>>2VIG:HELIX  110 110 LEU G  307  ASN G  337  1                                  31    
LQVIQFKLADMALALESARLLTWRAAMLKDN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 110 110 LEU G 307 ASN G 337 1 31 ATOM 18728 N LEU G 307 -36.484 0.043 118.508 1.00 27.14 N ATOM 18729 CA LEU G 307 -37.342 -0.647 117.556 1.00 27.22 C ATOM 18730 C LEU G 307 -36.556 -1.789 116.914 1.00 22.24 C ATOM 18731 O LEU G 307 -35.486 -1.567 116.412 1.00 26.01 O ATOM 18732 CB LEU G 307 -37.824 0.325 116.474 1.00 26.93 C ATOM 18733 CG LEU G 307 -38.709 1.488 116.939 1.00 27.75 C ATOM 18734 CD1 LEU G 307 -38.804 2.540 115.851 1.00 26.51 C ATOM 18735 CD2 LEU G 307 -40.083 0.966 117.337 1.00 26.10 C ATOM 18736 N GLN G 308 -37.116 -3.002 116.963 1.00 26.67 N ATOM 18737 CA GLN G 308 -36.514 -4.209 116.382 1.00 31.67 C ATOM 18738 C GLN G 308 -36.151 -4.060 114.913 1.00 25.93 C ATOM 18739 O GLN G 308 -35.069 -4.436 114.500 1.00 23.11 O ATOM 18740 CB GLN G 308 -37.501 -5.387 116.479 1.00 34.17 C ATOM 18741 CG GLN G 308 -37.363 -6.254 117.689 1.00 44.62 C ATOM 18742 CD GLN G 308 -37.787 -7.703 117.425 1.00 49.57 C ATOM 18743 OE1 GLN G 308 -38.732 -7.989 116.653 1.00 31.89 O ATOM 18744 NE2 GLN G 308 -37.084 -8.625 118.069 1.00 28.10 N ATOM 18745 N VAL G 309 -37.090 -3.528 114.138 1.00 25.59 N ATOM 18746 CA VAL G 309 -36.915 -3.290 112.723 1.00 25.50 C ATOM 18747 C VAL G 309 -35.679 -2.442 112.447 1.00 25.09 C ATOM 18748 O VAL G 309 -34.918 -2.749 111.548 1.00 20.64 O ATOM 18749 CB VAL G 309 -38.173 -2.615 112.138 1.00 33.11 C ATOM 18750 CG1 VAL G 309 -37.926 -2.153 110.698 1.00 39.72 C ATOM 18751 CG2 VAL G 309 -39.355 -3.587 112.254 1.00 37.05 C ATOM 18752 N ILE G 310 -35.475 -1.393 113.235 1.00 24.35 N ATOM 18753 CA ILE G 310 -34.326 -0.504 113.021 1.00 23.62 C ATOM 18754 C ILE G 310 -33.011 -1.222 113.337 1.00 21.56 C ATOM 18755 O ILE G 310 -32.022 -1.053 112.620 1.00 21.54 O ATOM 18756 CB ILE G 310 -34.468 0.827 113.856 1.00 21.59 C ATOM 18757 CG1 ILE G 310 -35.712 1.629 113.415 1.00 26.66 C ATOM 18758 CG2 ILE G 310 -33.214 1.663 113.776 1.00 22.37 C ATOM 18759 CD1 ILE G 310 -35.761 2.041 111.923 1.00 22.27 C ATOM 18760 N GLN G 311 -33.014 -2.005 114.418 1.00 22.51 N ATOM 18761 CA GLN G 311 -31.864 -2.818 114.829 1.00 23.60 C ATOM 18762 C GLN G 311 -31.471 -3.825 113.759 1.00 22.51 C ATOM 18763 O GLN G 311 -30.281 -4.064 113.460 1.00 19.82 O ATOM 18764 CB GLN G 311 -32.209 -3.576 116.124 1.00 23.66 C ATOM 18765 CG GLN G 311 -32.234 -2.716 117.368 1.00 25.81 C ATOM 18766 CD GLN G 311 -32.759 -3.446 118.605 1.00 34.32 C ATOM 18767 OE1 GLN G 311 -32.847 -4.682 118.643 1.00 35.86 O ATOM 18768 NE2 GLN G 311 -33.109 -2.668 119.637 1.00 35.66 N ATOM 18769 N PHE G 312 -32.489 -4.471 113.210 1.00 19.78 N ATOM 18770 CA PHE G 312 -32.282 -5.372 112.083 1.00 22.56 C ATOM 18771 C PHE G 312 -31.662 -4.667 110.880 1.00 18.43 C ATOM 18772 O PHE G 312 -30.767 -5.218 110.283 1.00 20.22 O ATOM 18773 CB PHE G 312 -33.600 -6.059 111.683 1.00 21.70 C ATOM 18774 CG PHE G 312 -33.850 -7.349 112.426 1.00 28.96 C ATOM 18775 CD1 PHE G 312 -33.645 -7.429 113.809 1.00 35.96 C ATOM 18776 CD2 PHE G 312 -34.274 -8.489 111.749 1.00 35.26 C ATOM 18777 CE1 PHE G 312 -33.891 -8.624 114.508 1.00 38.87 C ATOM 18778 CE2 PHE G 312 -34.508 -9.679 112.442 1.00 34.33 C ATOM 18779 CZ PHE G 312 -34.319 -9.741 113.825 1.00 29.65 C ATOM 18780 N LYS G 313 -32.151 -3.464 110.533 1.00 22.19 N ATOM 18781 CA LYS G 313 -31.570 -2.681 109.431 1.00 23.15 C ATOM 18782 C LYS G 313 -30.097 -2.397 109.740 1.00 18.41 C ATOM 18783 O LYS G 313 -29.227 -2.656 108.919 1.00 21.17 O ATOM 18784 CB LYS G 313 -32.282 -1.342 109.222 1.00 24.53 C ATOM 18785 CG LYS G 313 -33.693 -1.408 108.716 1.00 27.77 C ATOM 18786 CD LYS G 313 -34.246 0.026 108.500 1.00 27.41 C ATOM 18787 CE LYS G 313 -35.725 -0.011 108.222 1.00 29.62 C ATOM 18788 NZ LYS G 313 -35.981 -0.631 106.898 1.00 27.11 N ATOM 18789 N LEU G 314 -29.832 -1.903 110.939 1.00 20.81 N ATOM 18790 CA LEU G 314 -28.433 -1.636 111.342 1.00 20.47 C ATOM 18791 C LEU G 314 -27.516 -2.869 111.323 1.00 22.09 C ATOM 18792 O LEU G 314 -26.352 -2.784 110.897 1.00 21.87 O ATOM 18793 CB LEU G 314 -28.398 -0.931 112.700 1.00 21.89 C ATOM 18794 CG LEU G 314 -29.037 0.477 112.686 1.00 22.81 C ATOM 18795 CD1 LEU G 314 -29.039 1.045 114.083 1.00 25.13 C ATOM 18796 CD2 LEU G 314 -28.362 1.449 111.699 1.00 19.40 C ATOM 18797 N ALA G 315 -28.032 -4.008 111.773 1.00 23.04 N ATOM 18798 CA ALA G 315 -27.280 -5.262 111.713 1.00 23.18 C ATOM 18799 C ALA G 315 -26.945 -5.693 110.284 1.00 23.69 C ATOM 18800 O ALA G 315 -25.807 -6.096 110.007 1.00 18.82 O ATOM 18801 CB ALA G 315 -28.019 -6.394 112.457 1.00 22.72 C ATOM 18802 N ASP G 316 -27.924 -5.611 109.379 1.00 17.47 N ATOM 18803 CA ASP G 316 -27.698 -5.936 107.973 1.00 20.15 C ATOM 18804 C ASP G 316 -26.687 -4.976 107.341 1.00 20.47 C ATOM 18805 O ASP G 316 -25.809 -5.398 106.587 1.00 21.42 O ATOM 18806 CB ASP G 316 -29.036 -5.934 107.205 1.00 24.46 C ATOM 18807 CG ASP G 316 -29.881 -7.152 107.526 1.00 35.96 C ATOM 18808 OD1 ASP G 316 -29.256 -8.156 107.915 1.00 39.48 O ATOM 18809 OD2 ASP G 316 -31.141 -7.122 107.414 1.00 34.47 O ATOM 18810 N MET G 317 -26.771 -3.702 107.700 1.00 21.03 N ATOM 18811 CA MET G 317 -25.795 -2.696 107.217 1.00 23.32 C ATOM 18812 C MET G 317 -24.380 -3.027 107.686 1.00 22.82 C ATOM 18813 O MET G 317 -23.438 -3.046 106.875 1.00 22.12 O ATOM 18814 CB MET G 317 -26.212 -1.267 107.645 1.00 21.09 C ATOM 18815 CG MET G 317 -27.497 -0.773 106.995 1.00 27.43 C ATOM 18816 SD MET G 317 -28.451 0.453 107.945 1.00 26.44 S ATOM 18817 CE MET G 317 -27.546 1.952 107.498 1.00 21.07 C ATOM 18818 N ALA G 318 -24.226 -3.326 108.977 1.00 22.44 N ATOM 18819 CA ALA G 318 -22.895 -3.622 109.527 1.00 24.14 C ATOM 18820 C ALA G 318 -22.306 -4.907 108.922 1.00 22.56 C ATOM 18821 O ALA G 318 -21.122 -4.974 108.597 1.00 20.27 O ATOM 18822 CB ALA G 318 -22.948 -3.719 111.079 1.00 23.00 C ATOM 18823 N LEU G 319 -23.141 -5.934 108.779 1.00 21.63 N ATOM 18824 CA LEU G 319 -22.710 -7.188 108.167 1.00 25.60 C ATOM 18825 C LEU G 319 -22.187 -6.949 106.735 1.00 22.45 C ATOM 18826 O LEU G 319 -21.090 -7.376 106.388 1.00 23.84 O ATOM 18827 CB LEU G 319 -23.883 -8.191 108.168 1.00 25.10 C ATOM 18828 CG LEU G 319 -23.618 -9.616 107.657 1.00 32.24 C ATOM 18829 CD1 LEU G 319 -22.474 -10.237 108.385 1.00 30.41 C ATOM 18830 CD2 LEU G 319 -24.852 -10.497 107.838 1.00 32.86 C ATOM 18831 N ALA G 320 -22.950 -6.226 105.922 1.00 21.72 N ATOM 18832 CA ALA G 320 -22.549 -5.974 104.535 1.00 21.12 C ATOM 18833 C ALA G 320 -21.256 -5.185 104.448 1.00 22.12 C ATOM 18834 O ALA G 320 -20.397 -5.479 103.622 1.00 21.26 O ATOM 18835 CB ALA G 320 -23.673 -5.244 103.756 1.00 21.66 C ATOM 18836 N LEU G 321 -21.111 -4.188 105.316 1.00 24.73 N ATOM 18837 CA LEU G 321 -19.886 -3.377 105.343 1.00 20.97 C ATOM 18838 C LEU G 321 -18.668 -4.182 105.768 1.00 19.92 C ATOM 18839 O LEU G 321 -17.597 -4.116 105.122 1.00 18.30 O ATOM 18840 CB LEU G 321 -20.075 -2.199 106.285 1.00 23.06 C ATOM 18841 CG LEU G 321 -18.976 -1.158 106.461 1.00 23.00 C ATOM 18842 CD1 LEU G 321 -18.425 -0.697 105.116 1.00 21.84 C ATOM 18843 CD2 LEU G 321 -19.544 -0.010 107.254 1.00 23.30 C ATOM 18844 N GLU G 322 -18.804 -4.908 106.874 1.00 20.27 N ATOM 18845 CA GLU G 322 -17.651 -5.645 107.392 1.00 26.90 C ATOM 18846 C GLU G 322 -17.194 -6.759 106.442 1.00 22.29 C ATOM 18847 O GLU G 322 -15.997 -6.952 106.246 1.00 20.28 O ATOM 18848 CB GLU G 322 -17.897 -6.115 108.824 1.00 27.62 C ATOM 18849 CG GLU G 322 -18.025 -4.905 109.780 1.00 37.54 C ATOM 18850 CD GLU G 322 -18.312 -5.258 111.243 1.00 37.51 C ATOM 18851 OE1 GLU G 322 -17.638 -6.159 111.791 1.00 37.11 O ATOM 18852 OE2 GLU G 322 -19.202 -4.604 111.857 1.00 39.88 O ATOM 18853 N SER G 323 -18.120 -7.476 105.809 1.00 19.76 N ATOM 18854 CA SER G 323 -17.722 -8.518 104.842 1.00 22.00 C ATOM 18855 C SER G 323 -17.013 -7.935 103.597 1.00 21.67 C ATOM 18856 O SER G 323 -15.966 -8.468 103.141 1.00 19.53 O ATOM 18857 CB SER G 323 -18.923 -9.397 104.447 1.00 23.56 C ATOM 18858 OG SER G 323 -20.074 -8.615 104.336 1.00 32.86 O ATOM 18859 N ALA G 324 -17.551 -6.819 103.096 1.00 20.61 N ATOM 18860 CA ALA G 324 -16.949 -6.086 101.987 1.00 19.91 C ATOM 18861 C ALA G 324 -15.541 -5.596 102.349 1.00 20.93 C ATOM 18862 O ALA G 324 -14.606 -5.758 101.568 1.00 21.34 O ATOM 18863 CB ALA G 324 -17.848 -4.902 101.579 1.00 18.69 C ATOM 18864 N ARG G 325 -15.383 -5.060 103.554 1.00 21.55 N ATOM 18865 CA ARG G 325 -14.040 -4.657 104.023 1.00 23.29 C ATOM 18866 C ARG G 325 -13.016 -5.815 103.982 1.00 18.23 C ATOM 18867 O ARG G 325 -11.945 -5.669 103.423 1.00 23.63 O ATOM 18868 CB ARG G 325 -14.106 -4.044 105.413 1.00 20.02 C ATOM 18869 CG ARG G 325 -12.734 -3.444 105.854 1.00 19.39 C ATOM 18870 CD ARG G 325 -12.781 -2.646 107.159 1.00 25.49 C ATOM 18871 NE ARG G 325 -13.621 -1.443 107.090 1.00 24.37 N ATOM 18872 CZ ARG G 325 -14.855 -1.342 107.575 1.00 20.67 C ATOM 18873 NH1 ARG G 325 -15.437 -2.369 108.173 1.00 22.06 N ATOM 18874 NH2 ARG G 325 -15.531 -0.203 107.468 1.00 26.66 N ATOM 18875 N LEU G 326 -13.379 -6.957 104.558 1.00 22.20 N ATOM 18876 CA LEU G 326 -12.527 -8.149 104.552 1.00 21.31 C ATOM 18877 C LEU G 326 -12.170 -8.598 103.126 1.00 24.38 C ATOM 18878 O LEU G 326 -11.022 -8.888 102.865 1.00 18.21 O ATOM 18879 CB LEU G 326 -13.164 -9.303 105.346 1.00 19.39 C ATOM 18880 CG LEU G 326 -13.396 -9.177 106.848 1.00 22.90 C ATOM 18881 CD1 LEU G 326 -14.094 -10.455 107.319 1.00 21.24 C ATOM 18882 CD2 LEU G 326 -12.072 -8.909 107.625 1.00 26.00 C ATOM 18883 N LEU G 327 -13.132 -8.636 102.191 1.00 18.04 N ATOM 18884 CA LEU G 327 -12.788 -8.875 100.776 1.00 20.44 C ATOM 18885 C LEU G 327 -11.744 -7.872 100.222 1.00 18.34 C ATOM 18886 O LEU G 327 -10.780 -8.276 99.519 1.00 20.55 O ATOM 18887 CB LEU G 327 -14.045 -8.853 99.872 1.00 16.63 C ATOM 18888 CG LEU G 327 -15.050 -9.990 100.077 1.00 19.19 C ATOM 18889 CD1 LEU G 327 -16.388 -9.669 99.378 1.00 18.36 C ATOM 18890 CD2 LEU G 327 -14.445 -11.309 99.611 1.00 24.19 C ATOM 18891 N THR G 328 -11.906 -6.594 100.576 1.00 20.53 N ATOM 18892 CA THR G 328 -10.990 -5.541 100.104 1.00 23.53 C ATOM 18893 C THR G 328 -9.593 -5.741 100.667 1.00 22.66 C ATOM 18894 O THR G 328 -8.588 -5.657 99.927 1.00 21.60 O ATOM 18895 CB THR G 328 -11.466 -4.125 100.473 1.00 26.82 C ATOM 18896 OG1 THR G 328 -12.806 -3.917 99.992 1.00 21.44 O ATOM 18897 CG2 THR G 328 -10.535 -3.060 99.862 1.00 20.97 C ATOM 18898 N TRP G 329 -9.528 -6.006 101.974 1.00 23.42 N ATOM 18899 CA TRP G 329 -8.218 -6.269 102.621 1.00 25.28 C ATOM 18900 C TRP G 329 -7.519 -7.501 102.088 1.00 21.84 C ATOM 18901 O TRP G 329 -6.298 -7.476 101.939 1.00 26.01 O ATOM 18902 CB TRP G 329 -8.336 -6.293 104.139 1.00 23.23 C ATOM 18903 CG TRP G 329 -8.642 -4.941 104.699 1.00 28.85 C ATOM 18904 CD1 TRP G 329 -8.918 -3.792 103.991 1.00 29.56 C ATOM 18905 CD2 TRP G 329 -8.739 -4.589 106.077 1.00 34.29 C ATOM 18906 NE1 TRP G 329 -9.153 -2.751 104.851 1.00 34.05 N ATOM 18907 CE2 TRP G 329 -9.056 -3.207 106.136 1.00 34.27 C ATOM 18908 CE3 TRP G 329 -8.587 -5.300 107.274 1.00 34.72 C ATOM 18909 CZ2 TRP G 329 -9.217 -2.524 107.345 1.00 34.26 C ATOM 18910 CZ3 TRP G 329 -8.747 -4.618 108.481 1.00 35.98 C ATOM 18911 CH2 TRP G 329 -9.063 -3.245 108.504 1.00 32.92 C ATOM 18912 N ARG G 330 -8.283 -8.568 101.816 1.00 23.10 N ATOM 18913 CA ARG G 330 -7.748 -9.764 101.172 1.00 23.76 C ATOM 18914 C ARG G 330 -7.073 -9.455 99.810 1.00 25.55 C ATOM 18915 O ARG G 330 -5.930 -9.886 99.550 1.00 20.03 O ATOM 18916 CB ARG G 330 -8.826 -10.853 101.006 1.00 23.32 C ATOM 18917 CG ARG G 330 -8.338 -11.999 100.108 1.00 23.55 C ATOM 18918 CD ARG G 330 -9.266 -13.164 99.983 1.00 25.37 C ATOM 18919 NE ARG G 330 -10.397 -12.853 99.109 1.00 27.01 N ATOM 18920 CZ ARG G 330 -11.148 -13.752 98.474 1.00 31.56 C ATOM 18921 NH1 ARG G 330 -10.909 -15.061 98.590 1.00 30.22 N ATOM 18922 NH2 ARG G 330 -12.164 -13.328 97.722 1.00 27.71 N ATOM 18923 N ALA G 331 -7.759 -8.688 98.966 1.00 22.05 N ATOM 18924 CA ALA G 331 -7.256 -8.274 97.643 1.00 25.62 C ATOM 18925 C ALA G 331 -5.957 -7.446 97.751 1.00 22.49 C ATOM 18926 O ALA G 331 -4.939 -7.770 97.075 1.00 23.57 O ATOM 18927 CB ALA G 331 -8.370 -7.458 96.870 1.00 17.19 C ATOM 18928 N ALA G 332 -5.980 -6.426 98.628 1.00 22.49 N ATOM 18929 CA ALA G 332 -4.781 -5.581 98.909 1.00 23.79 C ATOM 18930 C ALA G 332 -3.586 -6.390 99.407 1.00 26.59 C ATOM 18931 O ALA G 332 -2.431 -6.158 98.997 1.00 27.04 O ATOM 18932 CB ALA G 332 -5.112 -4.497 99.938 1.00 21.85 C ATOM 18933 N MET G 333 -3.852 -7.309 100.326 1.00 28.70 N ATOM 18934 CA MET G 333 -2.825 -8.207 100.812 1.00 30.97 C ATOM 18935 C MET G 333 -2.311 -9.144 99.724 1.00 30.21 C ATOM 18936 O MET G 333 -1.134 -9.419 99.701 1.00 28.38 O ATOM 18937 CB MET G 333 -3.308 -8.986 102.047 1.00 27.33 C ATOM 18938 CG MET G 333 -3.318 -8.141 103.332 1.00 38.92 C ATOM 18939 SD MET G 333 -4.367 -8.768 104.666 1.00 46.79 S ATOM 18940 CE MET G 333 -4.436 -10.540 104.354 1.00 46.30 C ATOM 18941 N LEU G 334 -3.156 -9.665 98.827 1.00 26.91 N ATOM 18942 CA LEU G 334 -2.605 -10.507 97.755 1.00 28.25 C ATOM 18943 C LEU G 334 -1.729 -9.687 96.817 1.00 29.03 C ATOM 18944 O LEU G 334 -0.637 -10.130 96.416 1.00 31.42 O ATOM 18945 CB LEU G 334 -3.695 -11.211 96.951 1.00 25.00 C ATOM 18946 CG LEU G 334 -4.480 -12.238 97.732 1.00 33.63 C ATOM 18947 CD1 LEU G 334 -5.838 -12.472 97.042 1.00 23.10 C ATOM 18948 CD2 LEU G 334 -3.712 -13.543 97.899 1.00 26.12 C ATOM 18949 N LYS G 335 -2.187 -8.479 96.486 1.00 23.11 N ATOM 18950 CA LYS G 335 -1.377 -7.564 95.676 1.00 31.57 C ATOM 18951 C LYS G 335 -0.035 -7.239 96.374 1.00 30.86 C ATOM 18952 O LYS G 335 1.018 -7.287 95.727 1.00 35.08 O ATOM 18953 CB LYS G 335 -2.138 -6.280 95.308 1.00 30.09 C ATOM 18954 CG LYS G 335 -1.199 -5.127 94.895 1.00 35.40 C ATOM 18955 CD LYS G 335 -1.770 -4.206 93.868 1.00 44.93 C ATOM 18956 CE LYS G 335 -0.917 -2.940 93.751 1.00 39.85 C ATOM 18957 NZ LYS G 335 0.470 -3.155 93.289 1.00 39.87 N ATOM 18958 N ASP G 336 -0.082 -6.923 97.672 1.00 28.73 N ATOM 18959 CA ASP G 336 1.143 -6.649 98.460 1.00 32.66 C ATOM 18960 C ASP G 336 2.139 -7.806 98.482 1.00 31.80 C ATOM 18961 O ASP G 336 3.346 -7.578 98.479 1.00 34.38 O ATOM 18962 CB ASP G 336 0.813 -6.223 99.898 1.00 32.00 C ATOM 18963 CG ASP G 336 0.245 -4.825 99.969 1.00 37.42 C ATOM 18964 OD1 ASP G 336 0.606 -4.001 99.098 1.00 42.31 O ATOM 18965 OD2 ASP G 336 -0.564 -4.534 100.885 1.00 31.94 O ATOM 18966 N ASN G 337 1.646 -9.037 98.483 1.00 32.61 N ATOM 18967 CA ASN G 337 2.509 -10.209 98.441 1.00 32.58 C ATOM 18968 C ASN G 337 2.778 -10.739 97.030 1.00 33.85 C ATOM 18969 O ASN G 337 3.238 -11.868 96.865 1.00 31.99 O ATOM 18970 CB ASN G 337 1.943 -11.306 99.343 1.00 34.99 C ATOM 18971 CG ASN G 337 1.979 -10.914 100.809 1.00 43.62 C ATOM 18972 OD1 ASN G 337 3.004 -10.469 101.307 1.00 56.07 O ATOM 18973 ND2 ASN G 337 0.854 -11.056 101.500 1.00 46.84 N