>>2HVH:HELIX   60  60 ASN D  780  GLU D  818  1                                  39    
NFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 60 60 ASN D 780 GLU D 818 1 39 ATOM 9338 N ASN D 780 148.058 -6.356 -8.101 1.00 38.70 N ATOM 9339 CA ASN D 780 147.461 -5.869 -9.335 1.00 38.78 C ATOM 9340 C ASN D 780 145.986 -5.537 -9.155 1.00 38.54 C ATOM 9341 O ASN D 780 145.246 -6.311 -8.557 1.00 38.80 O ATOM 9342 CB ASN D 780 147.673 -6.903 -10.442 1.00 38.88 C ATOM 9343 CG ASN D 780 146.944 -6.555 -11.713 1.00 40.08 C ATOM 9344 OD1 ASN D 780 145.726 -6.412 -11.714 1.00 42.30 O ATOM 9345 ND2 ASN D 780 147.679 -6.446 -12.814 1.00 40.44 N ATOM 9346 N PHE D 781 145.564 -4.387 -9.673 1.00 38.27 N ATOM 9347 CA PHE D 781 144.178 -3.940 -9.527 1.00 37.91 C ATOM 9348 C PHE D 781 143.182 -4.743 -10.371 1.00 37.44 C ATOM 9349 O PHE D 781 142.057 -5.000 -9.945 1.00 37.52 O ATOM 9350 CB PHE D 781 144.043 -2.437 -9.827 1.00 38.00 C ATOM 9351 CG PHE D 781 142.661 -1.889 -9.561 1.00 38.08 C ATOM 9352 CD1 PHE D 781 142.261 -1.579 -8.263 1.00 38.05 C ATOM 9353 CD2 PHE D 781 141.757 -1.699 -10.604 1.00 37.88 C ATOM 9354 CE1 PHE D 781 140.985 -1.088 -8.003 1.00 38.30 C ATOM 9355 CE2 PHE D 781 140.484 -1.208 -10.355 1.00 38.31 C ATOM 9356 CZ PHE D 781 140.098 -0.898 -9.047 1.00 38.23 C ATOM 9357 N ASN D 782 143.587 -5.123 -11.572 1.00 36.93 N ATOM 9358 CA ASN D 782 142.711 -5.893 -12.449 1.00 36.45 C ATOM 9359 C ASN D 782 142.467 -7.299 -11.898 1.00 35.55 C ATOM 9360 O ASN D 782 141.359 -7.813 -11.961 1.00 35.40 O ATOM 9361 CB ASN D 782 143.312 -5.986 -13.855 1.00 36.76 C ATOM 9362 CG ASN D 782 142.295 -6.421 -14.896 1.00 37.89 C ATOM 9363 OD1 ASN D 782 141.348 -5.691 -15.195 1.00 38.19 O ATOM 9364 ND2 ASN D 782 142.497 -7.608 -15.468 1.00 38.77 N ATOM 9365 N VAL D 783 143.512 -7.906 -11.345 1.00 34.52 N ATOM 9366 CA VAL D 783 143.433 -9.271 -10.837 1.00 33.24 C ATOM 9367 C VAL D 783 142.702 -9.294 -9.503 1.00 32.56 C ATOM 9368 O VAL D 783 141.943 -10.220 -9.211 1.00 32.00 O ATOM 9369 CB VAL D 783 144.847 -9.923 -10.732 1.00 33.26 C ATOM 9370 CG1 VAL D 783 144.807 -11.243 -9.988 1.00 32.59 C ATOM 9371 CG2 VAL D 783 145.438 -10.128 -12.122 1.00 32.76 C ATOM 9372 N ARG D 784 142.901 -8.250 -8.710 1.00 31.76 N ATOM 9373 CA ARG D 784 142.282 -8.204 -7.405 1.00 31.31 C ATOM 9374 C ARG D 784 140.786 -7.970 -7.530 1.00 30.18 C ATOM 9375 O ARG D 784 140.010 -8.486 -6.738 1.00 29.95 O ATOM 9376 CB ARG D 784 142.919 -7.129 -6.535 1.00 31.43 C ATOM 9377 CG ARG D 784 142.710 -7.364 -5.035 1.00 32.82 C ATOM 9378 CD ARG D 784 143.350 -6.288 -4.178 1.00 32.73 C ATOM 9379 NE ARG D 784 142.656 -5.017 -4.338 1.00 36.31 N ATOM 9380 CZ ARG D 784 143.088 -4.013 -5.094 1.00 37.82 C ATOM 9381 NH1 ARG D 784 144.240 -4.119 -5.760 1.00 37.90 N ATOM 9382 NH2 ARG D 784 142.364 -2.899 -5.176 1.00 38.90 N ATOM 9383 N SER D 785 140.386 -7.204 -8.540 1.00 29.18 N ATOM 9384 CA SER D 785 138.968 -6.923 -8.773 1.00 28.12 C ATOM 9385 C SER D 785 138.162 -8.156 -9.166 1.00 27.08 C ATOM 9386 O SER D 785 136.983 -8.265 -8.840 1.00 26.96 O ATOM 9387 CB SER D 785 138.796 -5.837 -9.828 1.00 28.02 C ATOM 9388 OG SER D 785 139.075 -4.568 -9.264 1.00 29.73 O ATOM 9389 N PHE D 786 138.786 -9.080 -9.878 1.00 25.95 N ATOM 9390 CA PHE D 786 138.074 -10.273 -10.261 1.00 25.05 C ATOM 9391 C PHE D 786 137.869 -11.140 -9.056 1.00 24.14 C ATOM 9392 O PHE D 786 136.789 -11.668 -8.849 1.00 24.28 O ATOM 9393 CB PHE D 786 138.790 -11.027 -11.375 1.00 25.14 C ATOM 9394 CG PHE D 786 138.442 -10.526 -12.728 1.00 25.80 C ATOM 9395 CD1 PHE D 786 137.325 -11.019 -13.391 1.00 26.76 C ATOM 9396 CD2 PHE D 786 139.194 -9.526 -13.329 1.00 25.57 C ATOM 9397 CE1 PHE D 786 136.983 -10.538 -14.650 1.00 26.21 C ATOM 9398 CE2 PHE D 786 138.862 -9.047 -14.578 1.00 25.60 C ATOM 9399 CZ PHE D 786 137.755 -9.552 -15.240 1.00 25.65 C ATOM 9400 N ALA D 787 138.912 -11.262 -8.250 1.00 23.22 N ATOM 9401 CA ALA D 787 138.865 -12.089 -7.066 1.00 21.93 C ATOM 9402 C ALA D 787 137.763 -11.605 -6.140 1.00 21.39 C ATOM 9403 O ALA D 787 136.991 -12.406 -5.612 1.00 21.25 O ATOM 9404 CB ALA D 787 140.196 -12.062 -6.368 1.00 21.78 C ATOM 9405 N GLU D 788 137.680 -10.289 -5.968 1.00 20.41 N ATOM 9406 CA GLU D 788 136.712 -9.693 -5.064 1.00 19.92 C ATOM 9407 C GLU D 788 135.287 -9.971 -5.508 1.00 18.86 C ATOM 9408 O GLU D 788 134.413 -10.256 -4.690 1.00 18.52 O ATOM 9409 CB GLU D 788 136.955 -8.187 -4.927 1.00 19.86 C ATOM 9410 CG GLU D 788 138.257 -7.855 -4.209 1.00 20.57 C ATOM 9411 CD GLU D 788 138.446 -6.363 -3.944 1.00 21.42 C ATOM 9412 OE1 GLU D 788 137.667 -5.551 -4.500 1.00 22.79 O ATOM 9413 OE2 GLU D 788 139.378 -6.008 -3.169 1.00 23.84 O ATOM 9414 N ARG D 789 135.063 -9.899 -6.811 1.00 18.12 N ATOM 9415 CA ARG D 789 133.739 -10.124 -7.355 1.00 17.55 C ATOM 9416 C ARG D 789 133.360 -11.597 -7.230 1.00 17.15 C ATOM 9417 O ARG D 789 132.187 -11.933 -7.097 1.00 17.22 O ATOM 9418 CB ARG D 789 133.622 -9.579 -8.786 1.00 17.41 C ATOM 9419 CG ARG D 789 133.632 -8.054 -8.846 1.00 17.02 C ATOM 9420 CD ARG D 789 133.205 -7.502 -10.205 1.00 17.70 C ATOM 9421 NE ARG D 789 134.093 -7.982 -11.265 1.00 18.38 N ATOM 9422 CZ ARG D 789 135.199 -7.362 -11.647 1.00 17.06 C ATOM 9423 NH1 ARG D 789 135.541 -6.213 -11.078 1.00 17.57 N ATOM 9424 NH2 ARG D 789 135.952 -7.886 -12.600 1.00 15.74 N ATOM 9425 N MET D 790 134.360 -12.468 -7.238 1.00 16.81 N ATOM 9426 CA MET D 790 134.136 -13.881 -6.952 1.00 16.89 C ATOM 9427 C MET D 790 133.789 -14.080 -5.458 1.00 16.18 C ATOM 9428 O MET D 790 133.056 -15.001 -5.106 1.00 16.23 O ATOM 9429 CB MET D 790 135.361 -14.715 -7.331 1.00 16.90 C ATOM 9430 CG MET D 790 135.764 -14.647 -8.791 1.00 16.72 C ATOM 9431 SD MET D 790 137.130 -15.788 -9.081 1.00 18.48 S ATOM 9432 CE MET D 790 137.317 -15.686 -10.875 1.00 16.45 C ATOM 9433 N ALA D 791 134.303 -13.220 -4.584 1.00 15.52 N ATOM 9434 CA ALA D 791 133.954 -13.305 -3.161 1.00 15.41 C ATOM 9435 C ALA D 791 132.499 -12.889 -2.909 1.00 15.35 C ATOM 9436 O ALA D 791 131.841 -13.406 -2.006 1.00 15.48 O ATOM 9437 CB ALA D 791 134.899 -12.474 -2.314 1.00 15.03 C ATOM 9438 N MET D 792 131.993 -11.959 -3.710 1.00 15.13 N ATOM 9439 CA MET D 792 130.603 -11.532 -3.572 1.00 15.20 C ATOM 9440 C MET D 792 129.618 -12.587 -4.116 1.00 14.50 C ATOM 9441 O MET D 792 128.646 -12.955 -3.459 1.00 14.18 O ATOM 9442 CB MET D 792 130.388 -10.188 -4.269 1.00 14.52 C ATOM 9443 CG MET D 792 131.337 -9.114 -3.784 1.00 15.33 C ATOM 9444 SD MET D 792 131.284 -7.580 -4.753 1.00 17.54 S ATOM 9445 CE MET D 792 132.819 -6.801 -4.221 1.00 17.07 C ATOM 9446 N ASN D 793 129.888 -13.081 -5.318 1.00 14.07 N ATOM 9447 CA ASN D 793 128.990 -14.014 -5.973 1.00 13.48 C ATOM 9448 C ASN D 793 128.999 -15.463 -5.444 1.00 12.70 C ATOM 9449 O ASN D 793 127.948 -16.059 -5.273 1.00 12.80 O ATOM 9450 CB ASN D 793 129.255 -13.987 -7.475 1.00 13.67 C ATOM 9451 CG ASN D 793 128.492 -15.043 -8.210 1.00 13.65 C ATOM 9452 OD1 ASN D 793 129.012 -16.132 -8.472 1.00 14.23 O ATOM 9453 ND2 ASN D 793 127.240 -14.752 -8.519 1.00 12.51 N ATOM 9454 N THR D 794 130.171 -16.018 -5.173 1.00 12.25 N ATOM 9455 CA THR D 794 130.280 -17.443 -4.752 1.00 11.85 C ATOM 9456 C THR D 794 129.423 -17.930 -3.569 1.00 11.73 C ATOM 9457 O THR D 794 128.725 -18.923 -3.693 1.00 11.53 O ATOM 9458 CB THR D 794 131.747 -17.890 -4.538 1.00 11.66 C ATOM 9459 OG1 THR D 794 132.433 -17.909 -5.800 1.00 10.03 O ATOM 9460 CG2 THR D 794 131.796 -19.265 -3.893 1.00 10.60 C ATOM 9461 N PRO D 795 129.478 -17.246 -2.419 1.00 11.90 N ATOM 9462 CA PRO D 795 128.628 -17.715 -1.330 1.00 11.99 C ATOM 9463 C PRO D 795 127.137 -17.649 -1.655 1.00 11.96 C ATOM 9464 O PRO D 795 126.362 -18.457 -1.149 1.00 12.42 O ATOM 9465 CB PRO D 795 128.969 -16.761 -0.179 1.00 12.01 C ATOM 9466 CG PRO D 795 130.310 -16.208 -0.527 1.00 12.07 C ATOM 9467 CD PRO D 795 130.286 -16.085 -2.012 1.00 12.22 C ATOM 9468 N ILE D 796 126.720 -16.711 -2.494 1.00 11.83 N ATOM 9469 CA ILE D 796 125.304 -16.632 -2.804 1.00 11.28 C ATOM 9470 C ILE D 796 124.959 -17.721 -3.811 1.00 11.35 C ATOM 9471 O ILE D 796 124.085 -18.569 -3.544 1.00 11.56 O ATOM 9472 CB ILE D 796 124.883 -15.260 -3.359 1.00 11.29 C ATOM 9473 CG1 ILE D 796 125.535 -14.116 -2.571 1.00 12.00 C ATOM 9474 CG2 ILE D 796 123.394 -15.137 -3.339 1.00 9.74 C ATOM 9475 CD1 ILE D 796 125.173 -14.084 -1.094 1.00 13.77 C ATOM 9476 N GLN D 797 125.657 -17.716 -4.948 1.00 10.51 N ATOM 9477 CA GLN D 797 125.402 -18.705 -5.993 1.00 10.35 C ATOM 9478 C GLN D 797 125.604 -20.140 -5.476 1.00 9.86 C ATOM 9479 O GLN D 797 124.824 -21.030 -5.781 1.00 9.68 O ATOM 9480 CB GLN D 797 126.250 -18.431 -7.254 1.00 10.01 C ATOM 9481 CG GLN D 797 125.807 -19.286 -8.464 1.00 10.66 C ATOM 9482 CD GLN D 797 126.706 -19.189 -9.703 1.00 10.70 C ATOM 9483 OE1 GLN D 797 127.369 -20.159 -10.067 1.00 11.05 O ATOM 9484 NE2 GLN D 797 126.722 -18.025 -10.353 1.00 9.39 N ATOM 9485 N GLY D 798 126.640 -20.347 -4.674 1.00 9.63 N ATOM 9486 CA GLY D 798 126.944 -21.665 -4.128 1.00 9.46 C ATOM 9487 C GLY D 798 125.937 -22.132 -3.095 1.00 9.91 C ATOM 9488 O GLY D 798 125.597 -23.338 -3.019 1.00 9.68 O ATOM 9489 N SER D 799 125.459 -21.201 -2.274 1.00 9.27 N ATOM 9490 CA SER D 799 124.450 -21.583 -1.312 1.00 9.26 C ATOM 9491 C SER D 799 123.185 -22.027 -2.051 1.00 9.10 C ATOM 9492 O SER D 799 122.553 -23.018 -1.661 1.00 9.47 O ATOM 9493 CB SER D 799 124.177 -20.470 -0.311 1.00 9.05 C ATOM 9494 OG SER D 799 125.342 -20.225 0.459 1.00 8.53 O ATOM 9495 N ALA D 800 122.853 -21.335 -3.145 1.00 8.81 N ATOM 9496 CA ALA D 800 121.653 -21.671 -3.928 1.00 8.08 C ATOM 9497 C ALA D 800 121.820 -23.054 -4.505 1.00 7.88 C ATOM 9498 O ALA D 800 120.864 -23.796 -4.639 1.00 7.86 O ATOM 9499 CB ALA D 800 121.412 -20.664 -5.014 1.00 7.51 C ATOM 9500 N ALA D 801 123.062 -23.403 -4.809 1.00 8.31 N ATOM 9501 CA ALA D 801 123.403 -24.714 -5.326 1.00 8.51 C ATOM 9502 C ALA D 801 123.227 -25.785 -4.254 1.00 9.14 C ATOM 9503 O ALA D 801 122.719 -26.874 -4.529 1.00 9.69 O ATOM 9504 CB ALA D 801 124.816 -24.710 -5.835 1.00 8.25 C ATOM 9505 N ASP D 802 123.632 -25.476 -3.025 1.00 9.39 N ATOM 9506 CA ASP D 802 123.518 -26.434 -1.933 1.00 9.25 C ATOM 9507 C ASP D 802 122.044 -26.721 -1.652 1.00 9.02 C ATOM 9508 O ASP D 802 121.667 -27.849 -1.316 1.00 8.96 O ATOM 9509 CB ASP D 802 124.175 -25.877 -0.659 1.00 9.61 C ATOM 9510 CG ASP D 802 125.696 -25.642 -0.804 1.00 11.12 C ATOM 9511 OD1 ASP D 802 126.187 -24.692 -0.139 1.00 13.23 O ATOM 9512 OD2 ASP D 802 126.388 -26.378 -1.561 1.00 7.85 O ATOM 9513 N ILE D 803 121.214 -25.688 -1.789 1.00 8.64 N ATOM 9514 CA ILE D 803 119.792 -25.784 -1.472 1.00 8.08 C ATOM 9515 C ILE D 803 119.024 -26.700 -2.427 1.00 8.03 C ATOM 9516 O ILE D 803 118.337 -27.632 -1.979 1.00 7.26 O ATOM 9517 CB ILE D 803 119.133 -24.395 -1.416 1.00 8.35 C ATOM 9518 CG1 ILE D 803 119.706 -23.607 -0.232 1.00 8.68 C ATOM 9519 CG2 ILE D 803 117.619 -24.518 -1.350 1.00 6.40 C ATOM 9520 CD1 ILE D 803 119.328 -22.132 -0.200 1.00 9.30 C ATOM 9521 N ILE D 804 119.153 -26.457 -3.731 1.00 7.51 N ATOM 9522 CA ILE D 804 118.432 -27.286 -4.692 1.00 7.19 C ATOM 9523 C ILE D 804 118.901 -28.732 -4.673 1.00 7.30 C ATOM 9524 O ILE D 804 118.118 -29.654 -4.920 1.00 7.16 O ATOM 9525 CB ILE D 804 118.444 -26.692 -6.137 1.00 7.32 C ATOM 9526 CG1 ILE D 804 117.535 -27.527 -7.048 1.00 6.60 C ATOM 9527 CG2 ILE D 804 119.859 -26.589 -6.689 1.00 6.51 C ATOM 9528 CD1 ILE D 804 116.927 -26.758 -8.149 1.00 6.99 C ATOM 9529 N LYS D 805 120.175 -28.933 -4.367 1.00 7.86 N ATOM 9530 CA LYS D 805 120.718 -30.281 -4.275 1.00 8.70 C ATOM 9531 C LYS D 805 120.070 -31.048 -3.117 1.00 9.44 C ATOM 9532 O LYS D 805 119.787 -32.253 -3.232 1.00 9.69 O ATOM 9533 CB LYS D 805 122.232 -30.245 -4.117 1.00 8.83 C ATOM 9534 CG LYS D 805 122.994 -29.973 -5.397 1.00 8.97 C ATOM 9535 CD LYS D 805 124.486 -30.035 -5.117 1.00 10.76 C ATOM 9536 CE LYS D 805 125.305 -29.752 -6.352 1.00 11.56 C ATOM 9537 NZ LYS D 805 126.756 -29.885 -6.042 1.00 12.72 N ATOM 9538 N LYS D 806 119.807 -30.344 -2.012 1.00 9.78 N ATOM 9539 CA LYS D 806 119.192 -30.985 -0.868 1.00 10.03 C ATOM 9540 C LYS D 806 117.741 -31.249 -1.211 1.00 10.53 C ATOM 9541 O LYS D 806 117.161 -32.279 -0.826 1.00 11.13 O ATOM 9542 CB LYS D 806 119.338 -30.143 0.395 1.00 9.78 C ATOM 9543 CG LYS D 806 119.116 -30.934 1.644 1.00 9.20 C ATOM 9544 CD LYS D 806 119.318 -30.068 2.888 1.00 10.81 C ATOM 9545 CE LYS D 806 118.951 -30.815 4.177 1.00 9.08 C ATOM 9546 NZ LYS D 806 117.498 -31.216 4.236 1.00 9.29 N ATOM 9547 N ALA D 807 117.165 -30.332 -1.970 1.00 10.63 N ATOM 9548 CA ALA D 807 115.811 -30.501 -2.449 1.00 11.21 C ATOM 9549 C ALA D 807 115.682 -31.772 -3.294 1.00 11.48 C ATOM 9550 O ALA D 807 114.715 -32.490 -3.164 1.00 11.36 O ATOM 9551 CB ALA D 807 115.370 -29.282 -3.238 1.00 11.24 C ATOM 9552 N MET D 808 116.654 -32.051 -4.157 1.00 12.45 N ATOM 9553 CA MET D 808 116.584 -33.256 -4.998 1.00 13.28 C ATOM 9554 C MET D 808 116.642 -34.519 -4.161 1.00 13.51 C ATOM 9555 O MET D 808 115.930 -35.481 -4.445 1.00 13.83 O ATOM 9556 CB MET D 808 117.707 -33.285 -6.033 1.00 13.07 C ATOM 9557 CG MET D 808 117.566 -32.227 -7.086 1.00 13.40 C ATOM 9558 SD MET D 808 119.018 -32.050 -8.144 1.00 13.60 S ATOM 9559 CE MET D 808 118.860 -33.437 -9.270 1.00 11.95 C ATOM 9560 N ILE D 809 117.487 -34.506 -3.131 1.00 13.63 N ATOM 9561 CA ILE D 809 117.643 -35.662 -2.250 1.00 13.63 C ATOM 9562 C ILE D 809 116.385 -35.885 -1.418 1.00 13.79 C ATOM 9563 O ILE D 809 115.916 -37.015 -1.260 1.00 13.95 O ATOM 9564 CB ILE D 809 118.864 -35.506 -1.321 1.00 13.86 C ATOM 9565 CG1 ILE D 809 120.157 -35.383 -2.137 1.00 13.50 C ATOM 9566 CG2 ILE D 809 118.971 -36.685 -0.347 1.00 13.12 C ATOM 9567 CD1 ILE D 809 121.318 -34.822 -1.334 1.00 11.57 C ATOM 9568 N ASP D 810 115.842 -34.801 -0.885 1.00 13.82 N ATOM 9569 CA ASP D 810 114.628 -34.884 -0.093 1.00 13.83 C ATOM 9570 C ASP D 810 113.460 -35.332 -0.950 1.00 13.74 C ATOM 9571 O ASP D 810 112.637 -36.141 -0.498 1.00 13.85 O ATOM 9572 CB ASP D 810 114.318 -33.544 0.575 1.00 13.88 C ATOM 9573 CG ASP D 810 115.312 -33.201 1.666 1.00 15.10 C ATOM 9574 OD1 ASP D 810 116.171 -34.070 1.963 1.00 16.74 O ATOM 9575 OD2 ASP D 810 115.236 -32.081 2.228 1.00 13.95 O ATOM 9576 N LEU D 811 113.398 -34.817 -2.179 1.00 13.26 N ATOM 9577 CA LEU D 811 112.326 -35.158 -3.105 1.00 13.52 C ATOM 9578 C LEU D 811 112.348 -36.647 -3.442 1.00 14.33 C ATOM 9579 O LEU D 811 111.314 -37.324 -3.470 1.00 14.21 O ATOM 9580 CB LEU D 811 112.425 -34.330 -4.387 1.00 13.26 C ATOM 9581 CG LEU D 811 111.360 -34.555 -5.462 1.00 12.29 C ATOM 9582 CD1 LEU D 811 109.964 -34.426 -4.874 1.00 11.64 C ATOM 9583 CD2 LEU D 811 111.535 -33.572 -6.592 1.00 12.68 C ATOM 9584 N ASN D 812 113.543 -37.152 -3.689 1.00 15.16 N ATOM 9585 CA ASN D 812 113.710 -38.542 -4.029 1.00 16.24 C ATOM 9586 C ASN D 812 113.193 -39.422 -2.897 1.00 16.75 C ATOM 9587 O ASN D 812 112.503 -40.410 -3.129 1.00 17.18 O ATOM 9588 CB ASN D 812 115.182 -38.810 -4.274 1.00 16.61 C ATOM 9589 CG ASN D 812 115.405 -39.959 -5.199 1.00 17.02 C ATOM 9590 OD1 ASN D 812 115.052 -39.895 -6.373 1.00 17.74 O ATOM 9591 ND2 ASN D 812 116.014 -41.016 -4.687 1.00 17.95 N ATOM 9592 N ALA D 813 113.520 -39.037 -1.666 1.00 17.46 N ATOM 9593 CA ALA D 813 113.074 -39.749 -0.473 1.00 17.77 C ATOM 9594 C ALA D 813 111.560 -39.816 -0.396 1.00 18.14 C ATOM 9595 O ALA D 813 111.010 -40.887 -0.190 1.00 18.17 O ATOM 9596 CB ALA D 813 113.635 -39.095 0.769 1.00 17.54 C ATOM 9597 N ARG D 814 110.895 -38.675 -0.578 1.00 18.98 N ATOM 9598 CA ARG D 814 109.435 -38.618 -0.528 1.00 19.73 C ATOM 9599 C ARG D 814 108.761 -39.477 -1.595 1.00 19.68 C ATOM 9600 O ARG D 814 107.841 -40.214 -1.283 1.00 19.67 O ATOM 9601 CB ARG D 814 108.911 -37.184 -0.631 1.00 19.80 C ATOM 9602 CG ARG D 814 109.249 -36.246 0.528 1.00 22.98 C ATOM 9603 CD ARG D 814 108.581 -36.627 1.849 1.00 27.39 C ATOM 9604 NE ARG D 814 107.179 -37.008 1.674 1.00 31.65 N ATOM 9605 CZ ARG D 814 106.150 -36.171 1.780 1.00 33.49 C ATOM 9606 NH1 ARG D 814 106.363 -34.892 2.061 1.00 33.75 N ATOM 9607 NH2 ARG D 814 104.910 -36.616 1.601 1.00 33.82 N ATOM 9608 N LEU D 815 109.200 -39.375 -2.847 1.00 20.17 N ATOM 9609 CA LEU D 815 108.576 -40.145 -3.934 1.00 20.84 C ATOM 9610 C LEU D 815 108.578 -41.630 -3.613 1.00 21.49 C ATOM 9611 O LEU D 815 107.565 -42.294 -3.732 1.00 21.38 O ATOM 9612 CB LEU D 815 109.269 -39.883 -5.272 1.00 20.21 C ATOM 9613 CG LEU D 815 109.181 -38.432 -5.753 1.00 21.13 C ATOM 9614 CD1 LEU D 815 110.088 -38.159 -6.961 1.00 20.63 C ATOM 9615 CD2 LEU D 815 107.736 -38.025 -6.057 1.00 20.84 C ATOM 9616 N LYS D 816 109.729 -42.132 -3.190 1.00 22.94 N ATOM 9617 CA LYS D 816 109.871 -43.515 -2.788 1.00 24.57 C ATOM 9618 C LYS D 816 108.925 -43.832 -1.636 1.00 24.92 C ATOM 9619 O LYS D 816 108.128 -44.768 -1.711 1.00 25.66 O ATOM 9620 CB LYS D 816 111.320 -43.808 -2.382 1.00 24.67 C ATOM 9621 CG LYS D 816 111.514 -45.182 -1.741 1.00 25.48 C ATOM 9622 CD LYS D 816 113.001 -45.569 -1.598 1.00 25.80 C ATOM 9623 CE LYS D 816 113.148 -47.014 -1.106 1.00 26.70 C ATOM 9624 NZ LYS D 816 114.553 -47.520 -1.256 1.00 28.43 N ATOM 9625 N GLU D 817 109.020 -43.050 -0.571 1.00 25.25 N ATOM 9626 CA GLU D 817 108.164 -43.206 0.596 1.00 25.71 C ATOM 9627 C GLU D 817 106.677 -43.244 0.197 1.00 25.78 C ATOM 9628 O GLU D 817 105.911 -44.025 0.733 1.00 26.16 O ATOM 9629 CB GLU D 817 108.485 -42.080 1.585 1.00 25.80 C ATOM 9630 CG GLU D 817 107.496 -41.797 2.698 1.00 27.32 C ATOM 9631 CD GLU D 817 107.502 -40.302 3.096 1.00 30.19 C ATOM 9632 OE1 GLU D 817 108.597 -39.684 3.183 1.00 30.49 O ATOM 9633 OE2 GLU D 817 106.403 -39.735 3.304 1.00 31.34 O ATOM 9634 N GLU D 818 106.278 -42.431 -0.771 1.00 26.07 N ATOM 9635 CA GLU D 818 104.889 -42.411 -1.234 1.00 26.23 C ATOM 9636 C GLU D 818 104.596 -43.477 -2.295 1.00 25.96 C ATOM 9637 O GLU D 818 103.460 -43.618 -2.732 1.00 25.83 O ATOM 9638 CB GLU D 818 104.555 -41.041 -1.829 1.00 26.34 C ATOM 9639 CG GLU D 818 104.856 -39.877 -0.917 1.00 27.93 C ATOM 9640 CD GLU D 818 103.765 -39.630 0.091 1.00 28.61 C ATOM 9641 OE1 GLU D 818 104.090 -39.466 1.284 1.00 29.70 O ATOM 9642 OE2 GLU D 818 102.590 -39.602 -0.316 1.00 28.60 O