>>1ZIL:HELIX    1   1 ARG A    1  VAL A   30  1                                  30    
RMKQLEDKVEELLSKQYHLENEVARLKKLV
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 1 1 ARG A 1 VAL A 30 1 30 ATOM 1 N ARG A 1 40.332 15.568 14.615 1.00 25.69 N ATOM 2 CA ARG A 1 38.986 15.017 14.745 1.00 29.22 C ATOM 3 C ARG A 1 37.879 16.054 14.914 1.00 42.70 C ATOM 4 O ARG A 1 36.757 15.835 14.454 1.00 41.92 O ATOM 5 CB ARG A 1 38.881 13.965 15.839 1.00 34.81 C ATOM 6 CG ARG A 1 37.442 13.481 16.029 1.00 37.25 C ATOM 7 CD ARG A 1 36.641 14.323 17.008 1.00 50.81 C ATOM 8 NE ARG A 1 35.654 13.528 17.723 1.00 72.52 N ATOM 9 CZ ARG A 1 35.983 12.675 18.692 1.00 73.04 C ATOM 10 NH1 ARG A 1 37.255 12.506 19.071 1.00 41.20 N ATOM 11 NH2 ARG A 1 35.023 11.982 19.302 1.00 68.87 N ATOM 12 N MET A 2 38.197 17.153 15.622 1.00 41.01 N ATOM 13 CA MET A 2 37.287 18.260 15.897 1.00 38.01 C ATOM 14 C MET A 2 36.856 18.877 14.567 1.00 33.85 C ATOM 15 O MET A 2 35.653 19.055 14.280 1.00 28.94 O ATOM 16 CB MET A 2 38.062 19.301 16.733 1.00 44.46 C ATOM 17 CG MET A 2 37.227 20.419 17.343 1.00 54.95 C ATOM 18 SD MET A 2 36.801 20.131 19.079 1.00 66.94 S ATOM 19 CE MET A 2 35.560 18.815 18.925 1.00 60.13 C ATOM 20 N LYS A 3 37.892 19.181 13.748 1.00 27.24 N ATOM 21 CA LYS A 3 37.747 19.760 12.410 1.00 20.96 C ATOM 22 C LYS A 3 36.969 18.810 11.506 1.00 18.52 C ATOM 23 O LYS A 3 36.455 19.150 10.467 1.00 22.05 O ATOM 24 CB LYS A 3 39.116 20.048 11.829 1.00 19.26 C ATOM 25 CG LYS A 3 39.131 20.235 10.320 1.00 18.50 C ATOM 26 CD LYS A 3 38.482 21.522 9.832 1.00 56.22 C ATOM 27 CE LYS A 3 38.971 21.932 8.447 1.00 49.23 C ATOM 28 NZ LYS A 3 39.112 20.789 7.527 1.00 40.64 N ATOM 29 N GLN A 4 36.903 17.577 11.918 1.00 24.74 N ATOM 30 CA GLN A 4 36.184 16.597 11.159 1.00 28.41 C ATOM 31 C GLN A 4 34.744 16.738 11.552 1.00 20.31 C ATOM 32 O GLN A 4 33.858 16.674 10.720 1.00 26.87 O ATOM 33 CB GLN A 4 36.673 15.144 11.435 1.00 34.54 C ATOM 34 CG GLN A 4 38.189 15.030 11.714 1.00 74.34 C ATOM 35 CD GLN A 4 38.634 13.625 12.107 1.00100.00 C ATOM 36 OE1 GLN A 4 37.867 12.655 11.993 1.00100.00 O ATOM 37 NE2 GLN A 4 39.879 13.508 12.573 1.00 85.87 N ATOM 38 N LEU A 5 34.540 16.940 12.855 1.00 9.84 N ATOM 39 CA LEU A 5 33.213 17.082 13.403 1.00 19.60 C ATOM 40 C LEU A 5 32.631 18.379 12.948 1.00 23.08 C ATOM 41 O LEU A 5 31.439 18.473 12.643 1.00 24.20 O ATOM 42 CB LEU A 5 33.155 16.916 14.945 1.00 22.88 C ATOM 43 CG LEU A 5 33.020 15.452 15.397 1.00 14.70 C ATOM 44 CD1 LEU A 5 33.150 15.339 16.910 1.00 16.32 C ATOM 45 CD2 LEU A 5 31.670 14.892 14.951 1.00 4.96 C ATOM 46 N GLU A 6 33.511 19.368 12.887 1.00 17.57 N ATOM 47 CA GLU A 6 33.131 20.686 12.447 1.00 17.96 C ATOM 48 C GLU A 6 32.658 20.640 11.004 1.00 10.57 C ATOM 49 O GLU A 6 31.608 21.156 10.674 1.00 18.77 O ATOM 50 CB GLU A 6 34.274 21.729 12.724 1.00 17.06 C ATOM 51 CG GLU A 6 34.172 22.332 14.152 1.00 7.21 C ATOM 52 CD GLU A 6 35.459 22.789 14.747 1.00 11.53 C ATOM 53 OE1 GLU A 6 36.510 22.854 14.134 1.00 24.04 O ATOM 54 OE2 GLU A 6 35.330 23.055 16.024 1.00 11.46 O ATOM 55 N ASP A 7 33.426 19.979 10.136 1.00 15.63 N ATOM 56 CA ASP A 7 33.095 19.855 8.695 1.00 20.94 C ATOM 57 C ASP A 7 31.826 19.064 8.376 1.00 29.20 C ATOM 58 O ASP A 7 31.160 19.272 7.344 1.00 18.41 O ATOM 59 CB ASP A 7 34.279 19.320 7.865 1.00 22.96 C ATOM 60 CG ASP A 7 35.396 20.308 7.659 1.00 27.65 C ATOM 61 OD1 ASP A 7 35.258 21.515 7.707 1.00 26.65 O ATOM 62 OD2 ASP A 7 36.546 19.720 7.444 1.00 37.91 O ATOM 63 N LYS A 8 31.505 18.142 9.266 1.00 35.49 N ATOM 64 CA LYS A 8 30.333 17.302 9.131 1.00 31.02 C ATOM 65 C LYS A 8 29.079 18.128 9.378 1.00 35.50 C ATOM 66 O LYS A 8 28.074 17.978 8.668 1.00 35.67 O ATOM 67 CB LYS A 8 30.396 16.145 10.120 1.00 27.48 C ATOM 68 CG LYS A 8 29.353 15.076 9.870 1.00 33.79 C ATOM 69 CD LYS A 8 29.721 14.193 8.696 1.00 31.14 C ATOM 70 CE LYS A 8 28.649 13.175 8.347 1.00 18.71 C ATOM 71 NZ LYS A 8 28.931 12.514 7.060 1.00 35.67 N ATOM 72 N VAL A 9 29.148 19.005 10.404 1.00 21.45 N ATOM 73 CA VAL A 9 28.006 19.844 10.713 1.00 20.05 C ATOM 74 C VAL A 9 27.736 20.745 9.514 1.00 23.70 C ATOM 75 O VAL A 9 26.609 20.878 9.037 1.00 24.48 O ATOM 76 CB VAL A 9 28.153 20.655 12.009 1.00 15.38 C ATOM 77 CG1 VAL A 9 26.842 21.285 12.398 1.00 11.04 C ATOM 78 CG2 VAL A 9 28.607 19.787 13.151 1.00 14.03 C ATOM 79 N GLU A 10 28.805 21.340 9.013 1.00 23.76 N ATOM 80 CA GLU A 10 28.715 22.225 7.872 1.00 22.89 C ATOM 81 C GLU A 10 28.225 21.505 6.649 1.00 28.15 C ATOM 82 O GLU A 10 27.445 22.049 5.891 1.00 26.32 O ATOM 83 CB GLU A 10 30.045 22.929 7.580 1.00 22.34 C ATOM 84 CG GLU A 10 30.604 23.629 8.820 1.00 20.00 C ATOM 85 CD GLU A 10 32.096 23.661 8.782 1.00 53.37 C ATOM 86 OE1 GLU A 10 32.741 23.701 7.745 1.00 23.34 O ATOM 87 OE2 GLU A 10 32.631 23.581 9.973 1.00 51.90 O ATOM 88 N GLU A 11 28.680 20.275 6.434 1.00 26.97 N ATOM 89 CA GLU A 11 28.178 19.616 5.251 1.00 28.20 C ATOM 90 C GLU A 11 26.696 19.308 5.387 1.00 20.60 C ATOM 91 O GLU A 11 25.948 19.383 4.428 1.00 28.71 O ATOM 92 CB GLU A 11 28.969 18.384 4.816 1.00 31.52 C ATOM 93 CG GLU A 11 28.162 17.535 3.821 1.00 41.79 C ATOM 94 CD GLU A 11 28.185 16.075 4.183 1.00 60.93 C ATOM 95 OE1 GLU A 11 29.188 15.384 4.112 1.00 29.90 O ATOM 96 OE2 GLU A 11 27.039 15.649 4.658 1.00 53.09 O ATOM 97 N LEU A 12 26.270 18.974 6.601 1.00 20.45 N ATOM 98 CA LEU A 12 24.870 18.650 6.884 1.00 26.22 C ATOM 99 C LEU A 12 23.879 19.829 6.784 1.00 28.47 C ATOM 100 O LEU A 12 22.658 19.632 6.585 1.00 12.65 O ATOM 101 CB LEU A 12 24.697 17.872 8.200 1.00 27.31 C ATOM 102 CG LEU A 12 25.248 16.450 8.143 1.00 21.96 C ATOM 103 CD1 LEU A 12 25.439 15.950 9.559 1.00 13.52 C ATOM 104 CD2 LEU A 12 24.244 15.553 7.446 1.00 8.43 C ATOM 105 N LEU A 13 24.384 21.057 6.954 1.00 26.46 N ATOM 106 CA LEU A 13 23.509 22.229 6.866 1.00 27.14 C ATOM 107 C LEU A 13 23.104 22.460 5.405 1.00 26.55 C ATOM 108 O LEU A 13 21.944 22.780 5.108 1.00 28.64 O ATOM 109 CB LEU A 13 24.157 23.475 7.492 1.00 28.05 C ATOM 110 CG LEU A 13 23.170 24.504 8.017 1.00 25.31 C ATOM 111 CD1 LEU A 13 22.476 23.966 9.254 1.00 14.20 C ATOM 112 CD2 LEU A 13 23.912 25.803 8.324 1.00 27.63 C ATOM 113 N SER A 14 24.096 22.248 4.511 1.00 19.86 N ATOM 114 CA SER A 14 23.951 22.369 3.064 1.00 19.48 C ATOM 115 C SER A 14 22.924 21.363 2.535 1.00 26.92 C ATOM 116 O SER A 14 22.143 21.648 1.642 1.00 31.96 O ATOM 117 CB SER A 14 25.281 22.166 2.341 1.00 18.94 C ATOM 118 OG SER A 14 26.269 23.043 2.852 1.00 30.31 O ATOM 119 N LYS A 15 22.923 20.161 3.091 1.00 28.73 N ATOM 120 CA LYS A 15 21.961 19.160 2.666 1.00 26.24 C ATOM 121 C LYS A 15 20.602 19.606 3.114 1.00 19.31 C ATOM 122 O LYS A 15 19.663 19.611 2.357 1.00 19.68 O ATOM 123 CB LYS A 15 22.244 17.774 3.223 1.00 22.96 C ATOM 124 CG LYS A 15 23.054 16.907 2.281 1.00 44.67 C ATOM 125 CD LYS A 15 22.509 15.489 2.199 1.00 56.94 C ATOM 126 CE LYS A 15 23.588 14.437 1.994 1.00 78.51 C ATOM 127 NZ LYS A 15 24.421 14.670 0.804 1.00 91.06 N ATOM 128 N GLN A 16 20.528 20.004 4.383 1.00 23.01 N ATOM 129 CA GLN A 16 19.294 20.484 4.969 1.00 21.78 C ATOM 130 C GLN A 16 18.684 21.591 4.140 1.00 24.43 C ATOM 131 O GLN A 16 17.499 21.540 3.801 1.00 29.18 O ATOM 132 CB GLN A 16 19.467 20.925 6.428 1.00 26.54 C ATOM 133 CG GLN A 16 18.134 21.307 7.113 1.00 27.40 C ATOM 134 CD GLN A 16 18.329 22.066 8.410 1.00 19.73 C ATOM 135 OE1 GLN A 16 18.997 21.601 9.351 1.00 17.55 O ATOM 136 NE2 GLN A 16 17.750 23.259 8.463 1.00 22.48 N ATOM 137 N TYR A 17 19.487 22.593 3.779 1.00 22.39 N ATOM 138 CA TYR A 17 18.954 23.698 2.958 1.00 23.01 C ATOM 139 C TYR A 17 18.382 23.260 1.629 1.00 24.75 C ATOM 140 O TYR A 17 17.266 23.654 1.248 1.00 22.81 O ATOM 141 CB TYR A 17 19.882 24.917 2.799 1.00 21.02 C ATOM 142 CG TYR A 17 20.105 25.667 4.091 1.00 12.76 C ATOM 143 CD1 TYR A 17 19.063 25.957 4.977 1.00 14.10 C ATOM 144 CD2 TYR A 17 21.390 26.087 4.420 1.00 17.46 C ATOM 145 CE1 TYR A 17 19.295 26.638 6.174 1.00 14.22 C ATOM 146 CE2 TYR A 17 21.643 26.784 5.599 1.00 23.95 C ATOM 147 CZ TYR A 17 20.595 27.045 6.481 1.00 7.67 C ATOM 148 OH TYR A 17 20.850 27.729 7.627 1.00 23.35 O ATOM 149 N HIS A 18 19.141 22.446 0.913 1.00 22.70 N ATOM 150 CA HIS A 18 18.677 21.957 -0.370 1.00 21.84 C ATOM 151 C HIS A 18 17.291 21.357 -0.198 1.00 31.57 C ATOM 152 O HIS A 18 16.356 21.638 -0.961 1.00 22.14 O ATOM 153 CB HIS A 18 19.643 20.909 -0.912 1.00 24.44 C ATOM 154 CG HIS A 18 19.106 20.133 -2.068 1.00 30.24 C ATOM 155 ND1 HIS A 18 18.090 19.210 -1.911 1.00 34.04 N ATOM 156 CD2 HIS A 18 19.467 20.150 -3.373 1.00 36.95 C ATOM 157 CE1 HIS A 18 17.852 18.696 -3.110 1.00 37.84 C ATOM 158 NE2 HIS A 18 18.664 19.238 -4.013 1.00 38.76 N ATOM 159 N LEU A 19 17.194 20.529 0.861 1.00 35.99 N ATOM 160 CA LEU A 19 15.994 19.815 1.272 1.00 27.78 C ATOM 161 C LEU A 19 14.820 20.726 1.550 1.00 25.75 C ATOM 162 O LEU A 19 13.700 20.452 1.148 1.00 34.60 O ATOM 163 CB LEU A 19 16.257 18.947 2.518 1.00 30.41 C ATOM 164 CG LEU A 19 16.857 17.572 2.222 1.00 39.72 C ATOM 165 CD1 LEU A 19 17.046 16.813 3.537 1.00 34.25 C ATOM 166 CD2 LEU A 19 15.941 16.774 1.293 1.00 48.24 C ATOM 167 N GLU A 20 15.040 21.803 2.265 1.00 23.17 N ATOM 168 CA GLU A 20 13.929 22.685 2.550 1.00 31.20 C ATOM 169 C GLU A 20 13.489 23.423 1.294 1.00 39.85 C ATOM 170 O GLU A 20 12.314 23.762 1.098 1.00 32.77 O ATOM 171 CB GLU A 20 14.218 23.670 3.685 1.00 35.77 C ATOM 172 CG GLU A 20 14.305 23.018 5.071 1.00 39.43 C ATOM 173 CD GLU A 20 15.104 23.877 6.001 1.00 38.76 C ATOM 174 OE1 GLU A 20 14.859 25.148 5.843 1.00 80.02 O ATOM 175 OE2 GLU A 20 15.907 23.440 6.796 1.00 50.30 O ATOM 176 N ASN A 21 14.445 23.685 0.420 1.00 45.12 N ATOM 177 CA ASN A 21 14.087 24.377 -0.801 1.00 44.57 C ATOM 178 C ASN A 21 13.093 23.527 -1.603 1.00 43.98 C ATOM 179 O ASN A 21 12.044 24.020 -2.018 1.00 44.45 O ATOM 180 CB ASN A 21 15.311 24.816 -1.635 1.00 23.14 C ATOM 181 CG ASN A 21 16.207 25.844 -0.965 1.00 27.08 C ATOM 182 OD1 ASN A 21 15.848 26.504 0.029 1.00 26.24 O ATOM 183 ND2 ASN A 21 17.412 25.972 -1.511 1.00 32.64 N ATOM 184 N GLU A 22 13.452 22.237 -1.771 1.00 30.70 N ATOM 185 CA GLU A 22 12.692 21.212 -2.480 1.00 34.71 C ATOM 186 C GLU A 22 11.252 21.046 -1.982 1.00 25.29 C ATOM 187 O GLU A 22 10.282 21.090 -2.749 1.00 28.45 O ATOM 188 CB GLU A 22 13.429 19.883 -2.245 1.00 42.11 C ATOM 189 CG GLU A 22 12.864 18.693 -3.021 1.00 65.17 C ATOM 190 CD GLU A 22 13.975 17.810 -3.480 1.00 55.35 C ATOM 191 OE1 GLU A 22 14.878 17.438 -2.759 1.00 60.33 O ATOM 192 OE2 GLU A 22 13.936 17.587 -4.763 1.00 55.45 O ATOM 193 N VAL A 23 11.153 20.876 -0.669 1.00 20.70 N ATOM 194 CA VAL A 23 9.905 20.723 0.047 1.00 26.59 C ATOM 195 C VAL A 23 8.993 21.922 -0.194 1.00 41.48 C ATOM 196 O VAL A 23 7.765 21.828 -0.132 1.00 39.26 O ATOM 197 CB VAL A 23 10.210 20.565 1.528 1.00 31.28 C ATOM 198 CG1 VAL A 23 8.934 20.611 2.363 1.00 27.76 C ATOM 199 CG2 VAL A 23 10.978 19.249 1.759 1.00 33.08 C ATOM 200 N ALA A 24 9.635 23.065 -0.453 1.00 41.69 N ATOM 201 CA ALA A 24 8.958 24.315 -0.732 1.00 39.48 C ATOM 202 C ALA A 24 8.432 24.235 -2.145 1.00 40.81 C ATOM 203 O ALA A 24 7.264 24.467 -2.430 1.00 46.69 O ATOM 204 CB ALA A 24 9.938 25.466 -0.605 1.00 38.79 C ATOM 205 N ARG A 25 9.334 23.859 -3.036 1.00 34.36 N ATOM 206 CA ARG A 25 9.005 23.715 -4.425 1.00 35.56 C ATOM 207 C ARG A 25 7.809 22.796 -4.508 1.00 48.84 C ATOM 208 O ARG A 25 6.798 23.095 -5.138 1.00 51.16 O ATOM 209 CB ARG A 25 10.139 23.018 -5.166 1.00 33.57 C ATOM 210 CG ARG A 25 9.903 22.959 -6.670 1.00 38.29 C ATOM 211 CD ARG A 25 10.213 21.611 -7.309 1.00 44.62 C ATOM 212 NE ARG A 25 11.141 20.789 -6.537 1.00 52.70 N ATOM 213 CZ ARG A 25 11.553 19.582 -6.936 1.00 78.70 C ATOM 214 NH1 ARG A 25 11.148 19.050 -8.086 1.00 76.04 N ATOM 215 NH2 ARG A 25 12.399 18.889 -6.173 1.00 47.22 N ATOM 216 N LEU A 26 7.955 21.654 -3.851 1.00 42.94 N ATOM 217 CA LEU A 26 6.917 20.659 -3.837 1.00 31.26 C ATOM 218 C LEU A 26 5.634 21.180 -3.246 1.00 32.18 C ATOM 219 O LEU A 26 4.564 20.762 -3.672 1.00 30.90 O ATOM 220 CB LEU A 26 7.383 19.300 -3.260 1.00 24.75 C ATOM 221 CG LEU A 26 8.426 18.614 -4.152 1.00 16.58 C ATOM 222 CD1 LEU A 26 9.056 17.452 -3.417 1.00 17.40 C ATOM 223 CD2 LEU A 26 7.780 18.065 -5.406 1.00 19.01 C ATOM 224 N LYS A 27 5.731 22.116 -2.283 1.00 34.63 N ATOM 225 CA LYS A 27 4.515 22.655 -1.690 1.00 40.75 C ATOM 226 C LYS A 27 3.696 23.457 -2.695 1.00 58.16 C ATOM 227 O LYS A 27 2.535 23.136 -2.963 1.00 58.18 O ATOM 228 CB LYS A 27 4.686 23.369 -0.358 1.00 42.66 C ATOM 229 CG LYS A 27 4.888 22.418 0.805 1.00 23.88 C ATOM 230 CD LYS A 27 4.409 22.985 2.133 1.00 25.73 C ATOM 231 CE LYS A 27 5.164 22.445 3.346 1.00 31.84 C ATOM 232 NZ LYS A 27 5.288 20.977 3.360 1.00 41.63 N ATOM 233 N LYS A 28 4.299 24.495 -3.271 1.00 58.69 N ATOM 234 CA LYS A 28 3.567 25.269 -4.249 1.00 62.68 C ATOM 235 C LYS A 28 2.818 24.307 -5.146 1.00 70.26 C ATOM 236 O LYS A 28 1.635 24.457 -5.420 1.00 72.75 O ATOM 237 CB LYS A 28 4.500 26.100 -5.127 1.00 67.77 C ATOM 238 CG LYS A 28 4.682 27.523 -4.642 1.00 70.82 C ATOM 239 CD LYS A 28 5.916 28.192 -5.218 1.00 75.73 C ATOM 240 CE LYS A 28 6.299 29.457 -4.462 1.00 99.71 C ATOM 241 NZ LYS A 28 6.483 29.239 -3.016 1.00 94.42 N ATOM 242 N LEU A 29 3.559 23.308 -5.586 1.00 62.41 N ATOM 243 CA LEU A 29 3.085 22.272 -6.460 1.00 57.34 C ATOM 244 C LEU A 29 1.693 21.814 -6.145 1.00 57.60 C ATOM 245 O LEU A 29 1.023 21.294 -7.020 1.00 56.56 O ATOM 246 CB LEU A 29 4.063 21.079 -6.509 1.00 56.12 C ATOM 247 CG LEU A 29 4.281 20.595 -7.935 1.00 54.32 C ATOM 248 CD1 LEU A 29 3.928 21.735 -8.878 1.00 58.09 C ATOM 249 CD2 LEU A 29 5.737 20.201 -8.178 1.00 29.39 C ATOM 250 N VAL A 30 1.261 21.993 -4.898 1.00 54.78 N ATOM 251 CA VAL A 30 -0.088 21.571 -4.519 1.00 71.37 C ATOM 252 C VAL A 30 -1.100 22.720 -4.650 1.00100.00 C ATOM 253 O VAL A 30 -0.866 23.872 -4.258 1.00 56.37 O ATOM 254 CB VAL A 30 -0.163 20.881 -3.148 1.00 70.48 C ATOM 255 CG1 VAL A 30 -1.348 19.924 -3.107 1.00 68.19 C ATOM 256 CG2 VAL A 30 1.131 20.131 -2.838 1.00 69.15 C