>>2IAG:HELIX   29  29 THR B  189  GLY B  220  1                                  32    
THESQAQDRVHSADVFHTFRQLDRLLPKLARG
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 29 29 THR B 189 GLY B 220 1 32 ATOM 5155 N THR B 189 21.482 17.500 45.504 1.00 32.39 N ATOM 5156 CA THR B 189 20.194 17.098 44.942 1.00 30.98 C ATOM 5157 C THR B 189 19.111 17.269 46.019 1.00 30.60 C ATOM 5158 O THR B 189 19.427 17.679 47.136 1.00 30.34 O ATOM 5159 CB THR B 189 20.268 15.628 44.481 1.00 30.97 C ATOM 5160 OG1 THR B 189 20.533 14.781 45.612 1.00 29.55 O ATOM 5161 CG2 THR B 189 21.389 15.435 43.439 1.00 29.69 C ATOM 5162 N HIS B 190 17.846 16.984 45.696 1.00 29.75 N ATOM 5163 CA HIS B 190 16.786 17.017 46.720 1.00 29.18 C ATOM 5164 C HIS B 190 16.910 15.884 47.745 1.00 28.10 C ATOM 5165 O HIS B 190 16.629 16.078 48.929 1.00 27.18 O ATOM 5166 CB HIS B 190 15.364 17.141 46.122 1.00 29.75 C ATOM 5167 CG HIS B 190 14.768 15.859 45.608 1.00 31.30 C ATOM 5168 ND1 HIS B 190 14.165 14.930 46.433 1.00 31.93 N ATOM 5169 CD2 HIS B 190 14.613 15.391 44.344 1.00 32.81 C ATOM 5170 CE1 HIS B 190 13.701 13.928 45.706 1.00 31.39 C ATOM 5171 NE2 HIS B 190 13.965 14.179 44.435 1.00 33.34 N ATOM 5172 N GLU B 191 17.378 14.727 47.279 1.00 27.37 N ATOM 5173 CA GLU B 191 17.626 13.564 48.131 1.00 27.50 C ATOM 5174 C GLU B 191 18.818 13.747 49.085 1.00 26.50 C ATOM 5175 O GLU B 191 18.745 13.363 50.249 1.00 25.68 O ATOM 5176 CB GLU B 191 17.828 12.296 47.291 1.00 28.22 C ATOM 5177 CG GLU B 191 16.649 11.930 46.398 1.00 29.83 C ATOM 5178 CD GLU B 191 16.818 12.383 44.958 1.00 34.40 C ATOM 5179 OE1 GLU B 191 16.206 11.729 44.081 1.00 37.04 O ATOM 5180 OE2 GLU B 191 17.560 13.365 44.681 1.00 35.54 O ATOM 5181 N SER B 192 19.899 14.337 48.586 1.00 25.79 N ATOM 5182 CA SER B 192 21.085 14.560 49.413 1.00 25.83 C ATOM 5183 C SER B 192 20.829 15.629 50.484 1.00 25.35 C ATOM 5184 O SER B 192 21.235 15.456 51.635 1.00 24.98 O ATOM 5185 CB SER B 192 22.295 14.910 48.553 1.00 25.10 C ATOM 5186 OG SER B 192 22.254 16.265 48.173 1.00 26.25 O ATOM 5187 N GLN B 193 20.124 16.706 50.105 1.00 25.32 N ATOM 5188 CA GLN B 193 19.783 17.791 51.039 1.00 25.03 C ATOM 5189 C GLN B 193 18.795 17.337 52.108 1.00 24.60 C ATOM 5190 O GLN B 193 18.889 17.754 53.274 1.00 24.83 O ATOM 5191 CB GLN B 193 19.242 19.024 50.304 1.00 24.97 C ATOM 5192 CG GLN B 193 20.313 19.826 49.577 1.00 27.21 C ATOM 5193 CD GLN B 193 19.894 21.252 49.185 1.00 29.69 C ATOM 5194 OE1 GLN B 193 20.723 22.036 48.754 1.00 32.10 O ATOM 5195 NE2 GLN B 193 18.612 21.580 49.322 1.00 31.96 N ATOM 5196 N ALA B 194 17.853 16.486 51.707 1.00 23.55 N ATOM 5197 CA ALA B 194 16.904 15.871 52.632 1.00 23.14 C ATOM 5198 C ALA B 194 17.651 14.959 53.617 1.00 23.04 C ATOM 5199 O ALA B 194 17.316 14.900 54.799 1.00 21.90 O ATOM 5200 CB ALA B 194 15.846 15.074 51.862 1.00 22.94 C ATOM 5201 N GLN B 195 18.665 14.254 53.115 1.00 23.20 N ATOM 5202 CA GLN B 195 19.543 13.458 53.973 1.00 24.15 C ATOM 5203 C GLN B 195 20.405 14.350 54.889 1.00 23.33 C ATOM 5204 O GLN B 195 20.583 14.012 56.055 1.00 23.41 O ATOM 5205 CB GLN B 195 20.392 12.476 53.135 1.00 25.06 C ATOM 5206 CG GLN B 195 21.238 11.440 53.934 1.00 28.64 C ATOM 5207 CD GLN B 195 20.472 10.697 55.053 1.00 35.35 C ATOM 5208 OE1 GLN B 195 21.087 10.236 56.023 1.00 37.82 O ATOM 5209 NE2 GLN B 195 19.136 10.585 54.926 1.00 36.41 N ATOM 5210 N ASP B 196 20.894 15.487 54.371 1.00 22.57 N ATOM 5211 CA ASP B 196 21.620 16.498 55.186 1.00 22.71 C ATOM 5212 C ASP B 196 20.781 16.926 56.392 1.00 21.85 C ATOM 5213 O ASP B 196 21.290 17.083 57.502 1.00 21.68 O ATOM 5214 CB ASP B 196 21.993 17.764 54.376 1.00 22.45 C ATOM 5215 CG ASP B 196 23.237 17.601 53.492 1.00 24.24 C ATOM 5216 OD1 ASP B 196 24.126 16.807 53.855 1.00 23.86 O ATOM 5217 OD2 ASP B 196 23.330 18.299 52.417 1.00 25.85 O ATOM 5218 N ARG B 197 19.489 17.113 56.162 1.00 21.32 N ATOM 5219 CA ARG B 197 18.577 17.568 57.190 1.00 21.02 C ATOM 5220 C ARG B 197 18.314 16.513 58.280 1.00 20.42 C ATOM 5221 O ARG B 197 18.323 16.831 59.462 1.00 19.31 O ATOM 5222 CB ARG B 197 17.277 18.109 56.553 1.00 21.32 C ATOM 5223 CG ARG B 197 17.482 19.493 55.886 1.00 24.08 C ATOM 5224 CD ARG B 197 16.234 20.095 55.203 1.00 29.20 C ATOM 5225 NE ARG B 197 15.008 19.688 55.867 1.00 34.26 N ATOM 5226 CZ ARG B 197 14.103 18.864 55.348 1.00 36.56 C ATOM 5227 NH1 ARG B 197 14.248 18.380 54.118 1.00 36.88 N ATOM 5228 NH2 ARG B 197 13.039 18.540 56.065 1.00 36.83 N ATOM 5229 N VAL B 198 18.090 15.270 57.864 1.00 19.81 N ATOM 5230 CA VAL B 198 17.948 14.118 58.772 1.00 19.63 C ATOM 5231 C VAL B 198 19.232 13.823 59.581 1.00 18.76 C ATOM 5232 O VAL B 198 19.177 13.708 60.786 1.00 18.39 O ATOM 5233 CB VAL B 198 17.585 12.794 57.985 1.00 19.58 C ATOM 5234 CG1 VAL B 198 17.640 11.599 58.929 1.00 20.65 C ATOM 5235 CG2 VAL B 198 16.207 12.890 57.321 1.00 18.80 C ATOM 5236 N HIS B 199 20.367 13.674 58.898 1.00 18.53 N ATOM 5237 CA HIS B 199 21.643 13.409 59.561 1.00 18.76 C ATOM 5238 C HIS B 199 21.971 14.519 60.562 1.00 18.37 C ATOM 5239 O HIS B 199 22.174 14.255 61.724 1.00 18.28 O ATOM 5240 CB HIS B 199 22.773 13.220 58.528 1.00 19.51 C ATOM 5241 CG HIS B 199 24.148 13.103 59.126 1.00 20.82 C ATOM 5242 ND1 HIS B 199 24.483 12.151 60.070 1.00 22.23 N ATOM 5243 CD2 HIS B 199 25.278 13.812 58.898 1.00 22.42 C ATOM 5244 CE1 HIS B 199 25.755 12.285 60.402 1.00 21.70 C ATOM 5245 NE2 HIS B 199 26.260 13.288 59.707 1.00 23.28 N ATOM 5246 N SER B 200 21.959 15.768 60.119 1.00 18.34 N ATOM 5247 CA SER B 200 22.282 16.883 61.010 1.00 18.18 C ATOM 5248 C SER B 200 21.350 16.998 62.220 1.00 18.42 C ATOM 5249 O SER B 200 21.790 17.421 63.294 1.00 17.99 O ATOM 5250 CB SER B 200 22.320 18.200 60.233 1.00 17.94 C ATOM 5251 OG SER B 200 21.021 18.598 59.834 1.00 17.30 O ATOM 5252 N ALA B 201 20.071 16.626 62.060 1.00 18.97 N ATOM 5253 CA ALA B 201 19.132 16.687 63.192 1.00 19.15 C ATOM 5254 C ALA B 201 19.489 15.604 64.207 1.00 19.42 C ATOM 5255 O ALA B 201 19.408 15.813 65.414 1.00 20.54 O ATOM 5256 CB ALA B 201 17.666 16.547 62.731 1.00 19.24 C ATOM 5257 N ASP B 202 19.926 14.463 63.708 1.00 20.34 N ATOM 5258 CA ASP B 202 20.392 13.357 64.561 1.00 21.29 C ATOM 5259 C ASP B 202 21.624 13.787 65.381 1.00 20.61 C ATOM 5260 O ASP B 202 21.641 13.687 66.602 1.00 21.30 O ATOM 5261 CB ASP B 202 20.642 12.122 63.681 1.00 21.80 C ATOM 5262 CG ASP B 202 21.144 10.918 64.462 1.00 24.43 C ATOM 5263 OD1 ASP B 202 20.672 10.691 65.594 1.00 27.64 O ATOM 5264 OD2 ASP B 202 22.007 10.193 63.921 1.00 25.40 O ATOM 5265 N VAL B 203 22.639 14.309 64.706 1.00 20.61 N ATOM 5266 CA VAL B 203 23.799 14.936 65.373 1.00 18.96 C ATOM 5267 C VAL B 203 23.380 15.990 66.426 1.00 18.43 C ATOM 5268 O VAL B 203 23.846 15.970 67.560 1.00 17.51 O ATOM 5269 CB VAL B 203 24.754 15.560 64.308 1.00 19.27 C ATOM 5270 CG1 VAL B 203 25.834 16.423 64.959 1.00 18.67 C ATOM 5271 CG2 VAL B 203 25.369 14.468 63.431 1.00 17.43 C ATOM 5272 N PHE B 204 22.497 16.914 66.052 1.00 18.54 N ATOM 5273 CA PHE B 204 22.042 17.924 66.997 1.00 18.04 C ATOM 5274 C PHE B 204 21.390 17.331 68.249 1.00 18.83 C ATOM 5275 O PHE B 204 21.721 17.730 69.371 1.00 18.63 O ATOM 5276 CB PHE B 204 21.078 18.928 66.356 1.00 17.50 C ATOM 5277 CG PHE B 204 20.425 19.850 67.361 1.00 16.50 C ATOM 5278 CD1 PHE B 204 21.163 20.856 67.979 1.00 15.41 C ATOM 5279 CD2 PHE B 204 19.083 19.691 67.715 1.00 15.73 C ATOM 5280 CE1 PHE B 204 20.572 21.711 68.918 1.00 15.59 C ATOM 5281 CE2 PHE B 204 18.473 20.540 68.650 1.00 14.68 C ATOM 5282 CZ PHE B 204 19.220 21.544 69.265 1.00 15.25 C ATOM 5283 N HIS B 205 20.448 16.407 68.064 1.00 19.73 N ATOM 5284 CA HIS B 205 19.732 15.853 69.208 1.00 20.82 C ATOM 5285 C HIS B 205 20.687 15.098 70.123 1.00 20.31 C ATOM 5286 O HIS B 205 20.673 15.319 71.321 1.00 19.50 O ATOM 5287 CB HIS B 205 18.469 15.070 68.799 1.00 22.13 C ATOM 5288 CG HIS B 205 17.393 15.958 68.243 1.00 26.61 C ATOM 5289 ND1 HIS B 205 16.652 16.814 69.035 1.00 28.46 N ATOM 5290 CD2 HIS B 205 16.989 16.185 66.966 1.00 29.34 C ATOM 5291 CE1 HIS B 205 15.821 17.505 68.274 1.00 29.15 C ATOM 5292 NE2 HIS B 205 16.006 17.144 67.014 1.00 29.30 N ATOM 5293 N THR B 206 21.575 14.283 69.557 1.00 20.17 N ATOM 5294 CA THR B 206 22.599 13.632 70.369 1.00 19.65 C ATOM 5295 C THR B 206 23.543 14.654 71.016 1.00 19.01 C ATOM 5296 O THR B 206 23.882 14.537 72.186 1.00 19.14 O ATOM 5297 CB THR B 206 23.422 12.634 69.552 1.00 19.94 C ATOM 5298 OG1 THR B 206 22.534 11.753 68.862 1.00 21.65 O ATOM 5299 CG2 THR B 206 24.340 11.843 70.454 1.00 18.13 C ATOM 5300 N PHE B 207 23.958 15.657 70.255 1.00 18.89 N ATOM 5301 CA PHE B 207 24.822 16.708 70.801 1.00 18.50 C ATOM 5302 C PHE B 207 24.193 17.401 72.024 1.00 18.14 C ATOM 5303 O PHE B 207 24.886 17.692 73.001 1.00 17.35 O ATOM 5304 CB PHE B 207 25.197 17.745 69.717 1.00 18.53 C ATOM 5305 CG PHE B 207 26.023 18.896 70.239 1.00 18.59 C ATOM 5306 CD1 PHE B 207 27.421 18.808 70.289 1.00 21.16 C ATOM 5307 CD2 PHE B 207 25.404 20.056 70.719 1.00 19.03 C ATOM 5308 CE1 PHE B 207 28.201 19.877 70.799 1.00 20.36 C ATOM 5309 CE2 PHE B 207 26.166 21.139 71.215 1.00 19.93 C ATOM 5310 CZ PHE B 207 27.564 21.049 71.256 1.00 20.02 C ATOM 5311 N ARG B 208 22.896 17.699 71.957 1.00 18.92 N ATOM 5312 CA ARG B 208 22.228 18.399 73.071 1.00 19.52 C ATOM 5313 C ARG B 208 22.255 17.580 74.338 1.00 19.10 C ATOM 5314 O ARG B 208 22.288 18.132 75.412 1.00 18.96 O ATOM 5315 CB ARG B 208 20.789 18.801 72.749 1.00 19.37 C ATOM 5316 CG ARG B 208 20.644 20.093 71.952 1.00 23.32 C ATOM 5317 CD ARG B 208 21.116 21.346 72.711 1.00 26.05 C ATOM 5318 NE ARG B 208 20.118 21.814 73.672 1.00 28.17 N ATOM 5319 CZ ARG B 208 20.400 22.336 74.858 1.00 30.22 C ATOM 5320 NH1 ARG B 208 21.663 22.465 75.273 1.00 29.63 N ATOM 5321 NH2 ARG B 208 19.406 22.724 75.644 1.00 32.09 N ATOM 5322 N GLN B 209 22.233 16.258 74.207 1.00 19.79 N ATOM 5323 CA GLN B 209 22.324 15.371 75.377 1.00 20.16 C ATOM 5324 C GLN B 209 23.691 15.513 76.050 1.00 19.80 C ATOM 5325 O GLN B 209 23.772 15.624 77.269 1.00 19.59 O ATOM 5326 CB GLN B 209 22.053 13.904 74.978 1.00 20.79 C ATOM 5327 CG GLN B 209 20.600 13.614 74.561 1.00 23.28 C ATOM 5328 CD GLN B 209 20.385 12.192 74.079 1.00 26.36 C ATOM 5329 OE1 GLN B 209 19.972 11.332 74.839 1.00 31.15 O ATOM 5330 NE2 GLN B 209 20.678 11.938 72.809 1.00 29.73 N ATOM 5331 N LEU B 210 24.764 15.507 75.254 1.00 19.58 N ATOM 5332 CA LEU B 210 26.102 15.745 75.789 1.00 19.89 C ATOM 5333 C LEU B 210 26.137 17.119 76.437 1.00 20.34 C ATOM 5334 O LEU B 210 26.514 17.251 77.598 1.00 20.15 O ATOM 5335 CB LEU B 210 27.182 15.638 74.691 1.00 19.45 C ATOM 5336 CG LEU B 210 28.655 15.737 75.115 1.00 19.56 C ATOM 5337 CD1 LEU B 210 29.551 14.883 74.208 1.00 17.90 C ATOM 5338 CD2 LEU B 210 29.123 17.175 75.098 1.00 19.11 C ATOM 5339 N ASP B 211 25.718 18.129 75.674 1.00 21.32 N ATOM 5340 CA ASP B 211 25.785 19.528 76.088 1.00 22.01 C ATOM 5341 C ASP B 211 25.061 19.761 77.413 1.00 22.88 C ATOM 5342 O ASP B 211 25.529 20.525 78.260 1.00 22.33 O ATOM 5343 CB ASP B 211 25.199 20.432 75.005 1.00 21.78 C ATOM 5344 CG ASP B 211 25.412 21.909 75.294 1.00 22.59 C ATOM 5345 OD1 ASP B 211 26.556 22.323 75.604 1.00 20.40 O ATOM 5346 OD2 ASP B 211 24.433 22.666 75.172 1.00 24.96 O ATOM 5347 N ARG B 212 23.926 19.099 77.598 1.00 24.10 N ATOM 5348 CA ARG B 212 23.183 19.230 78.845 1.00 25.49 C ATOM 5349 C ARG B 212 23.954 18.670 80.047 1.00 25.66 C ATOM 5350 O ARG B 212 23.880 19.227 81.121 1.00 25.76 O ATOM 5351 CB ARG B 212 21.806 18.578 78.731 1.00 25.86 C ATOM 5352 CG ARG B 212 20.808 19.397 77.909 1.00 29.44 C ATOM 5353 CD ARG B 212 19.378 18.915 78.146 1.00 34.67 C ATOM 5354 NE ARG B 212 18.403 19.527 77.244 1.00 37.38 N ATOM 5355 CZ ARG B 212 17.946 18.954 76.131 1.00 39.19 C ATOM 5356 NH1 ARG B 212 18.389 17.749 75.756 1.00 38.71 N ATOM 5357 NH2 ARG B 212 17.046 19.590 75.381 1.00 38.73 N ATOM 5358 N LEU B 213 24.719 17.595 79.836 1.00 26.07 N ATOM 5359 CA LEU B 213 25.403 16.850 80.918 1.00 26.19 C ATOM 5360 C LEU B 213 26.809 17.385 81.222 1.00 26.27 C ATOM 5361 O LEU B 213 27.418 17.022 82.236 1.00 25.40 O ATOM 5362 CB LEU B 213 25.503 15.363 80.515 1.00 26.11 C ATOM 5363 CG LEU B 213 24.633 14.228 81.102 1.00 27.06 C ATOM 5364 CD1 LEU B 213 23.446 14.665 81.970 1.00 26.23 C ATOM 5365 CD2 LEU B 213 24.205 13.220 80.014 1.00 26.42 C ATOM 5366 N LEU B 214 27.312 18.250 80.344 1.00 26.21 N ATOM 5367 CA LEU B 214 28.710 18.679 80.402 1.00 27.26 C ATOM 5368 C LEU B 214 29.125 19.476 81.685 1.00 27.18 C ATOM 5369 O LEU B 214 30.219 19.244 82.213 1.00 26.63 O ATOM 5370 CB LEU B 214 29.107 19.381 79.088 1.00 27.52 C ATOM 5371 CG LEU B 214 30.565 19.731 78.788 1.00 29.47 C ATOM 5372 CD1 LEU B 214 30.771 19.787 77.297 1.00 32.58 C ATOM 5373 CD2 LEU B 214 30.971 21.075 79.393 1.00 32.57 C ATOM 5374 N PRO B 215 28.269 20.409 82.177 1.00 27.23 N ATOM 5375 CA PRO B 215 28.546 21.032 83.484 1.00 27.51 C ATOM 5376 C PRO B 215 28.726 20.027 84.621 1.00 27.69 C ATOM 5377 O PRO B 215 29.774 20.003 85.249 1.00 28.15 O ATOM 5378 CB PRO B 215 27.301 21.897 83.746 1.00 27.34 C ATOM 5379 CG PRO B 215 26.760 22.195 82.429 1.00 27.37 C ATOM 5380 CD PRO B 215 27.059 20.983 81.558 1.00 27.07 C ATOM 5381 N LYS B 216 27.712 19.212 84.876 1.00 28.05 N ATOM 5382 CA LYS B 216 27.772 18.180 85.905 1.00 28.38 C ATOM 5383 C LYS B 216 28.992 17.259 85.746 1.00 27.97 C ATOM 5384 O LYS B 216 29.555 16.806 86.741 1.00 28.12 O ATOM 5385 CB LYS B 216 26.485 17.360 85.911 1.00 28.25 C ATOM 5386 CG LYS B 216 25.395 17.819 86.880 1.00 32.17 C ATOM 5387 CD LYS B 216 24.510 18.915 86.288 1.00 35.04 C ATOM 5388 CE LYS B 216 23.343 19.260 87.210 1.00 37.59 C ATOM 5389 NZ LYS B 216 22.155 18.376 86.980 1.00 37.98 N ATOM 5390 N LEU B 217 29.402 16.994 84.507 1.00 27.11 N ATOM 5391 CA LEU B 217 30.579 16.153 84.258 1.00 27.04 C ATOM 5392 C LEU B 217 31.869 16.848 84.682 1.00 27.41 C ATOM 5393 O LEU B 217 32.664 16.284 85.421 1.00 26.68 O ATOM 5394 CB LEU B 217 30.660 15.707 82.793 1.00 26.29 C ATOM 5395 CG LEU B 217 31.874 14.872 82.360 1.00 25.04 C ATOM 5396 CD1 LEU B 217 31.933 13.515 83.075 1.00 24.78 C ATOM 5397 CD2 LEU B 217 31.845 14.672 80.891 1.00 23.51 C ATOM 5398 N ALA B 218 32.055 18.077 84.205 1.00 28.67 N ATOM 5399 CA ALA B 218 33.198 18.899 84.575 1.00 29.40 C ATOM 5400 C ALA B 218 33.289 19.117 86.091 1.00 30.53 C ATOM 5401 O ALA B 218 34.388 19.148 86.648 1.00 30.44 O ATOM 5402 CB ALA B 218 33.141 20.231 83.849 1.00 29.16 C ATOM 5403 N ARG B 219 32.140 19.268 86.746 1.00 31.74 N ATOM 5404 CA ARG B 219 32.105 19.516 88.181 1.00 33.63 C ATOM 5405 C ARG B 219 32.309 18.229 88.972 1.00 33.91 C ATOM 5406 O ARG B 219 32.654 18.269 90.144 1.00 35.11 O ATOM 5407 CB ARG B 219 30.822 20.269 88.604 1.00 33.85 C ATOM 5408 CG ARG B 219 30.599 21.589 87.823 1.00 36.48 C ATOM 5409 CD ARG B 219 30.140 22.823 88.660 1.00 40.06 C ATOM 5410 NE ARG B 219 28.859 22.667 89.366 1.00 43.39 N ATOM 5411 CZ ARG B 219 27.666 22.462 88.796 1.00 45.29 C ATOM 5412 NH1 ARG B 219 27.543 22.347 87.476 1.00 44.72 N ATOM 5413 NH2 ARG B 219 26.582 22.339 89.562 1.00 45.51 N ATOM 5414 N GLY B 220 32.131 17.093 88.306 1.00 34.46 N ATOM 5415 CA GLY B 220 32.265 15.771 88.914 1.00 34.82 C ATOM 5416 C GLY B 220 31.082 15.363 89.773 1.00 34.98 C ATOM 5417 O GLY B 220 31.256 14.673 90.778 1.00 35.36 O