>>1XL4:HELIX    4   4 ILE A  105  THR A  136  1                                  32    
IGPLANTLVTLEALCGMLGLAVAASLIYARFT
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 4 4 ILE A 105 THR A 136 1 32 ATOM 733 N ILE A 105 39.362 -59.852 157.583 1.00 79.63 N ATOM 734 CA ILE A 105 38.488 -59.578 156.438 1.00 79.38 C ATOM 735 C ILE A 105 37.016 -59.486 156.853 1.00 78.21 C ATOM 736 O ILE A 105 36.425 -60.473 157.286 1.00 77.17 O ATOM 737 CB ILE A 105 38.598 -60.682 155.347 1.00 80.94 C ATOM 738 CG1 ILE A 105 39.973 -60.639 154.672 1.00 82.26 C ATOM 739 CG2 ILE A 105 37.504 -60.493 154.303 1.00 81.71 C ATOM 740 CD1 ILE A 105 40.256 -59.353 153.904 1.00 82.22 C ATOM 741 N GLY A 106 36.430 -58.302 156.716 1.00 77.58 N ATOM 742 CA GLY A 106 35.032 -58.128 157.068 1.00 77.64 C ATOM 743 C GLY A 106 34.778 -57.867 158.540 1.00 77.35 C ATOM 744 O GLY A 106 35.549 -58.313 159.385 1.00 78.75 O ATOM 745 N PRO A 107 33.693 -57.151 158.878 1.00 76.61 N ATOM 746 CA PRO A 107 33.314 -56.813 160.250 1.00 75.85 C ATOM 747 C PRO A 107 33.424 -57.943 161.270 1.00 74.76 C ATOM 748 O PRO A 107 33.752 -57.696 162.430 1.00 74.63 O ATOM 749 CB PRO A 107 31.887 -56.309 160.086 1.00 75.80 C ATOM 750 CG PRO A 107 31.972 -55.582 158.800 1.00 76.52 C ATOM 751 CD PRO A 107 32.730 -56.568 157.929 1.00 77.10 C ATOM 752 N LEU A 108 33.151 -59.175 160.852 1.00 73.93 N ATOM 753 CA LEU A 108 33.239 -60.301 161.775 1.00 72.62 C ATOM 754 C LEU A 108 34.669 -60.554 162.235 1.00 71.54 C ATOM 755 O LEU A 108 34.942 -60.607 163.434 1.00 72.82 O ATOM 756 CB LEU A 108 32.678 -61.573 161.141 1.00 72.28 C ATOM 757 CG LEU A 108 31.156 -61.650 161.052 1.00 72.66 C ATOM 758 CD1 LEU A 108 30.758 -63.043 160.597 1.00 72.73 C ATOM 759 CD2 LEU A 108 30.537 -61.345 162.408 1.00 72.22 C ATOM 760 N ALA A 109 35.579 -60.710 161.284 1.00 69.11 N ATOM 761 CA ALA A 109 36.973 -60.954 161.617 1.00 67.85 C ATOM 762 C ALA A 109 37.556 -59.822 162.462 1.00 66.77 C ATOM 763 O ALA A 109 38.302 -60.066 163.407 1.00 68.05 O ATOM 764 CB ALA A 109 37.789 -61.122 160.341 1.00 68.29 C ATOM 765 N ASN A 110 37.207 -58.587 162.123 1.00 64.60 N ATOM 766 CA ASN A 110 37.712 -57.418 162.834 1.00 62.75 C ATOM 767 C ASN A 110 37.153 -57.233 164.248 1.00 62.47 C ATOM 768 O ASN A 110 37.733 -56.510 165.062 1.00 61.55 O ATOM 769 CB ASN A 110 37.440 -56.164 162.007 1.00 61.07 C ATOM 770 CG ASN A 110 38.371 -56.029 160.821 1.00 60.45 C ATOM 771 OD1 ASN A 110 39.447 -55.451 160.930 1.00 60.42 O ATOM 772 ND2 ASN A 110 37.963 -56.572 159.681 1.00 60.40 N ATOM 773 N THR A 111 36.027 -57.875 164.541 1.00 62.05 N ATOM 774 CA THR A 111 35.432 -57.760 165.868 1.00 61.76 C ATOM 775 C THR A 111 36.089 -58.774 166.795 1.00 61.14 C ATOM 776 O THR A 111 36.129 -58.594 168.014 1.00 60.04 O ATOM 777 CB THR A 111 33.910 -57.996 165.826 1.00 61.34 C ATOM 778 OG1 THR A 111 33.319 -57.076 164.901 1.00 61.10 O ATOM 779 CG2 THR A 111 33.297 -57.773 167.205 1.00 59.82 C ATOM 780 N LEU A 112 36.603 -59.845 166.204 1.00 59.71 N ATOM 781 CA LEU A 112 37.291 -60.858 166.979 1.00 58.68 C ATOM 782 C LEU A 112 38.659 -60.286 167.307 1.00 58.04 C ATOM 783 O LEU A 112 39.153 -60.418 168.426 1.00 58.95 O ATOM 784 CB LEU A 112 37.428 -62.147 166.172 1.00 58.39 C ATOM 785 CG LEU A 112 36.148 -62.981 166.108 1.00 58.96 C ATOM 786 CD1 LEU A 112 36.359 -64.189 165.223 1.00 59.72 C ATOM 787 CD2 LEU A 112 35.758 -63.410 167.513 1.00 57.26 C ATOM 788 N VAL A 113 39.260 -59.632 166.320 1.00 56.40 N ATOM 789 CA VAL A 113 40.567 -59.020 166.499 1.00 54.40 C ATOM 790 C VAL A 113 40.527 -58.043 167.669 1.00 54.93 C ATOM 791 O VAL A 113 41.372 -58.084 168.561 1.00 55.47 O ATOM 792 CB VAL A 113 40.998 -58.267 165.227 1.00 51.48 C ATOM 793 CG1 VAL A 113 42.178 -57.351 165.530 1.00 48.50 C ATOM 794 CG2 VAL A 113 41.354 -59.268 164.142 1.00 49.47 C ATOM 795 N THR A 114 39.533 -57.165 167.656 1.00 54.66 N ATOM 796 CA THR A 114 39.381 -56.176 168.707 1.00 54.33 C ATOM 797 C THR A 114 39.293 -56.851 170.069 1.00 54.82 C ATOM 798 O THR A 114 39.905 -56.405 171.044 1.00 55.79 O ATOM 799 CB THR A 114 38.113 -55.347 168.486 1.00 52.58 C ATOM 800 OG1 THR A 114 38.261 -54.572 167.293 1.00 52.65 O ATOM 801 CG2 THR A 114 37.860 -54.429 169.672 1.00 53.20 C ATOM 802 N LEU A 115 38.530 -57.934 170.115 1.00 53.88 N ATOM 803 CA LEU A 115 38.315 -58.683 171.337 1.00 53.26 C ATOM 804 C LEU A 115 39.565 -59.457 171.737 1.00 53.48 C ATOM 805 O LEU A 115 39.946 -59.485 172.911 1.00 53.86 O ATOM 806 CB LEU A 115 37.139 -59.633 171.132 1.00 53.68 C ATOM 807 CG LEU A 115 36.497 -60.247 172.369 1.00 54.52 C ATOM 808 CD1 LEU A 115 36.097 -59.147 173.336 1.00 54.93 C ATOM 809 CD2 LEU A 115 35.283 -61.057 171.949 1.00 55.33 C ATOM 810 N GLU A 116 40.204 -60.083 170.756 1.00 52.22 N ATOM 811 CA GLU A 116 41.408 -60.856 171.009 1.00 52.03 C ATOM 812 C GLU A 116 42.535 -59.947 171.485 1.00 52.63 C ATOM 813 O GLU A 116 43.416 -60.371 172.240 1.00 54.44 O ATOM 814 CB GLU A 116 41.818 -61.605 169.743 1.00 52.08 C ATOM 815 CG GLU A 116 43.132 -62.338 169.847 1.00 51.48 C ATOM 816 CD GLU A 116 43.270 -63.413 168.791 1.00 51.42 C ATOM 817 OE1 GLU A 116 42.831 -63.182 167.649 1.00 49.92 O ATOM 818 OE2 GLU A 116 43.825 -64.486 169.104 1.00 52.40 O ATOM 819 N ALA A 117 42.497 -58.694 171.045 1.00 51.80 N ATOM 820 CA ALA A 117 43.493 -57.704 171.437 1.00 49.97 C ATOM 821 C ALA A 117 43.337 -57.393 172.925 1.00 49.89 C ATOM 822 O ALA A 117 44.322 -57.211 173.644 1.00 48.92 O ATOM 823 CB ALA A 117 43.308 -56.432 170.619 1.00 49.60 C ATOM 824 N LEU A 118 42.090 -57.331 173.380 1.00 49.50 N ATOM 825 CA LEU A 118 41.811 -57.041 174.774 1.00 51.06 C ATOM 826 C LEU A 118 42.219 -58.221 175.638 1.00 51.83 C ATOM 827 O LEU A 118 42.756 -58.035 176.724 1.00 52.92 O ATOM 828 CB LEU A 118 40.322 -56.740 174.975 1.00 52.66 C ATOM 829 CG LEU A 118 39.904 -56.194 176.346 1.00 52.97 C ATOM 830 CD1 LEU A 118 40.573 -54.856 176.588 1.00 53.30 C ATOM 831 CD2 LEU A 118 38.394 -56.030 176.402 1.00 53.65 C ATOM 832 N CYS A 119 41.973 -59.435 175.155 1.00 51.99 N ATOM 833 CA CYS A 119 42.333 -60.637 175.907 1.00 54.26 C ATOM 834 C CYS A 119 43.839 -60.745 176.134 1.00 54.29 C ATOM 835 O CYS A 119 44.289 -61.031 177.244 1.00 55.27 O ATOM 836 CB CYS A 119 41.833 -61.889 175.186 1.00 55.39 C ATOM 837 SG CYS A 119 40.038 -61.935 175.009 1.00 62.59 S ATOM 838 N GLY A 120 44.621 -60.534 175.083 1.00 53.35 N ATOM 839 CA GLY A 120 46.060 -60.601 175.240 1.00 50.99 C ATOM 840 C GLY A 120 46.507 -59.502 176.187 1.00 50.48 C ATOM 841 O GLY A 120 47.441 -59.683 176.967 1.00 48.99 O ATOM 842 N MET A 121 45.834 -58.355 176.120 1.00 50.95 N ATOM 843 CA MET A 121 46.166 -57.229 176.983 1.00 50.48 C ATOM 844 C MET A 121 45.912 -57.646 178.431 1.00 48.56 C ATOM 845 O MET A 121 46.792 -57.541 179.274 1.00 46.43 O ATOM 846 CB MET A 121 45.315 -56.011 176.604 1.00 53.94 C ATOM 847 CG MET A 121 45.623 -54.729 177.387 1.00 59.75 C ATOM 848 SD MET A 121 44.793 -54.562 179.016 1.00 68.25 S ATOM 849 CE MET A 121 43.563 -53.218 178.693 1.00 63.41 C ATOM 850 N LEU A 122 44.710 -58.135 178.711 1.00 46.70 N ATOM 851 CA LEU A 122 44.373 -58.570 180.054 1.00 47.47 C ATOM 852 C LEU A 122 45.268 -59.752 180.443 1.00 47.32 C ATOM 853 O LEU A 122 45.704 -59.867 181.593 1.00 47.94 O ATOM 854 CB LEU A 122 42.896 -58.965 180.119 1.00 46.90 C ATOM 855 CG LEU A 122 41.907 -57.859 179.735 1.00 47.72 C ATOM 856 CD1 LEU A 122 40.483 -58.366 179.874 1.00 47.00 C ATOM 857 CD2 LEU A 122 42.113 -56.646 180.622 1.00 47.96 C ATOM 858 N GLY A 123 45.549 -60.617 179.474 1.00 45.59 N ATOM 859 CA GLY A 123 46.394 -61.771 179.724 1.00 43.53 C ATOM 860 C GLY A 123 47.757 -61.382 180.258 1.00 43.48 C ATOM 861 O GLY A 123 48.243 -61.974 181.216 1.00 45.93 O ATOM 862 N LEU A 124 48.377 -60.381 179.645 1.00 42.14 N ATOM 863 CA LEU A 124 49.693 -59.926 180.077 1.00 41.83 C ATOM 864 C LEU A 124 49.633 -59.402 181.494 1.00 41.45 C ATOM 865 O LEU A 124 50.485 -59.718 182.327 1.00 41.54 O ATOM 866 CB LEU A 124 50.206 -58.809 179.167 1.00 42.02 C ATOM 867 CG LEU A 124 51.427 -58.031 179.674 1.00 42.56 C ATOM 868 CD1 LEU A 124 52.639 -58.952 179.809 1.00 43.30 C ATOM 869 CD2 LEU A 124 51.733 -56.903 178.705 1.00 45.78 C ATOM 870 N ALA A 125 48.615 -58.593 181.754 1.00 40.64 N ATOM 871 CA ALA A 125 48.427 -57.986 183.054 1.00 39.01 C ATOM 872 C ALA A 125 48.291 -59.050 184.127 1.00 40.15 C ATOM 873 O ALA A 125 48.930 -58.967 185.181 1.00 39.11 O ATOM 874 CB ALA A 125 47.197 -57.103 183.030 1.00 39.59 C ATOM 875 N VAL A 126 47.458 -60.052 183.866 1.00 40.61 N ATOM 876 CA VAL A 126 47.265 -61.111 184.835 1.00 41.63 C ATOM 877 C VAL A 126 48.564 -61.879 185.032 1.00 43.11 C ATOM 878 O VAL A 126 49.041 -62.024 186.157 1.00 43.95 O ATOM 879 CB VAL A 126 46.163 -62.072 184.390 1.00 41.86 C ATOM 880 CG1 VAL A 126 46.087 -63.254 185.341 1.00 42.12 C ATOM 881 CG2 VAL A 126 44.838 -61.337 184.363 1.00 41.23 C ATOM 882 N ALA A 127 49.150 -62.353 183.938 1.00 43.14 N ATOM 883 CA ALA A 127 50.399 -63.099 184.023 1.00 43.66 C ATOM 884 C ALA A 127 51.477 -62.310 184.761 1.00 44.30 C ATOM 885 O ALA A 127 52.299 -62.884 185.473 1.00 45.56 O ATOM 886 CB ALA A 127 50.879 -63.463 182.638 1.00 44.14 C ATOM 887 N ALA A 128 51.484 -60.994 184.598 1.00 43.10 N ATOM 888 CA ALA A 128 52.480 -60.188 185.280 1.00 42.90 C ATOM 889 C ALA A 128 52.159 -60.128 186.774 1.00 44.00 C ATOM 890 O ALA A 128 53.060 -60.074 187.608 1.00 43.72 O ATOM 891 CB ALA A 128 52.515 -58.798 184.688 1.00 42.45 C ATOM 892 N SER A 129 50.870 -60.140 187.107 1.00 45.89 N ATOM 893 CA SER A 129 50.436 -60.104 188.503 1.00 46.24 C ATOM 894 C SER A 129 50.911 -61.377 189.174 1.00 46.31 C ATOM 895 O SER A 129 51.655 -61.347 190.152 1.00 46.39 O ATOM 896 CB SER A 129 48.909 -60.026 188.597 1.00 46.83 C ATOM 897 OG SER A 129 48.428 -58.802 188.064 1.00 51.22 O ATOM 898 N LEU A 130 50.478 -62.502 188.630 1.00 46.15 N ATOM 899 CA LEU A 130 50.859 -63.786 189.175 1.00 45.74 C ATOM 900 C LEU A 130 52.367 -63.875 189.393 1.00 45.44 C ATOM 901 O LEU A 130 52.822 -64.216 190.487 1.00 45.31 O ATOM 902 CB LEU A 130 50.395 -64.904 188.243 1.00 46.06 C ATOM 903 CG LEU A 130 48.878 -65.026 188.065 1.00 47.44 C ATOM 904 CD1 LEU A 130 48.580 -66.215 187.156 1.00 47.46 C ATOM 905 CD2 LEU A 130 48.198 -65.202 189.422 1.00 45.31 C ATOM 906 N ILE A 131 53.142 -63.560 188.361 1.00 43.81 N ATOM 907 CA ILE A 131 54.591 -63.631 188.475 1.00 42.81 C ATOM 908 C ILE A 131 55.117 -62.777 189.621 1.00 45.03 C ATOM 909 O ILE A 131 56.001 -63.207 190.367 1.00 44.08 O ATOM 910 CB ILE A 131 55.269 -63.200 187.175 1.00 41.05 C ATOM 911 CG1 ILE A 131 54.955 -64.226 186.077 1.00 40.27 C ATOM 912 CG2 ILE A 131 56.766 -63.036 187.399 1.00 39.00 C ATOM 913 CD1 ILE A 131 55.559 -63.903 184.737 1.00 34.15 C ATOM 914 N TYR A 132 54.581 -61.571 189.772 1.00 45.94 N ATOM 915 CA TYR A 132 55.034 -60.712 190.860 1.00 49.14 C ATOM 916 C TYR A 132 54.640 -61.315 192.206 1.00 49.75 C ATOM 917 O TYR A 132 55.454 -61.386 193.128 1.00 48.48 O ATOM 918 CB TYR A 132 54.435 -59.311 190.752 1.00 49.47 C ATOM 919 CG TYR A 132 54.947 -58.394 191.835 1.00 52.40 C ATOM 920 CD1 TYR A 132 56.214 -57.816 191.747 1.00 54.16 C ATOM 921 CD2 TYR A 132 54.187 -58.136 192.974 1.00 54.63 C ATOM 922 CE1 TYR A 132 56.709 -57.001 192.767 1.00 53.57 C ATOM 923 CE2 TYR A 132 54.671 -57.328 193.999 1.00 55.38 C ATOM 924 CZ TYR A 132 55.931 -56.763 193.886 1.00 55.13 C ATOM 925 OH TYR A 132 56.398 -55.947 194.893 1.00 56.77 O ATOM 926 N ALA A 133 53.381 -61.735 192.311 1.00 50.65 N ATOM 927 CA ALA A 133 52.864 -62.338 193.533 1.00 51.03 C ATOM 928 C ALA A 133 53.740 -63.506 193.970 1.00 52.73 C ATOM 929 O ALA A 133 54.138 -63.600 195.128 1.00 53.31 O ATOM 930 CB ALA A 133 51.442 -62.811 193.311 1.00 50.09 C ATOM 931 N ARG A 134 54.033 -64.405 193.042 1.00 54.36 N ATOM 932 CA ARG A 134 54.870 -65.544 193.362 1.00 57.07 C ATOM 933 C ARG A 134 56.217 -65.065 193.894 1.00 59.32 C ATOM 934 O ARG A 134 56.869 -65.764 194.674 1.00 61.18 O ATOM 935 CB ARG A 134 55.047 -66.418 192.123 1.00 57.17 C ATOM 936 CG ARG A 134 53.783 -67.190 191.760 1.00 59.03 C ATOM 937 CD ARG A 134 53.846 -67.736 190.343 1.00 59.45 C ATOM 938 NE ARG A 134 55.015 -68.583 190.118 1.00 61.16 N ATOM 939 CZ ARG A 134 55.156 -69.817 190.593 1.00 60.75 C ATOM 940 NH1 ARG A 134 54.198 -70.369 191.329 1.00 59.93 N ATOM 941 NH2 ARG A 134 56.258 -70.501 190.325 1.00 59.92 N ATOM 942 N PHE A 135 56.626 -63.868 193.482 1.00 61.03 N ATOM 943 CA PHE A 135 57.890 -63.284 193.931 1.00 63.16 C ATOM 944 C PHE A 135 57.768 -62.752 195.358 1.00 64.57 C ATOM 945 O PHE A 135 58.774 -62.594 196.049 1.00 64.91 O ATOM 946 CB PHE A 135 58.313 -62.111 193.034 1.00 64.83 C ATOM 947 CG PHE A 135 59.005 -62.510 191.759 1.00 64.55 C ATOM 948 CD1 PHE A 135 59.303 -63.837 191.482 1.00 64.76 C ATOM 949 CD2 PHE A 135 59.386 -61.535 190.843 1.00 64.87 C ATOM 950 CE1 PHE A 135 59.975 -64.186 190.314 1.00 64.95 C ATOM 951 CE2 PHE A 135 60.056 -61.873 189.676 1.00 65.72 C ATOM 952 CZ PHE A 135 60.351 -63.203 189.411 1.00 65.40 C ATOM 953 N THR A 136 56.538 -62.469 195.788 1.00 65.43 N ATOM 954 CA THR A 136 56.296 -61.925 197.122 1.00 66.34 C ATOM 955 C THR A 136 55.835 -62.939 198.182 1.00 67.81 C ATOM 956 O THR A 136 55.215 -62.568 199.181 1.00 69.37 O ATOM 957 CB THR A 136 55.263 -60.768 197.069 1.00 65.71 C ATOM 958 OG1 THR A 136 53.991 -61.269 196.640 1.00 64.94 O ATOM 959 CG2 THR A 136 55.725 -59.688 196.109 1.00 65.76 C