 24.51 O ATOM 3212 CB GLU A 412 47.565 50.642 -54.494 1.00 20.11 C ATOM 3213 CG GLU A 412 48.151 49.336 -53.887 1.00 55.99 C ATOM 3214 CD GLU A 412 47.380 48.040 -54.112 1.00100.00 C ATOM 3215 OE1 GLU A 412 46.212 47.978 -54.459 1.00100.00 O ATOM 3216 OE2 GLU A 412 48.097 46.963 -53.866 1.00100.00 O ATOM 3217 N LYS A 413 50.410 51.614 -55.877 1.00 18.45 N ATOM 3218 CA LYS A 413 51.798 51.405 -56.174 1.00 16.47 C ATOM 3219 C LYS A 413 52.681 52.555 -55.752 1.00 12.18 C ATOM 3220 O LYS A 413 53.840 52.346 -55.369 1.00 16.14 O ATOM 3221 CB LYS A 413 52.012 51.116 -57.660 1.00 17.55 C ATOM 3222 CG LYS A 413 51.134 49.948 -58.069 1.00 23.88 C ATOM 3223 CD LYS A 413 51.595 49.378 -59.392 1.00 37.28 C ATOM 3224 CE LYS A 413 50.773 48.162 -59.775 1.00 59.84 C ATOM 3225 NZ LYS A 413 51.511 47.241 -60.650 1.00100.00 N ATOM 3226 N SER A 414 52.167 53.776 -55.874 1.00 14.94 N ATOM 3227 CA SER A 414 52.983 54.926 -55.483 1.00 26.34 C ATOM 3228 C SER A 414 53.266 54.893 -53.967 1.00 23.10 C ATOM 3229 O SER A 414 54.372 55.172 -53.509 1.00 20.56 O ATOM 3230 CB SER A 414 52.375 56.286 -55.836 1.00 21.16 C ATOM 3231 OG SER A 414 51.940 56.392 -57.173 1.00 21.87 O ATOM 3232 N SER A 415 52.247 54.540 -53.183 1.00 24.57 N ATOM 3233 CA SER A 415 52.390 54.462 -51.723 1.00 16.15 C ATOM 3234 C SER A 415 53.394 53.378 -51.335 1.00 10.16 C ATOM 3235 O SER A 415 54.295 53.585 -50.520 1.00 21.11 O ATOM 3236 CB SER A 415 51.015 54.164 -51.154 1.00 23.51 C ATOM 3237 OG SER A 415 51.117 53.954 -49.761 1.00 32.42 O ATOM 3238 N SER A 416 53.240 52.201 -52.000 1.00 19.04 N ATOM 3239 CA SER A 416 54.119 51.064 -51.793 1.00 14.95 C ATOM 3240 C SER A 416 55.552 51.428 -52.088 1.00 20.44 C ATOM 3241 O SER A 416 56.494 50.964 -51.408 1.00 19.35 O ATOM 3242 CB SER A 416 53.711 49.810 -52.553 1.00 18.04 C ATOM 3243 OG SER A 416 52.808 49.015 -51.814 1.00 96.66 O ATOM 3244 N SER A 417 55.711 52.270 -53.141 1.00 21.25 N ATOM 3245 CA SER A 417 57.053 52.697 -53.553 1.00 15.19 C ATOM 3246 C SER A 417 57.644 53.668 -52.535 1.00 8.04 C ATOM 3247 O SER A 417 58.833 53.567 -52.215 1.00 13.77 O ATOM 3248 CB SER A 417 57.085 53.230 -54.998 1.00 14.13 C ATOM 3249 OG SER A 417 58.408 53.498 -55.417 1.00 17.61 O ATOM 3250 N ARG A 418 56.802 54.624 -52.091 1.00 15.63 N ATOM 3251 CA ARG A 418 57.260 55.599 -51.084 1.00 12.97 C ATOM 3252 C ARG A 418 57.683 54.726 -49.866 1.00 8.66 C ATOM 3253 O ARG A 418 58.757 54.952 -49.316 1.00 13.29 O ATOM 3254 CB ARG A 418 56.102 56.564 -50.781 1.00 16.30 C ATOM 3255 CG ARG A 418 56.323 57.441 -49.538 1.00 23.21 C ATOM 3256 CD ARG A 418 55.825 56.812 -48.213 1.00 17.05 C ATOM 3257 NE ARG A 418 54.492 56.254 -48.347 1.00 12.47 N ATOM 3258 CZ ARG A 418 53.437 57.059 -48.324 1.00 12.44 C ATOM 3259 NH1 ARG A 418 53.582 58.344 -48.141 1.00 20.25 N ATOM 3260 NH2 ARG A 418 52.221 56.574 -48.508 1.00 17.55 N ATOM 3261 N ASP A 419 56.856 53.688 -49.549 1.00 15.51 N ATOM 3262 CA ASP A 419 57.171 52.767 -48.444 1.00 11.99 C ATOM 3263 C ASP A 419 58.489 52.060 -48.638 1.00 24.78 C ATOM 3264 O ASP A 419 59.301 51.922 -47.697 1.00 17.36 O ATOM 3265 CB ASP A 419 56.088 51.736 -48.070 1.00 11.35 C ATOM 3266 CG ASP A 419 54.910 52.383 -47.392 1.00 15.15 C ATOM 3267 OD1 ASP A 419 54.858 53.544 -47.035 1.00 16.94 O ATOM 3268 OD2 ASP A 419 53.912 51.572 -47.283 1.00 15.41 O ATOM 3269 N ALA A 420 58.699 51.616 -49.876 1.00 19.73 N ATOM 3270 CA ALA A 420 59.940 50.932 -50.201 1.00 11.40 C ATOM 3271 C ALA A 420 61.100 51.875 -50.021 1.00 13.06 C ATOM 3272 O ALA A 420 62.152 51.464 -49.538 1.00 15.92 O ATOM 3273 CB ALA A 420 59.956 50.378 -51.637 1.00 24.53 C ATOM 3274 N LEU A 421 60.921 53.142 -50.427 1.00 14.73 N ATOM 3275 CA LEU A 421 62.001 54.104 -50.264 1.00 12.11 C ATOM 3276 C LEU A 421 62.321 54.320 -48.759 1.00 16.50 C ATOM 3277 O LEU A 421 63.464 54.369 -48.356 1.00 14.18 O ATOM 3278 CB LEU A 421 61.549 55.461 -50.837 1.00 9.60 C ATOM 3279 CG LEU A 421 62.386 56.673 -50.470 1.00 11.87 C ATOM 3280 CD1 LEU A 421 63.820 56.482 -50.919 1.00 11.65 C ATOM 3281 CD2 LEU A 421 61.720 57.944 -51.027 1.00 11.87 C ATOM 3282 N VAL A 422 61.302 54.485 -47.936 1.00 14.89 N ATOM 3283 CA VAL A 422 61.496 54.692 -46.485 1.00 14.03 C ATOM 3284 C VAL A 422 62.283 53.506 -45.855 1.00 14.06 C ATOM 3285 O VAL A 422 63.317 53.707 -45.183 1.00 23.27 O ATOM 3286 CB VAL A 422 60.077 54.881 -45.924 1.00 19.23 C ATOM 3287 CG1 VAL A 422 60.058 54.534 -44.426 1.00 19.81 C ATOM 3288 CG2 VAL A 422 59.585 56.309 -46.186 1.00 16.00 C ATOM 3289 N LYS A 423 61.806 52.262 -46.151 1.00 16.04 N ATOM 3290 CA LYS A 423 62.413 51.025 -45.680 1.00 13.63 C ATOM 3291 C LYS A 423 63.865 50.899 -46.021 1.00 20.05 C ATOM 3292 O LYS A 423 64.718 50.508 -45.223 1.00 21.60 O ATOM 3293 CB LYS A 423 61.574 49.833 -46.046 1.00 19.44 C ATOM 3294 CG LYS A 423 60.254 50.002 -45.316 1.00 20.15 C ATOM 3295 CD LYS A 423 59.404 48.770 -45.458 1.00 20.01 C ATOM 3296 CE LYS A 423 59.255 48.363 -46.906 1.00 31.40 C ATOM 3297 NZ LYS A 423 58.559 47.074 -47.053 1.00 39.37 N ATOM 3298 N ALA A 424 64.220 51.289 -47.233 1.00 17.84 N ATOM 3299 CA ALA A 424 65.628 51.231 -47.640 1.00 17.03 C ATOM 3300 C ALA A 424 66.437 52.320 -46.918 1.00 9.82 C ATOM 3301 O ALA A 424 67.615 52.140 -46.555 1.00 19.17 O ATOM 3302 CB ALA A 424 65.693 51.502 -49.153 1.00 14.02 C ATOM 3303 N LEU A 425 65.783 53.502 -46.742 1.00 13.36 N ATOM 3304 CA LEU A 425 66.456 54.618 -46.067 1.00 13.88 C ATOM 3305 C LEU A 425 66.780 54.112 -44.658 1.00 16.08 C ATOM 3306 O LEU A 425 67.888 54.140 -44.139 1.00 15.08 O ATOM 3307 CB LEU A 425 65.547 55.875 -45.996 1.00 16.05 C ATOM 3308 CG LEU A 425 65.602 56.760 -47.256 1.00 15.58 C ATOM 3309 CD1 LEU A 425 64.381 57.662 -47.343 1.00 13.65 C ATOM 3310 CD2 LEU A 425 66.904 57.553 -47.272 1.00 17.93 C ATOM 3311 N TYR A 426 65.737 53.598 -44.061 1.00 13.79 N ATOM 3312 CA TYR A 426 65.917 53.077 -42.705 1.00 20.83 C ATOM 3313 C TYR A 426 66.902 51.927 -42.571 1.00 19.67 C ATOM 3314 O TYR A 426 67.861 51.997 -41.806 1.00 19.40 O ATOM 3315 CB TYR A 426 64.548 52.755 -42.098 1.00 18.42 C ATOM 3316 CG TYR A 426 64.665 52.722 -40.565 1.00 18.86 C ATOM 3317 CD1 TYR A 426 64.599 53.934 -39.870 1.00 22.51 C ATOM 3318 CD2 TYR A 426 64.868 51.537 -39.842 1.00 22.86 C ATOM 3319 CE1 TYR A 426 64.713 53.993 -38.480 1.00 21.79 C ATOM 3320 CE2 TYR A 426 64.943 51.568 -38.440 1.00 22.91 C ATOM 3321 CZ TYR A 426 64.874 52.799 -37.777 1.00 24.89 C ATOM 3322 OH TYR A 426 64.981 52.900 -36.407 1.00 23.44 O ATOM 3323 N GLY A 427 66.682 50.847 -43.339 1.00 11.14 N ATOM 3324 CA GLY A 427 67.591 49.723 -43.283 1.00 11.05 C ATOM 3325 C GLY A 427 68.990 50.135 -43.639 1.00 18.91 C ATOM 3326 O GLY A 427 69.990 49.687 -43.072 1.00 15.68 O ATOM 3327 N ARG A 428 69.122 51.004 -44.624 1.00 14.26 N ATOM 3328 CA ARG A 428 70.514 51.343 -44.889 1.00 13.41 C ATOM 3329 C ARG A 428 71.156 52.223 -43.787 1.00 13.59 C ATOM 3330 O ARG A 428 72.356 52.149 -43.579 1.00 15.82 O ATOM 3331 CB ARG A 428 70.652 52.081 -46.220 1.00 17.44 C ATOM 3332 CG ARG A 428 70.424 51.145 -47.400 1.00 17.16 C ATOM 3333 CD ARG A 428 70.178 51.949 -48.670 1.00 29.70 C ATOM 3334 NE ARG A 428 69.555 51.138 -49.712 1.00 22.99 N ATOM 3335 CZ ARG A 428 69.709 51.368 -50.999 1.00 42.32 C ATOM 3336 NH1 ARG A 428 70.466 52.360 -51.428 1.00 21.10 N ATOM 3337 NH2 ARG A 428 69.102 50.597 -51.884 1.00 20.56 N ATOM 3338 N LEU A 429 70.346 53.087 -43.161 1.00 17.68 N ATOM 3339 CA LEU A 429 70.818 53.949 -42.085 1.00 19.85 C ATOM 3340 C LEU A 429 71.252 53.015 -40.963 1.00 13.72 C ATOM 3341 O LEU A 429 72.292 53.169 -40.378 1.00 16.63 O ATOM 3342 CB LEU A 429 69.650 54.801 -41.557 1.00 24.15 C ATOM 3343 CG LEU A 429 69.992 55.614 -40.296 1.00 19.80 C ATOM 3344 CD1 LEU A 429 71.184 56.540 -40.490 1.00 13.03 C ATOM 3345 CD2 LEU A 429 68.783 56.362 -39.769 1.00 13.79 C ATOM 3346 N PHE A 430 70.436 52.023 -40.711 1.00 18.41 N ATOM 3347 CA PHE A 430 70.797 51.074 -39.679 1.00 17.20 C ATOM 3348 C PHE A 430 72.139 50.412 -39.953 1.00 20.43 C ATOM 3349 O PHE A 430 73.022 50.299 -39.094 1.00 18.31 O ATOM 3350 CB PHE A 430 69.628 50.086 -39.453 1.00 17.91 C ATOM 3351 CG PHE A 430 69.813 49.283 -38.158 1.00 32.45 C ATOM 3352 CD1 PHE A 430 69.380 49.755 -36.914 1.00 25.58 C ATOM 3353 CD2 PHE A 430 70.447 48.037 -38.182 1.00 26.59 C ATOM 3354 CE1 PHE A 430 69.543 49.003 -35.743 1.00 22.63 C ATOM 3355 CE2 PHE A 430 70.634 47.269 -37.029 1.00 28.98 C ATOM 3356 CZ PHE A 430 70.178 47.762 -35.801 1.00 13.71 C ATOM 3357 N LEU A 431 72.306 49.953 -41.175 1.00 18.28 N ATOM 3358 CA LEU A 431 73.549 49.303 -41.475 1.00 12.86 C ATOM 3359 C LEU A 431 74.685 50.262 -41.340 1.00 16.02 C ATOM 3360 O LEU A 431 75.794 49.903 -40.942 1.00 22.02 O ATOM 3361 CB LEU A 431 73.649 48.891 -42.932 1.00 22.80 C ATOM 3362 CG LEU A 431 72.984 47.575 -43.183 1.00 50.82 C ATOM 3363 CD1 LEU A 431 73.388 47.193 -44.598 1.00 70.62 C ATOM 3364 CD2 LEU A 431 73.545 46.562 -42.195 1.00 82.96 C ATOM 3365 N TRP A 432 74.420 51.506 -41.729 1.00 16.33 N ATOM 3366 CA TRP A 432 75.490 52.469 -41.627 1.00 15.09 C ATOM 3367 C TRP A 432 75.919 52.686 -40.164 1.00 13.46 C ATOM 3368 O TRP A 432 77.123 52.727 -39.896 1.00 20.95 O ATOM 3369 CB TRP A 432 75.064 53.750 -42.353 1.00 19.37 C ATOM 3370 CG TRP A 432 76.076 54.856 -42.226 1.00 24.44 C ATOM 3371 CD1 TRP A 432 77.192 55.035 -42.969 1.00 37.68 C ATOM 3372 CD2 TRP A 432 76.055 55.941 -41.295 1.00 23.78 C ATOM 3373 NE1 TRP A 432 77.866 56.155 -42.566 1.00 29.53 N ATOM 3374 CE2 TRP A 432 77.179 56.734 -41.543 1.00 31.36 C ATOM 3375 CE3 TRP A 432 75.189 56.286 -40.288 1.00 17.79 C ATOM 3376 CZ2 TRP A 432 77.465 57.859 -40.799 1.00 24.45 C ATOM 3377 CZ3 TRP A 432 75.446 57.407 -39.564 1.00 28.93 C ATOM 3378 CH2 TRP A 432 76.574 58.178 -39.818 1.00 31.99 C ATOM 3379 N LEU A 433 74.920 52.799 -39.254 1.00 21.16 N ATOM 3380 CA LEU A 433 75.137 52.965 -37.799 1.00 13.04 C ATOM 3381 C LEU A 433 75.968 51.815 -37.329 1.00 15.02 C ATOM 3382 O LEU A 433 77.001 52.011 -36.729 1.00 21.23 O ATOM 3383 CB LEU A 433 73.824 53.006 -37.010 1.00 16.10 C ATOM 3384 CG LEU A 433 73.037 54.318 -37.157 1.00 18.50 C ATOM 3385 CD1 LEU A 433 71.676 54.176 -36.500 1.00 17.94 C ATOM 3386 CD2 LEU A 433 73.719 55.561 -36.599 1.00 18.56 C ATOM 3387 N VAL A 434 75.570 50.585 -37.665 1.00 20.29 N ATOM 3388 CA VAL A 434 76.408 49.474 -37.248 1.00 13.12 C ATOM 3389 C VAL A 434 77.836 49.507 -37.779 1.00 22.42 C ATOM 3390 O VAL A 434 78.811 49.250 -37.061 1.00 25.12 O ATOM 3391 CB VAL A 434 75.785 48.151 -37.652 1.00 14.30 C ATOM 3392 CG1 VAL A 434 76.567 46.975 -37.101 1.00 15.96 C ATOM 3393 CG2 VAL A 434 74.339 48.063 -37.227 1.00 12.71 C ATOM 3394 N LYS A 435 77.981 49.786 -39.090 1.00 20.89 N ATOM 3395 CA LYS A 435 79.313 49.828 -39.706 1.00 17.17 C ATOM 3396 C LYS A 435 80.131 50.913 -39.060 1.00 15.22 C ATOM 3397 O LYS A 435 81.323 50.757 -38.781 1.00 22.17 O ATOM 3398 CB LYS A 435 79.200 50.062 -41.206 1.00 22.43 C ATOM 3399 CG LYS A 435 78.762 48.800 -41.925 1.00 35.22 C ATOM 3400 CD LYS A 435 78.201 49.033 -43.328 1.00 52.67 C ATOM 3401 CE LYS A 435 78.552 47.987 -44.391 1.00100.00 C ATOM 3402 NZ LYS A 435 77.847 46.689 -44.312 1.00 29.36 N ATOM 3403 N LYS A 436 79.446 52.017 -38.806 1.00 20.86 N ATOM 3404 CA LYS A 436 80.135 53.114 -38.167 1.00 17.96 C ATOM 3405 C LYS A 436 80.636 52.621 -36.832 1.00 32.82 C ATOM 3406 O LYS A 436 81.781 52.836 -36.494 1.00 33.23 O ATOM 3407 CB LYS A 436 79.234 54.303 -37.943 1.00 20.82 C ATOM 3408 CG LYS A 436 79.064 55.108 -39.220 1.00 47.99 C ATOM 3409 CD LYS A 436 80.349 55.789 -39.647 1.00 37.14 C ATOM 3410 CE LYS A 436 80.231 57.306 -39.596 1.00 78.25 C ATOM 3411 NZ LYS A 436 81.509 58.034 -39.619 1.00 44.70 N ATOM 3412 N ILE A 437 79.777 51.939 -36.094 1.00 19.26 N ATOM 3413 CA ILE A 437 80.157 51.418 -34.794 1.00 17.37 C ATOM 3414 C ILE A 437 81.273 50.419 -34.924 1.00 20.90 C ATOM 3415 O ILE A 437 82.286 50.479 -34.224 1.00 26.39 O ATOM 3416 CB ILE A 437 78.956 50.827 -34.085 1.00 25.41 C ATOM 3417 CG1 ILE A 437 78.123 51.971 -33.558 1.00 17.50 C ATOM 3418 CG2 ILE A 437 79.419 49.979 -32.912 1.00 20.67 C ATOM 3419 CD1 ILE A 437 76.665 51.608 -33.324 1.00 18.82 C ATOM 3420 N ASN A 438 81.122 49.506 -35.847 1.00 24.24 N ATOM 3421 CA ASN A 438 82.196 48.554 -35.986 1.00 23.86 C ATOM 3422 C ASN A 438 83.528 49.172 -36.341 1.00 39.64 C ATOM 3423 O ASN A 438 84.561 48.666 -35.906 1.00 28.43 O ATOM 3424 CB ASN A 438 81.869 47.523 -37.073 1.00 25.13 C ATOM 3425 CG ASN A 438 80.888 46.526 -36.537 1.00 24.31 C ATOM 3426 OD1 ASN A 438 80.810 46.324 -35.319 1.00 26.72 O ATOM 3427 ND2 ASN A 438 80.164 45.905 -37.450 1.00 14.99 N ATOM 3428 N ASN A 439 83.528 50.239 -37.139 1.00 31.19 N ATOM 3429 CA ASN A 439 84.828 50.765 -37.474 1.00 35.40 C ATOM 3430 C ASN A 439 85.524 51.383 -36.296 1.00 26.41 C ATOM 3431 O ASN A 439 86.738 51.327 -36.143 1.00 45.45 O ATOM 3432 CB ASN A 439 84.989 51.499 -38.807 1.00 43.95 C ATOM 3433 CG ASN A 439 86.448 51.690 -39.265 1.00100.00 C ATOM 3434 OD1 ASN A 439 86.663 52.382 -40.250 1.00100.00 O ATOM 3435 ND2 ASN A 439 87.489 51.124 -38.620 1.00 48.63 N ATOM 3436 N VAL A 440 84.726 51.951 -35.433 1.00 32.72 N ATOM 3437 CA VAL A 440 85.309 52.539 -34.243 1.00 33.11 C ATOM 3438 C VAL A 440 85.937 51.452 -33.391 1.00 40.56 C ATOM 3439 O VAL A 440 87.006 51.649 -32.820 1.00 32.71 O ATOM 3440 CB VAL A 440 84.256 53.264 -33.409 1.00 52.22 C ATOM 3441 CG1 VAL A 440 84.791 53.607 -32.029 1.00 32.75 C ATOM 3442 CG2 VAL A 440 83.781 54.534 -34.104 1.00 32.49 C ATOM 3443 N LEU A 441 85.232 50.313 -33.323 1.00 32.22 N ATOM 3444 CA LEU A 441 85.626 49.153 -32.536 1.00 31.72 C ATOM 3445 C LEU A 441 86.662 48.256 -33.164 1.00 64.66 C ATOM 3446 O LEU A 441 87.116 47.330 -32.499 1.00 28.93 O ATOM 3447 CB LEU A 441 84.462 48.350 -31.901 1.00 34.99 C ATOM 3448 CG LEU A 441 83.348 49.212 -31.311 1.00 18.38 C ATOM 3449 CD1 LEU A 441 82.144 48.350 -30.990 1.00 19.25 C ATOM 3450 CD2 LEU A 441 83.812 49.969 -30.079 1.00 24.80 C