>>1ZIL:HELIX    2   2 ARG B    1  VAL B   30  1                                  30    
RMKQLEDKVEELLSKQYHLENEVARLKKLV
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 2 2 ARG B 1 VAL B 30 1 30 ATOM 258 N ARG B 1 34.429 21.471 21.610 1.00 68.98 N ATOM 259 CA ARG B 1 33.902 20.503 22.555 1.00 65.94 C ATOM 260 C ARG B 1 33.064 19.451 21.831 1.00 61.61 C ATOM 261 O ARG B 1 31.945 19.724 21.374 1.00 61.24 O ATOM 262 CB ARG B 1 33.203 21.188 23.724 1.00 57.87 C ATOM 263 CG ARG B 1 32.682 20.215 24.756 1.00 52.32 C ATOM 264 CD ARG B 1 31.373 19.586 24.301 1.00 37.95 C ATOM 265 NE ARG B 1 30.952 18.482 25.144 1.00 48.63 N ATOM 266 CZ ARG B 1 30.445 18.628 26.355 1.00 55.95 C ATOM 267 NH1 ARG B 1 30.295 19.832 26.917 1.00 49.21 N ATOM 268 NH2 ARG B 1 30.079 17.530 27.021 1.00 45.13 N ATOM 269 N MET B 2 33.655 18.248 21.735 1.00 49.21 N ATOM 270 CA MET B 2 33.115 17.057 21.063 1.00 45.33 C ATOM 271 C MET B 2 31.650 16.638 21.162 1.00 37.03 C ATOM 272 O MET B 2 30.942 16.579 20.143 1.00 32.29 O ATOM 273 CB MET B 2 34.050 15.852 21.110 1.00 50.34 C ATOM 274 CG MET B 2 34.885 15.745 19.846 1.00 55.87 C ATOM 275 SD MET B 2 36.603 15.317 20.174 1.00 62.89 S ATOM 276 CE MET B 2 36.362 13.978 21.364 1.00 60.82 C ATOM 277 N LYS B 3 31.199 16.319 22.364 1.00 25.33 N ATOM 278 CA LYS B 3 29.830 15.871 22.568 1.00 19.17 C ATOM 279 C LYS B 3 28.756 16.825 22.058 1.00 24.26 C ATOM 280 O LYS B 3 27.686 16.414 21.615 1.00 31.30 O ATOM 281 CB LYS B 3 29.576 15.458 23.999 1.00 25.12 C ATOM 282 CG LYS B 3 30.383 14.245 24.422 1.00 69.05 C ATOM 283 CD LYS B 3 31.887 14.466 24.353 1.00 92.12 C ATOM 284 CE LYS B 3 32.499 14.968 25.654 1.00100.00 C ATOM 285 NZ LYS B 3 33.975 15.044 25.593 1.00 88.00 N ATOM 286 N GLN B 4 28.999 18.108 22.135 1.00 22.60 N ATOM 287 CA GLN B 4 27.972 18.992 21.645 1.00 27.82 C ATOM 288 C GLN B 4 27.970 18.921 20.118 1.00 22.15 C ATOM 289 O GLN B 4 26.922 18.837 19.496 1.00 26.09 O ATOM 290 CB GLN B 4 27.896 20.408 22.308 1.00 36.18 C ATOM 291 CG GLN B 4 27.512 20.391 23.830 1.00 38.50 C ATOM 292 CD GLN B 4 27.452 21.776 24.512 1.00 57.21 C ATOM 293 OE1 GLN B 4 26.793 22.724 24.047 1.00 43.91 O ATOM 294 NE2 GLN B 4 28.146 21.905 25.632 1.00 46.71 N ATOM 295 N LEU B 5 29.170 18.904 19.518 1.00 14.69 N ATOM 296 CA LEU B 5 29.339 18.804 18.051 1.00 21.18 C ATOM 297 C LEU B 5 28.757 17.484 17.612 1.00 24.84 C ATOM 298 O LEU B 5 28.015 17.412 16.640 1.00 32.38 O ATOM 299 CB LEU B 5 30.825 18.883 17.572 1.00 22.06 C ATOM 300 CG LEU B 5 31.472 20.291 17.390 1.00 21.82 C ATOM 301 CD1 LEU B 5 32.982 20.118 17.420 1.00 17.44 C ATOM 302 CD2 LEU B 5 31.137 20.919 16.036 1.00 1.00 C ATOM 303 N GLU B 6 29.111 16.436 18.366 1.00 24.52 N ATOM 304 CA GLU B 6 28.630 15.069 18.116 1.00 18.73 C ATOM 305 C GLU B 6 27.093 15.038 18.207 1.00 18.73 C ATOM 306 O GLU B 6 26.416 14.382 17.450 1.00 28.39 O ATOM 307 CB GLU B 6 29.286 14.059 19.100 1.00 12.75 C ATOM 308 CG GLU B 6 30.692 13.588 18.654 1.00 11.48 C ATOM 309 CD GLU B 6 31.612 13.219 19.802 1.00 9.88 C ATOM 310 OE1 GLU B 6 31.272 12.547 20.754 1.00 27.19 O ATOM 311 OE2 GLU B 6 32.804 13.766 19.703 1.00 43.54 O ATOM 312 N ASP B 7 26.576 15.806 19.159 1.00 21.32 N ATOM 313 CA ASP B 7 25.148 15.954 19.440 1.00 23.26 C ATOM 314 C ASP B 7 24.404 16.668 18.344 1.00 16.53 C ATOM 315 O ASP B 7 23.292 16.301 18.019 1.00 16.19 O ATOM 316 CB ASP B 7 24.914 16.688 20.767 1.00 25.69 C ATOM 317 CG ASP B 7 24.912 15.779 21.949 1.00 28.60 C ATOM 318 OD1 ASP B 7 25.118 14.587 21.845 1.00 30.54 O ATOM 319 OD2 ASP B 7 24.638 16.392 23.086 1.00 45.08 O ATOM 320 N LYS B 8 25.057 17.702 17.813 1.00 19.14 N ATOM 321 CA LYS B 8 24.549 18.543 16.730 1.00 20.08 C ATOM 322 C LYS B 8 24.452 17.735 15.429 1.00 21.90 C ATOM 323 O LYS B 8 23.549 17.935 14.599 1.00 26.80 O ATOM 324 CB LYS B 8 25.420 19.800 16.559 1.00 19.48 C ATOM 325 CG LYS B 8 25.098 20.593 15.325 1.00 14.94 C ATOM 326 CD LYS B 8 23.725 21.224 15.376 1.00 31.30 C ATOM 327 CE LYS B 8 23.702 22.576 16.066 1.00 54.77 C ATOM 328 NZ LYS B 8 22.402 23.244 15.954 1.00 54.98 N ATOM 329 N VAL B 9 25.391 16.800 15.263 1.00 18.04 N ATOM 330 CA VAL B 9 25.414 15.934 14.092 1.00 17.54 C ATOM 331 C VAL B 9 24.197 14.992 14.115 1.00 23.10 C ATOM 332 O VAL B 9 23.409 14.902 13.146 1.00 13.60 O ATOM 333 CB VAL B 9 26.744 15.156 13.981 1.00 14.48 C ATOM 334 CG1 VAL B 9 26.596 13.921 13.063 1.00 7.37 C ATOM 335 CG2 VAL B 9 27.821 16.071 13.382 1.00 12.99 C ATOM 336 N GLU B 10 24.053 14.290 15.251 1.00 20.97 N ATOM 337 CA GLU B 10 22.963 13.381 15.428 1.00 14.96 C ATOM 338 C GLU B 10 21.676 14.163 15.391 1.00 21.42 C ATOM 339 O GLU B 10 20.610 13.635 15.112 1.00 23.67 O ATOM 340 CB GLU B 10 23.066 12.632 16.760 1.00 18.96 C ATOM 341 CG GLU B 10 24.321 11.742 16.855 1.00 39.76 C ATOM 342 CD GLU B 10 24.751 11.443 18.275 1.00 59.85 C ATOM 343 OE1 GLU B 10 23.995 11.363 19.215 1.00 27.63 O ATOM 344 OE2 GLU B 10 26.039 11.348 18.388 1.00 62.27 O ATOM 345 N GLU B 11 21.773 15.448 15.671 1.00 25.34 N ATOM 346 CA GLU B 11 20.585 16.272 15.662 1.00 24.43 C ATOM 347 C GLU B 11 20.149 16.629 14.250 1.00 20.21 C ATOM 348 O GLU B 11 18.991 16.465 13.876 1.00 18.05 O ATOM 349 CB GLU B 11 20.640 17.444 16.662 1.00 26.32 C ATOM 350 CG GLU B 11 20.313 16.945 18.083 1.00 20.94 C ATOM 351 CD GLU B 11 20.477 17.987 19.134 1.00 53.16 C ATOM 352 OE1 GLU B 11 20.880 19.118 18.891 1.00 47.70 O ATOM 353 OE2 GLU B 11 20.151 17.537 20.333 1.00 35.90 O ATOM 354 N LEU B 12 21.109 17.099 13.462 1.00 19.50 N ATOM 355 CA LEU B 12 20.886 17.477 12.075 1.00 19.25 C ATOM 356 C LEU B 12 20.456 16.277 11.216 1.00 30.69 C ATOM 357 O LEU B 12 19.531 16.342 10.390 1.00 29.94 O ATOM 358 CB LEU B 12 22.187 18.050 11.485 1.00 15.75 C ATOM 359 CG LEU B 12 22.513 19.452 11.960 1.00 17.73 C ATOM 360 CD1 LEU B 12 23.991 19.703 11.786 1.00 17.72 C ATOM 361 CD2 LEU B 12 21.775 20.473 11.115 1.00 18.15 C ATOM 362 N LEU B 13 21.165 15.177 11.428 1.00 25.48 N ATOM 363 CA LEU B 13 20.958 13.928 10.726 1.00 23.68 C ATOM 364 C LEU B 13 19.536 13.359 10.817 1.00 25.56 C ATOM 365 O LEU B 13 19.042 12.718 9.881 1.00 23.55 O ATOM 366 CB LEU B 13 22.046 12.918 11.148 1.00 25.82 C ATOM 367 CG LEU B 13 22.002 11.587 10.406 1.00 27.83 C ATOM 368 CD1 LEU B 13 22.317 11.771 8.918 1.00 19.55 C ATOM 369 CD2 LEU B 13 22.978 10.611 11.065 1.00 29.38 C ATOM 370 N SER B 14 18.874 13.595 11.951 1.00 22.94 N ATOM 371 CA SER B 14 17.495 13.131 12.158 1.00 23.92 C ATOM 372 C SER B 14 16.512 14.054 11.458 1.00 22.29 C ATOM 373 O SER B 14 15.454 13.635 11.013 1.00 22.11 O ATOM 374 CB SER B 14 17.111 13.004 13.622 1.00 28.69 C ATOM 375 OG SER B 14 16.268 14.088 13.962 1.00 43.29 O ATOM 376 N LYS B 15 16.866 15.343 11.364 1.00 28.08 N ATOM 377 CA LYS B 15 16.004 16.295 10.684 1.00 24.28 C ATOM 378 C LYS B 15 16.097 15.979 9.214 1.00 22.18 C ATOM 379 O LYS B 15 15.163 16.088 8.454 1.00 19.39 O ATOM 380 CB LYS B 15 16.408 17.739 10.907 1.00 32.36 C ATOM 381 CG LYS B 15 15.493 18.734 10.215 1.00 42.35 C ATOM 382 CD LYS B 15 16.293 19.840 9.554 1.00 67.47 C ATOM 383 CE LYS B 15 15.736 21.233 9.799 1.00 90.64 C ATOM 384 NZ LYS B 15 14.391 21.428 9.240 1.00100.00 N ATOM 385 N GLN B 16 17.268 15.543 8.815 1.00 25.19 N ATOM 386 CA GLN B 16 17.470 15.188 7.442 1.00 24.05 C ATOM 387 C GLN B 16 16.569 14.051 6.988 1.00 28.18 C ATOM 388 O GLN B 16 16.058 14.076 5.872 1.00 33.14 O ATOM 389 CB GLN B 16 18.923 14.826 7.184 1.00 29.48 C ATOM 390 CG GLN B 16 19.079 14.214 5.797 1.00 39.15 C ATOM 391 CD GLN B 16 20.507 14.210 5.397 1.00 30.18 C ATOM 392 OE1 GLN B 16 21.073 15.273 5.114 1.00 32.90 O ATOM 393 NE2 GLN B 16 21.116 13.036 5.473 1.00 40.21 N ATOM 394 N TYR B 17 16.386 13.046 7.865 1.00 31.03 N ATOM 395 CA TYR B 17 15.547 11.872 7.580 1.00 22.07 C ATOM 396 C TYR B 17 14.092 12.262 7.499 1.00 21.68 C ATOM 397 O TYR B 17 13.335 11.743 6.682 1.00 19.34 O ATOM 398 CB TYR B 17 15.754 10.722 8.595 1.00 24.72 C ATOM 399 CG TYR B 17 17.124 10.088 8.480 1.00 32.95 C ATOM 400 CD1 TYR B 17 17.713 9.972 7.221 1.00 39.53 C ATOM 401 CD2 TYR B 17 17.831 9.599 9.581 1.00 31.56 C ATOM 402 CE1 TYR B 17 18.979 9.412 7.053 1.00 44.69 C ATOM 403 CE2 TYR B 17 19.093 9.020 9.434 1.00 31.41 C ATOM 404 CZ TYR B 17 19.665 8.935 8.164 1.00 34.41 C ATOM 405 OH TYR B 17 20.893 8.374 7.995 1.00 39.13 O ATOM 406 N HIS B 18 13.705 13.199 8.358 1.00 17.29 N ATOM 407 CA HIS B 18 12.329 13.663 8.367 1.00 24.03 C ATOM 408 C HIS B 18 11.959 14.566 7.175 1.00 28.19 C ATOM 409 O HIS B 18 10.805 14.619 6.749 1.00 36.48 O ATOM 410 CB HIS B 18 11.902 14.287 9.703 1.00 30.56 C ATOM 411 CG HIS B 18 10.588 14.957 9.536 1.00 35.05 C ATOM 412 ND1 HIS B 18 10.506 16.314 9.253 1.00 37.79 N ATOM 413 CD2 HIS B 18 9.330 14.447 9.566 1.00 38.77 C ATOM 414 CE1 HIS B 18 9.219 16.603 9.125 1.00 37.27 C ATOM 415 NE2 HIS B 18 8.487 15.503 9.322 1.00 38.79 N ATOM 416 N LEU B 19 12.931 15.297 6.640 1.00 21.01 N ATOM 417 CA LEU B 19 12.692 16.174 5.509 1.00 23.00 C ATOM 418 C LEU B 19 12.628 15.340 4.247 1.00 23.98 C ATOM 419 O LEU B 19 11.753 15.534 3.425 1.00 35.73 O ATOM 420 CB LEU B 19 13.769 17.277 5.365 1.00 28.83 C ATOM 421 CG LEU B 19 13.723 18.341 6.467 1.00 37.03 C ATOM 422 CD1 LEU B 19 14.579 19.551 6.084 1.00 30.99 C ATOM 423 CD2 LEU B 19 12.276 18.764 6.739 1.00 36.71 C ATOM 424 N GLU B 20 13.582 14.414 4.140 1.00 15.81 N ATOM 425 CA GLU B 20 13.720 13.482 3.036 1.00 14.11 C ATOM 426 C GLU B 20 12.423 12.735 2.783 1.00 21.63 C ATOM 427 O GLU B 20 11.932 12.708 1.652 1.00 32.46 O ATOM 428 CB GLU B 20 14.829 12.446 3.328 1.00 13.28 C ATOM 429 CG GLU B 20 16.212 12.778 2.769 1.00 20.72 C ATOM 430 CD GLU B 20 17.251 11.737 3.132 1.00 50.22 C ATOM 431 OE1 GLU B 20 17.005 10.743 3.778 1.00 55.96 O ATOM 432 OE2 GLU B 20 18.457 12.047 2.706 1.00 37.55 O ATOM 433 N ASN B 21 11.861 12.119 3.839 1.00 25.88 N ATOM 434 CA ASN B 21 10.602 11.372 3.707 1.00 26.17 C ATOM 435 C ASN B 21 9.412 12.292 3.427 1.00 29.39 C ATOM 436 O ASN B 21 8.337 11.873 2.963 1.00 19.77 O ATOM 437 CB ASN B 21 10.208 10.498 4.926 1.00 33.22 C ATOM 438 CG ASN B 21 11.288 10.003 5.856 1.00 27.83 C ATOM 439 OD1 ASN B 21 12.456 9.829 5.475 1.00 43.59 O ATOM 440 ND2 ASN B 21 10.869 9.748 7.098 1.00 21.95 N ATOM 441 N GLU B 22 9.586 13.558 3.745 1.00 33.12 N ATOM 442 CA GLU B 22 8.528 14.508 3.508 1.00 38.35 C ATOM 443 C GLU B 22 8.388 14.699 2.012 1.00 33.83 C ATOM 444 O GLU B 22 7.322 14.575 1.424 1.00 29.35 O ATOM 445 CB GLU B 22 8.844 15.853 4.169 1.00 42.94 C ATOM 446 CG GLU B 22 7.588 16.724 4.328 1.00 58.07 C ATOM 447 CD GLU B 22 7.918 18.113 4.743 1.00 42.87 C ATOM 448 OE1 GLU B 22 8.962 18.423 5.278 1.00 61.30 O ATOM 449 OE2 GLU B 22 6.999 18.959 4.405 1.00 35.58 O ATOM 450 N VAL B 23 9.524 15.011 1.421 1.00 31.26 N ATOM 451 CA VAL B 23 9.617 15.210 0.012 1.00 33.17 C ATOM 452 C VAL B 23 9.023 13.993 -0.640 1.00 40.06 C ATOM 453 O VAL B 23 8.078 14.078 -1.394 1.00 34.98 O ATOM 454 CB VAL B 23 11.082 15.337 -0.381 1.00 30.10 C ATOM 455 CG1 VAL B 23 11.187 15.536 -1.877 1.00 30.67 C ATOM 456 CG2 VAL B 23 11.710 16.520 0.350 1.00 27.95 C ATOM 457 N ALA B 24 9.594 12.840 -0.307 1.00 40.46 N ATOM 458 CA ALA B 24 9.117 11.596 -0.844 1.00 40.83 C ATOM 459 C ALA B 24 7.590 11.513 -0.811 1.00 48.69 C ATOM 460 O ALA B 24 6.977 11.129 -1.805 1.00 44.26 O ATOM 461 CB ALA B 24 9.783 10.423 -0.144 1.00 42.77 C ATOM 462 N ARG B 25 6.974 11.885 0.337 1.00 55.38 N ATOM 463 CA ARG B 25 5.509 11.864 0.496 1.00 52.45 C ATOM 464 C ARG B 25 4.839 12.865 -0.419 1.00 46.73 C ATOM 465 O ARG B 25 3.793 12.589 -0.977 1.00 48.08 O ATOM 466 CB ARG B 25 5.025 12.101 1.933 1.00 54.84 C ATOM 467 CG ARG B 25 5.628 11.166 2.989 1.00 83.68 C ATOM 468 CD ARG B 25 4.726 10.931 4.216 1.00100.00 C ATOM 469 NE ARG B 25 4.214 12.151 4.862 1.00100.00 N ATOM 470 CZ ARG B 25 4.892 12.872 5.767 1.00100.00 C ATOM 471 NH1 ARG B 25 6.125 12.539 6.165 1.00100.00 N ATOM 472 NH2 ARG B 25 4.326 13.964 6.292 1.00 80.62 N ATOM 473 N LEU B 26 5.475 14.031 -0.550 1.00 43.75 N ATOM 474 CA LEU B 26 5.019 15.146 -1.383 1.00 38.97 C ATOM 475 C LEU B 26 5.030 14.818 -2.872 1.00 33.38 C ATOM 476 O LEU B 26 4.137 15.228 -3.597 1.00 36.60 O ATOM 477 CB LEU B 26 5.816 16.453 -1.105 1.00 36.20 C ATOM 478 CG LEU B 26 5.205 17.368 -0.037 1.00 35.81 C ATOM 479 CD1 LEU B 26 6.174 18.483 0.326 1.00 29.87 C ATOM 480 CD2 LEU B 26 3.908 17.979 -0.556 1.00 39.89 C ATOM 481 N LYS B 27 6.051 14.081 -3.315 1.00 34.84 N ATOM 482 CA LYS B 27 6.195 13.679 -4.717 1.00 39.52 C ATOM 483 C LYS B 27 5.040 12.824 -5.168 1.00 49.85 C ATOM 484 O LYS B 27 4.587 12.907 -6.308 1.00 50.31 O ATOM 485 CB LYS B 27 7.482 12.929 -5.001 1.00 41.41 C ATOM 486 CG LYS B 27 8.638 13.811 -5.435 1.00 37.76 C ATOM 487 CD LYS B 27 9.967 13.108 -5.199 1.00 34.59 C ATOM 488 CE LYS B 27 11.131 14.064 -4.971 1.00 43.34 C ATOM 489 NZ LYS B 27 11.868 14.400 -6.197 1.00 48.58 N ATOM 490 N LYS B 28 4.557 11.971 -4.279 1.00 50.57 N ATOM 491 CA LYS B 28 3.453 11.165 -4.698 1.00 52.57 C ATOM 492 C LYS B 28 2.279 12.092 -4.939 1.00 58.20 C ATOM 493 O LYS B 28 1.933 12.374 -6.079 1.00 64.13 O ATOM 494 CB LYS B 28 3.159 9.976 -3.799 1.00 56.62 C ATOM 495 CG LYS B 28 4.385 9.102 -3.572 1.00 56.78 C ATOM 496 CD LYS B 28 4.138 7.623 -3.837 1.00 57.96 C ATOM 497 CE LYS B 28 2.859 7.093 -3.206 1.00 83.55 C ATOM 498 NZ LYS B 28 2.957 6.936 -1.748 1.00 96.97 N ATOM 499 N LEU B 29 1.700 12.612 -3.867 1.00 48.49 N ATOM 500 CA LEU B 29 0.581 13.536 -3.953 1.00 44.49 C ATOM 501 C LEU B 29 0.662 14.434 -5.209 1.00 53.63 C ATOM 502 O LEU B 29 -0.336 14.818 -5.808 1.00 50.87 O ATOM 503 CB LEU B 29 0.532 14.342 -2.634 1.00 41.06 C ATOM 504 CG LEU B 29 -0.307 15.607 -2.639 1.00 43.98 C ATOM 505 CD1 LEU B 29 -1.767 15.272 -2.377 1.00 48.15 C ATOM 506 CD2 LEU B 29 0.194 16.538 -1.544 1.00 39.54 C ATOM 507 N VAL B 30 1.886 14.762 -5.609 1.00 62.62 N ATOM 508 CA VAL B 30 2.166 15.597 -6.775 1.00 64.37 C ATOM 509 C VAL B 30 2.939 14.799 -7.830 1.00 87.14 C ATOM 510 O VAL B 30 2.364 14.171 -8.722 1.00 49.31 O ATOM 511 CB VAL B 30 2.948 16.849 -6.361 1.00 60.49 C ATOM 512 CG1 VAL B 30 3.066 17.830 -7.523 1.00 59.56 C ATOM 513 CG2 VAL B 30 2.259 17.515 -5.170 1.00 56.24 C