>>2VIG:HELIX  126 126 LEU H  307  ASN H  337  1                                  31    
LQVIQFKLADMALALESARLLTWRAAMLKDN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 126 126 LEU H 307 ASN H 337 1 31 ATOM 21482 N LEU H 307 -27.897 -9.361 75.213 1.00 22.36 N ATOM 21483 CA LEU H 307 -27.295 -9.928 76.420 1.00 27.85 C ATOM 21484 C LEU H 307 -28.348 -10.467 77.377 1.00 22.54 C ATOM 21485 O LEU H 307 -29.253 -9.735 77.809 1.00 23.27 O ATOM 21486 CB LEU H 307 -26.399 -8.910 77.148 1.00 27.42 C ATOM 21487 CG LEU H 307 -25.260 -8.241 76.371 1.00 24.55 C ATOM 21488 CD1 LEU H 307 -24.841 -6.983 77.133 1.00 26.51 C ATOM 21489 CD2 LEU H 307 -24.012 -9.156 76.079 1.00 26.17 C ATOM 21490 N GLN H 308 -28.221 -11.747 77.720 1.00 22.99 N ATOM 21491 CA GLN H 308 -29.165 -12.410 78.634 1.00 30.92 C ATOM 21492 C GLN H 308 -29.372 -11.662 79.933 1.00 26.20 C ATOM 21493 O GLN H 308 -30.490 -11.583 80.434 1.00 20.06 O ATOM 21494 CB GLN H 308 -28.674 -13.816 79.008 1.00 34.65 C ATOM 21495 CG GLN H 308 -28.886 -14.862 77.967 1.00 44.79 C ATOM 21496 CD GLN H 308 -28.756 -16.274 78.536 1.00 49.57 C ATOM 21497 OE1 GLN H 308 -27.848 -16.568 79.343 1.00 29.21 O ATOM 21498 NE2 GLN H 308 -29.664 -17.156 78.112 1.00 26.36 N ATOM 21499 N VAL H 309 -28.275 -11.142 80.487 1.00 26.43 N ATOM 21500 CA VAL H 309 -28.309 -10.442 81.765 1.00 27.41 C ATOM 21501 C VAL H 309 -29.211 -9.205 81.695 1.00 24.06 C ATOM 21502 O VAL H 309 -30.023 -8.950 82.618 1.00 22.70 O ATOM 21503 CB VAL H 309 -26.852 -10.116 82.210 1.00 30.85 C ATOM 21504 CG1 VAL H 309 -26.809 -9.192 83.406 1.00 35.72 C ATOM 21505 CG2 VAL H 309 -26.138 -11.426 82.506 1.00 37.34 C ATOM 21506 N ILE H 310 -29.089 -8.468 80.591 1.00 20.88 N ATOM 21507 CA ILE H 310 -29.900 -7.284 80.332 1.00 24.47 C ATOM 21508 C ILE H 310 -31.353 -7.720 80.140 1.00 21.22 C ATOM 21509 O ILE H 310 -32.278 -7.101 80.688 1.00 22.06 O ATOM 21510 CB ILE H 310 -29.376 -6.455 79.078 1.00 21.84 C ATOM 21511 CG1 ILE H 310 -27.964 -5.886 79.324 1.00 28.74 C ATOM 21512 CG2 ILE H 310 -30.343 -5.321 78.715 1.00 20.55 C ATOM 21513 CD1 ILE H 310 -27.899 -4.828 80.433 1.00 22.40 C ATOM 21514 N GLN H 311 -31.561 -8.816 79.415 1.00 22.47 N ATOM 21515 CA GLN H 311 -32.939 -9.337 79.242 1.00 24.14 C ATOM 21516 C GLN H 311 -33.615 -9.670 80.572 1.00 21.92 C ATOM 21517 O GLN H 311 -34.805 -9.371 80.791 1.00 22.48 O ATOM 21518 CB GLN H 311 -32.919 -10.579 78.332 1.00 23.73 C ATOM 21519 CG GLN H 311 -32.745 -10.273 76.867 1.00 22.72 C ATOM 21520 CD GLN H 311 -32.618 -11.528 76.024 1.00 30.99 C ATOM 21521 OE1 GLN H 311 -33.286 -12.523 76.272 1.00 37.64 O ATOM 21522 NE2 GLN H 311 -31.762 -11.485 75.031 1.00 31.42 N ATOM 21523 N PHE H 312 -32.860 -10.312 81.456 1.00 21.64 N ATOM 21524 CA PHE H 312 -33.296 -10.597 82.820 1.00 21.66 C ATOM 21525 C PHE H 312 -33.598 -9.348 83.635 1.00 22.39 C ATOM 21526 O PHE H 312 -34.625 -9.313 84.334 1.00 19.95 O ATOM 21527 CB PHE H 312 -32.230 -11.420 83.565 1.00 23.47 C ATOM 21528 CG PHE H 312 -32.331 -12.917 83.358 1.00 27.47 C ATOM 21529 CD1 PHE H 312 -32.635 -13.459 82.114 1.00 35.11 C ATOM 21530 CD2 PHE H 312 -32.108 -13.783 84.423 1.00 36.38 C ATOM 21531 CE1 PHE H 312 -32.737 -14.841 81.933 1.00 36.82 C ATOM 21532 CE2 PHE H 312 -32.208 -15.169 84.246 1.00 37.92 C ATOM 21533 CZ PHE H 312 -32.521 -15.690 83.003 1.00 30.82 C ATOM 21534 N LYS H 313 -32.709 -8.345 83.573 1.00 20.43 N ATOM 21535 CA LYS H 313 -32.940 -7.071 84.272 1.00 22.99 C ATOM 21536 C LYS H 313 -34.293 -6.508 83.846 1.00 18.52 C ATOM 21537 O LYS H 313 -35.154 -6.245 84.680 1.00 23.18 O ATOM 21538 CB LYS H 313 -31.832 -6.032 84.008 1.00 23.03 C ATOM 21539 CG LYS H 313 -30.539 -6.291 84.712 1.00 25.36 C ATOM 21540 CD LYS H 313 -29.506 -5.218 84.386 1.00 28.07 C ATOM 21541 CE LYS H 313 -28.152 -5.567 84.992 1.00 31.00 C ATOM 21542 NZ LYS H 313 -28.296 -5.685 86.465 1.00 22.58 N ATOM 21543 N LEU H 314 -34.511 -6.459 82.540 1.00 24.45 N ATOM 21544 CA LEU H 314 -35.766 -5.970 81.982 1.00 17.01 C ATOM 21545 C LEU H 314 -37.033 -6.779 82.313 1.00 20.69 C ATOM 21546 O LEU H 314 -38.050 -6.183 82.614 1.00 14.35 O ATOM 21547 CB LEU H 314 -35.640 -5.782 80.469 1.00 22.81 C ATOM 21548 CG LEU H 314 -34.621 -4.724 80.034 1.00 19.79 C ATOM 21549 CD1 LEU H 314 -34.395 -4.776 78.530 1.00 22.95 C ATOM 21550 CD2 LEU H 314 -35.042 -3.318 80.470 1.00 21.44 C ATOM 21551 N ALA H 315 -36.980 -8.099 82.250 1.00 19.72 N ATOM 21552 CA ALA H 315 -38.117 -8.936 82.690 1.00 25.47 C ATOM 21553 C ALA H 315 -38.493 -8.713 84.155 1.00 21.59 C ATOM 21554 O ALA H 315 -39.699 -8.619 84.476 1.00 23.24 O ATOM 21555 CB ALA H 315 -37.838 -10.448 82.403 1.00 22.74 C ATOM 21556 N ASP H 316 -37.482 -8.621 85.033 1.00 18.28 N ATOM 21557 CA ASP H 316 -37.665 -8.392 86.479 1.00 21.32 C ATOM 21558 C ASP H 316 -38.312 -7.035 86.749 1.00 22.05 C ATOM 21559 O ASP H 316 -39.217 -6.896 87.566 1.00 18.78 O ATOM 21560 CB ASP H 316 -36.302 -8.550 87.240 1.00 24.70 C ATOM 21561 CG ASP H 316 -35.900 -10.013 87.400 1.00 35.19 C ATOM 21562 OD1 ASP H 316 -36.840 -10.837 87.496 1.00 40.11 O ATOM 21563 OD2 ASP H 316 -34.690 -10.349 87.399 1.00 32.47 O ATOM 21564 N MET H 317 -37.868 -6.041 86.002 1.00 25.82 N ATOM 21565 CA MET H 317 -38.494 -4.716 86.026 1.00 21.37 C ATOM 21566 C MET H 317 -39.971 -4.723 85.602 1.00 21.28 C ATOM 21567 O MET H 317 -40.802 -4.222 86.341 1.00 16.07 O ATOM 21568 CB MET H 317 -37.687 -3.746 85.150 1.00 23.38 C ATOM 21569 CG MET H 317 -36.292 -3.503 85.712 1.00 26.62 C ATOM 21570 SD MET H 317 -35.121 -2.907 84.505 1.00 27.05 S ATOM 21571 CE MET H 317 -35.669 -1.188 84.454 1.00 17.86 C ATOM 21572 N ALA H 318 -40.278 -5.285 84.438 1.00 22.64 N ATOM 21573 CA ALA H 318 -41.679 -5.391 83.988 1.00 24.46 C ATOM 21574 C ALA H 318 -42.549 -6.132 84.990 1.00 21.38 C ATOM 21575 O ALA H 318 -43.672 -5.706 85.255 1.00 22.12 O ATOM 21576 CB ALA H 318 -41.781 -6.041 82.582 1.00 21.30 C ATOM 21577 N LEU H 319 -42.034 -7.224 85.551 1.00 21.16 N ATOM 21578 CA LEU H 319 -42.782 -8.035 86.524 1.00 25.18 C ATOM 21579 C LEU H 319 -43.113 -7.239 87.798 1.00 21.01 C ATOM 21580 O LEU H 319 -44.278 -7.121 88.167 1.00 21.51 O ATOM 21581 CB LEU H 319 -42.052 -9.362 86.841 1.00 23.93 C ATOM 21582 CG LEU H 319 -42.693 -10.331 87.871 1.00 31.21 C ATOM 21583 CD1 LEU H 319 -44.141 -10.652 87.583 1.00 33.08 C ATOM 21584 CD2 LEU H 319 -41.932 -11.645 87.940 1.00 29.62 C ATOM 21585 N ALA H 320 -42.106 -6.577 88.376 1.00 20.01 N ATOM 21586 CA ALA H 320 -42.294 -5.701 89.518 1.00 19.09 C ATOM 21587 C ALA H 320 -43.340 -4.610 89.238 1.00 23.96 C ATOM 21588 O ALA H 320 -44.270 -4.391 90.042 1.00 23.58 O ATOM 21589 CB ALA H 320 -40.869 -5.077 89.993 1.00 16.84 C ATOM 21590 N LEU H 321 -43.236 -3.984 88.069 1.00 24.99 N ATOM 21591 CA LEU H 321 -44.166 -2.917 87.686 1.00 23.05 C ATOM 21592 C LEU H 321 -45.611 -3.391 87.515 1.00 21.79 C ATOM 21593 O LEU H 321 -46.542 -2.812 88.101 1.00 14.68 O ATOM 21594 CB LEU H 321 -43.676 -2.247 86.395 1.00 22.41 C ATOM 21595 CG LEU H 321 -44.469 -1.086 85.820 1.00 24.89 C ATOM 21596 CD1 LEU H 321 -44.867 -0.128 86.927 1.00 22.25 C ATOM 21597 CD2 LEU H 321 -43.639 -0.389 84.719 1.00 24.82 C ATOM 21598 N GLU H 322 -45.774 -4.434 86.719 1.00 21.99 N ATOM 21599 CA GLU H 322 -47.084 -4.957 86.397 1.00 28.03 C ATOM 21600 C GLU H 322 -47.746 -5.514 87.628 1.00 25.52 C ATOM 21601 O GLU H 322 -48.912 -5.248 87.856 1.00 20.14 O ATOM 21602 CB GLU H 322 -47.001 -5.971 85.248 1.00 29.18 C ATOM 21603 CG GLU H 322 -46.660 -5.270 83.919 1.00 37.59 C ATOM 21604 CD GLU H 322 -46.669 -6.164 82.689 1.00 35.71 C ATOM 21605 OE1 GLU H 322 -47.496 -7.098 82.623 1.00 40.14 O ATOM 21606 OE2 GLU H 322 -45.864 -5.908 81.766 1.00 37.72 O ATOM 21607 N SER H 323 -46.994 -6.219 88.466 1.00 22.14 N ATOM 21608 CA SER H 323 -47.517 -6.648 89.787 1.00 24.72 C ATOM 21609 C SER H 323 -48.022 -5.496 90.653 1.00 21.91 C ATOM 21610 O SER H 323 -49.070 -5.587 91.255 1.00 18.30 O ATOM 21611 CB SER H 323 -46.435 -7.390 90.609 1.00 23.12 C ATOM 21612 OG SER H 323 -46.043 -8.578 89.987 1.00 40.00 O ATOM 21613 N ALA H 324 -47.229 -4.439 90.764 1.00 21.50 N ATOM 21614 CA ALA H 324 -47.579 -3.276 91.572 1.00 20.47 C ATOM 21615 C ALA H 324 -48.809 -2.559 91.053 1.00 21.58 C ATOM 21616 O ALA H 324 -49.652 -2.125 91.857 1.00 20.57 O ATOM 21617 CB ALA H 324 -46.376 -2.296 91.658 1.00 20.00 C ATOM 21618 N ARG H 325 -48.944 -2.488 89.724 1.00 21.99 N ATOM 21619 CA ARG H 325 -50.118 -1.848 89.103 1.00 23.70 C ATOM 21620 C ARG H 325 -51.413 -2.605 89.446 1.00 22.40 C ATOM 21621 O ARG H 325 -52.443 -1.991 89.796 1.00 19.37 O ATOM 21622 CB ARG H 325 -49.923 -1.732 87.585 1.00 22.21 C ATOM 21623 CG ARG H 325 -51.142 -1.114 86.860 1.00 22.50 C ATOM 21624 CD ARG H 325 -50.917 -0.898 85.370 1.00 26.87 C ATOM 21625 NE ARG H 325 -49.822 0.018 85.060 1.00 20.13 N ATOM 21626 CZ ARG H 325 -48.613 -0.347 84.607 1.00 24.42 C ATOM 21627 NH1 ARG H 325 -48.314 -1.609 84.409 1.00 21.68 N ATOM 21628 NH2 ARG H 325 -47.679 0.564 84.356 1.00 27.46 N ATOM 21629 N LEU H 326 -51.365 -3.930 89.347 1.00 21.92 N ATOM 21630 CA LEU H 326 -52.538 -4.741 89.683 1.00 23.92 C ATOM 21631 C LEU H 326 -52.937 -4.586 91.149 1.00 24.05 C ATOM 21632 O LEU H 326 -54.115 -4.550 91.445 1.00 23.98 O ATOM 21633 CB LEU H 326 -52.325 -6.230 89.355 1.00 22.40 C ATOM 21634 CG LEU H 326 -52.125 -6.659 87.892 1.00 25.80 C ATOM 21635 CD1 LEU H 326 -51.844 -8.130 87.841 1.00 17.61 C ATOM 21636 CD2 LEU H 326 -53.325 -6.297 86.992 1.00 26.73 C ATOM 21637 N LEU H 327 -51.963 -4.498 92.064 1.00 21.85 N ATOM 21638 CA LEU H 327 -52.240 -4.170 93.467 1.00 21.38 C ATOM 21639 C LEU H 327 -52.861 -2.790 93.625 1.00 20.10 C ATOM 21640 O LEU H 327 -53.774 -2.590 94.436 1.00 19.07 O ATOM 21641 CB LEU H 327 -50.937 -4.225 94.327 1.00 18.48 C ATOM 21642 CG LEU H 327 -50.394 -5.612 94.659 1.00 22.55 C ATOM 21643 CD1 LEU H 327 -48.985 -5.484 95.251 1.00 19.94 C ATOM 21644 CD2 LEU H 327 -51.306 -6.362 95.592 1.00 22.10 C ATOM 21645 N THR H 328 -52.373 -1.828 92.848 1.00 18.48 N ATOM 21646 CA THR H 328 -52.942 -0.493 92.905 1.00 25.32 C ATOM 21647 C THR H 328 -54.399 -0.444 92.402 1.00 22.87 C ATOM 21648 O THR H 328 -55.263 0.183 93.033 1.00 23.67 O ATOM 21649 CB THR H 328 -52.092 0.483 92.120 1.00 27.97 C ATOM 21650 OG1 THR H 328 -50.743 0.431 92.629 1.00 21.69 O ATOM 21651 CG2 THR H 328 -52.680 1.901 92.229 1.00 23.48 C ATOM 21652 N TRP H 329 -54.656 -1.111 91.287 1.00 22.69 N ATOM 21653 CA TRP H 329 -56.010 -1.124 90.715 1.00 24.75 C ATOM 21654 C TRP H 329 -56.964 -1.853 91.622 1.00 21.95 C ATOM 21655 O TRP H 329 -58.125 -1.446 91.772 1.00 27.26 O ATOM 21656 CB TRP H 329 -55.983 -1.730 89.329 1.00 26.41 C ATOM 21657 CG TRP H 329 -55.330 -0.837 88.304 1.00 30.33 C ATOM 21658 CD1 TRP H 329 -54.673 0.344 88.530 1.00 31.79 C ATOM 21659 CD2 TRP H 329 -55.273 -1.058 86.895 1.00 34.75 C ATOM 21660 NE1 TRP H 329 -54.214 0.864 87.355 1.00 31.61 N ATOM 21661 CE2 TRP H 329 -54.565 0.026 86.331 1.00 32.61 C ATOM 21662 CE3 TRP H 329 -55.760 -2.064 86.048 1.00 34.72 C ATOM 21663 CZ2 TRP H 329 -54.331 0.137 84.953 1.00 33.25 C ATOM 21664 CZ3 TRP H 329 -55.515 -1.962 84.674 1.00 35.20 C ATOM 21665 CH2 TRP H 329 -54.804 -0.865 84.144 1.00 33.02 C ATOM 21666 N ARG H 330 -56.508 -2.932 92.247 1.00 21.90 N ATOM 21667 CA ARG H 330 -57.348 -3.619 93.230 1.00 24.74 C ATOM 21668 C ARG H 330 -57.790 -2.664 94.355 1.00 25.71 C ATOM 21669 O ARG H 330 -58.970 -2.624 94.681 1.00 20.44 O ATOM 21670 CB ARG H 330 -56.663 -4.893 93.795 1.00 20.24 C ATOM 21671 CG ARG H 330 -57.430 -5.495 95.008 1.00 24.56 C ATOM 21672 CD ARG H 330 -56.770 -6.713 95.606 1.00 28.10 C ATOM 21673 NE ARG H 330 -55.607 -6.387 96.427 1.00 26.50 N ATOM 21674 CZ ARG H 330 -55.024 -7.240 97.260 1.00 30.09 C ATOM 21675 NH1 ARG H 330 -55.512 -8.459 97.412 1.00 31.79 N ATOM 21676 NH2 ARG H 330 -53.960 -6.869 97.948 1.00 26.72 N ATOM 21677 N ALA H 331 -56.863 -1.885 94.927 1.00 23.61 N ATOM 21678 CA ALA H 331 -57.217 -0.961 96.023 1.00 23.81 C ATOM 21679 C ALA H 331 -58.180 0.143 95.560 1.00 20.64 C ATOM 21680 O ALA H 331 -59.144 0.469 96.278 1.00 25.52 O ATOM 21681 CB ALA H 331 -55.966 -0.335 96.654 1.00 14.94 C ATOM 21682 N ALA H 332 -57.923 0.662 94.361 1.00 21.02 N ATOM 21683 CA ALA H 332 -58.790 1.638 93.696 1.00 26.60 C ATOM 21684 C ALA H 332 -60.211 1.107 93.549 1.00 26.61 C ATOM 21685 O ALA H 332 -61.167 1.786 93.885 1.00 29.60 O ATOM 21686 CB ALA H 332 -58.241 2.005 92.320 1.00 20.80 C ATOM 21687 N MET H 333 -60.340 -0.106 93.050 1.00 28.41 N ATOM 21688 CA MET H 333 -61.648 -0.687 92.769 1.00 30.43 C ATOM 21689 C MET H 333 -62.435 -1.036 94.035 1.00 29.82 C ATOM 21690 O MET H 333 -63.674 -0.928 94.064 1.00 33.11 O ATOM 21691 CB MET H 333 -61.466 -1.907 91.882 1.00 26.41 C ATOM 21692 CG MET H 333 -61.078 -1.540 90.446 1.00 39.00 C ATOM 21693 SD MET H 333 -60.616 -2.923 89.375 1.00 47.01 S ATOM 21694 CE MET H 333 -62.211 -3.600 88.939 1.00 47.37 C ATOM 21695 N LEU H 334 -61.731 -1.448 95.085 1.00 27.91 N ATOM 21696 CA LEU H 334 -62.358 -1.699 96.383 1.00 29.36 C ATOM 21697 C LEU H 334 -62.989 -0.420 96.912 1.00 30.15 C ATOM 21698 O LEU H 334 -64.181 -0.395 97.265 1.00 31.19 O ATOM 21699 CB LEU H 334 -61.326 -2.257 97.384 1.00 28.02 C ATOM 21700 CG LEU H 334 -60.906 -3.695 97.104 1.00 32.72 C ATOM 21701 CD1 LEU H 334 -59.612 -4.069 97.822 1.00 24.53 C ATOM 21702 CD2 LEU H 334 -62.028 -4.632 97.482 1.00 26.01 C ATOM 21703 N LYS H 335 -62.198 0.649 96.927 1.00 28.18 N ATOM 21704 CA LYS H 335 -62.670 1.968 97.321 1.00 32.03 C ATOM 21705 C LYS H 335 -63.883 2.420 96.489 1.00 29.32 C ATOM 21706 O LYS H 335 -64.874 2.895 97.051 1.00 36.14 O ATOM 21707 CB LYS H 335 -61.538 3.011 97.231 1.00 30.52 C ATOM 21708 CG LYS H 335 -62.044 4.447 97.205 1.00 35.94 C ATOM 21709 CD LYS H 335 -61.110 5.424 97.867 1.00 45.87 C ATOM 21710 CE LYS H 335 -61.546 6.858 97.585 1.00 42.28 C ATOM 21711 NZ LYS H 335 -63.003 7.117 97.838 1.00 38.42 N ATOM 21712 N ASP H 336 -63.799 2.263 95.168 1.00 32.00 N ATOM 21713 CA ASP H 336 -64.904 2.614 94.264 1.00 30.90 C ATOM 21714 C ASP H 336 -66.155 1.816 94.563 1.00 34.39 C ATOM 21715 O ASP H 336 -67.280 2.298 94.359 1.00 34.71 O ATOM 21716 CB ASP H 336 -64.521 2.373 92.798 1.00 35.72 C ATOM 21717 CG ASP H 336 -63.553 3.421 92.256 1.00 37.89 C ATOM 21718 OD1 ASP H 336 -63.479 4.512 92.845 1.00 43.79 O ATOM 21719 OD2 ASP H 336 -62.859 3.166 91.240 1.00 35.53 O ATOM 21720 N ASN H 337 -65.975 0.586 95.027 1.00 34.55 N ATOM 21721 CA ASN H 337 -67.109 -0.268 95.398 1.00 31.81 C ATOM 21722 C ASN H 337 -67.458 -0.236 96.878 1.00 33.74 C ATOM 21723 O ASN H 337 -68.148 -1.127 97.374 1.00 34.68 O ATOM 21724 CB ASN H 337 -66.854 -1.695 94.925 1.00 34.84 C ATOM 21725 CG ASN H 337 -67.077 -1.841 93.453 1.00 42.33 C ATOM 21726 OD1 ASN H 337 -68.199 -2.065 93.018 1.00 56.03 O ATOM 21727 ND2 ASN H 337 -66.021 -1.679 92.666 1.00 46.62 N