>>2VIG:HELIX   43  43 MET C  259  ARG C  297  1                                  39    
MGFKIAMQTLDMGRIGIASQALGIAQTALDCAVNYAENR
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 43 43 MET C 259 ARG C 297 1 39 ATOM 7172 N MET C 259 -30.151 -18.275 -1.914 1.00 30.83 N ATOM 7173 CA MET C 259 -30.602 -17.720 -0.634 1.00 32.17 C ATOM 7174 C MET C 259 -29.854 -18.299 0.580 1.00 29.82 C ATOM 7175 O MET C 259 -30.061 -17.836 1.695 1.00 35.30 O ATOM 7176 CB MET C 259 -32.099 -17.972 -0.408 1.00 33.32 C ATOM 7177 CG MET C 259 -33.051 -16.955 -1.034 1.00 39.67 C ATOM 7178 SD MET C 259 -34.792 -17.222 -0.583 1.00 54.02 S ATOM 7179 CE MET C 259 -34.778 -16.916 1.189 1.00 43.68 C ATOM 7180 N GLY C 260 -29.001 -19.299 0.373 1.00 27.35 N ATOM 7181 CA GLY C 260 -28.434 -20.068 1.481 1.00 29.01 C ATOM 7182 C GLY C 260 -27.641 -19.242 2.470 1.00 30.47 C ATOM 7183 O GLY C 260 -27.858 -19.361 3.673 1.00 28.89 O ATOM 7184 N PHE C 261 -26.698 -18.442 1.960 1.00 30.74 N ATOM 7185 CA PHE C 261 -25.827 -17.676 2.818 1.00 29.27 C ATOM 7186 C PHE C 261 -26.641 -16.732 3.709 1.00 32.23 C ATOM 7187 O PHE C 261 -26.329 -16.605 4.888 1.00 26.28 O ATOM 7188 CB PHE C 261 -24.751 -16.914 2.033 1.00 30.44 C ATOM 7189 CG PHE C 261 -23.739 -16.234 2.928 1.00 34.48 C ATOM 7190 CD1 PHE C 261 -22.670 -16.956 3.458 1.00 42.97 C ATOM 7191 CD2 PHE C 261 -23.893 -14.895 3.287 1.00 36.16 C ATOM 7192 CE1 PHE C 261 -21.760 -16.345 4.303 1.00 44.63 C ATOM 7193 CE2 PHE C 261 -22.996 -14.278 4.130 1.00 37.78 C ATOM 7194 CZ PHE C 261 -21.923 -14.996 4.636 1.00 40.75 C ATOM 7195 N LYS C 262 -27.689 -16.112 3.147 1.00 30.10 N ATOM 7196 CA LYS C 262 -28.629 -15.290 3.910 1.00 31.51 C ATOM 7197 C LYS C 262 -29.469 -16.087 4.922 1.00 31.31 C ATOM 7198 O LYS C 262 -29.728 -15.597 6.026 1.00 25.39 O ATOM 7199 CB LYS C 262 -29.554 -14.483 2.960 1.00 31.54 C ATOM 7200 CG LYS C 262 -30.829 -13.918 3.596 1.00 41.39 C ATOM 7201 N ILE C 263 -29.938 -17.275 4.520 1.00 30.23 N ATOM 7202 CA ILE C 263 -30.641 -18.170 5.429 1.00 25.95 C ATOM 7203 C ILE C 263 -29.714 -18.563 6.603 1.00 25.87 C ATOM 7204 O ILE C 263 -30.115 -18.501 7.740 1.00 26.21 O ATOM 7205 CB ILE C 263 -31.204 -19.433 4.711 1.00 26.79 C ATOM 7206 CG1 ILE C 263 -32.358 -19.033 3.777 1.00 27.66 C ATOM 7207 CG2 ILE C 263 -31.688 -20.497 5.740 1.00 21.69 C ATOM 7208 CD1 ILE C 263 -32.848 -20.159 2.774 1.00 20.62 C ATOM 7209 N ALA C 264 -28.466 -18.917 6.302 1.00 24.13 N ATOM 7210 CA ALA C 264 -27.519 -19.303 7.306 1.00 25.56 C ATOM 7211 C ALA C 264 -27.241 -18.158 8.293 1.00 30.08 C ATOM 7212 O ALA C 264 -27.152 -18.401 9.499 1.00 27.22 O ATOM 7213 CB ALA C 264 -26.213 -19.763 6.653 1.00 22.09 C ATOM 7214 N MET C 265 -27.079 -16.933 7.774 1.00 28.42 N ATOM 7215 CA MET C 265 -26.689 -15.790 8.607 1.00 31.31 C ATOM 7216 C MET C 265 -27.847 -15.369 9.494 1.00 28.84 C ATOM 7217 O MET C 265 -27.656 -15.102 10.675 1.00 28.82 O ATOM 7218 CB MET C 265 -26.199 -14.597 7.782 1.00 28.76 C ATOM 7219 CG MET C 265 -24.837 -14.757 7.137 1.00 35.56 C ATOM 7220 SD MET C 265 -23.512 -15.375 8.219 1.00 43.65 S ATOM 7221 CE MET C 265 -23.405 -17.099 7.684 1.00 36.63 C ATOM 7222 N GLN C 266 -29.056 -15.357 8.946 1.00 27.61 N ATOM 7223 CA GLN C 266 -30.219 -15.014 9.745 1.00 26.59 C ATOM 7224 C GLN C 266 -30.557 -16.072 10.779 1.00 26.80 C ATOM 7225 O GLN C 266 -31.105 -15.758 11.856 1.00 24.88 O ATOM 7226 CB GLN C 266 -31.420 -14.727 8.844 1.00 28.69 C ATOM 7227 CG GLN C 266 -31.200 -13.483 8.008 1.00 30.55 C ATOM 7228 CD GLN C 266 -32.373 -13.128 7.100 1.00 34.89 C ATOM 7229 OE1 GLN C 266 -33.459 -13.677 7.214 1.00 41.60 O ATOM 7230 NE2 GLN C 266 -32.148 -12.187 6.204 1.00 51.29 N ATOM 7231 N THR C 267 -30.227 -17.325 10.482 1.00 28.30 N ATOM 7232 CA THR C 267 -30.527 -18.401 11.433 1.00 30.02 C ATOM 7233 C THR C 267 -29.561 -18.289 12.621 1.00 25.62 C ATOM 7234 O THR C 267 -29.966 -18.410 13.775 1.00 23.29 O ATOM 7235 CB THR C 267 -30.530 -19.809 10.755 1.00 26.82 C ATOM 7236 OG1 THR C 267 -31.612 -19.852 9.808 1.00 28.77 O ATOM 7237 CG2 THR C 267 -30.728 -20.946 11.793 1.00 25.78 C ATOM 7238 N LEU C 268 -28.300 -18.022 12.317 1.00 23.37 N ATOM 7239 CA LEU C 268 -27.292 -17.789 13.343 1.00 28.60 C ATOM 7240 C LEU C 268 -27.573 -16.590 14.275 1.00 27.43 C ATOM 7241 O LEU C 268 -27.184 -16.622 15.447 1.00 24.55 O ATOM 7242 CB LEU C 268 -25.898 -17.658 12.696 1.00 25.14 C ATOM 7243 CG LEU C 268 -25.265 -18.942 12.158 1.00 29.90 C ATOM 7244 CD1 LEU C 268 -24.122 -18.593 11.210 1.00 28.79 C ATOM 7245 CD2 LEU C 268 -24.767 -19.846 13.282 1.00 31.87 C ATOM 7246 N ASP C 269 -28.234 -15.542 13.769 1.00 28.46 N ATOM 7247 CA ASP C 269 -28.699 -14.420 14.614 1.00 30.00 C ATOM 7248 C ASP C 269 -29.610 -14.931 15.715 1.00 27.80 C ATOM 7249 O ASP C 269 -29.481 -14.542 16.899 1.00 27.34 O ATOM 7250 CB ASP C 269 -29.461 -13.346 13.806 1.00 29.15 C ATOM 7251 CG ASP C 269 -28.591 -12.644 12.766 1.00 39.93 C ATOM 7252 OD1 ASP C 269 -27.385 -12.449 13.032 1.00 39.57 O ATOM 7253 OD2 ASP C 269 -29.120 -12.276 11.682 1.00 39.29 O ATOM 7254 N MET C 270 -30.547 -15.792 15.330 1.00 29.09 N ATOM 7255 CA MET C 270 -31.475 -16.381 16.287 1.00 31.11 C ATOM 7256 C MET C 270 -30.752 -17.363 17.214 1.00 24.73 C ATOM 7257 O MET C 270 -30.935 -17.343 18.416 1.00 27.40 O ATOM 7258 CB MET C 270 -32.579 -17.134 15.565 1.00 31.98 C ATOM 7259 CG MET C 270 -33.424 -16.289 14.625 1.00 41.37 C ATOM 7260 SD MET C 270 -34.766 -17.288 13.950 1.00 43.18 S ATOM 7261 CE MET C 270 -34.038 -18.192 12.570 1.00 33.00 C ATOM 7262 N GLY C 271 -29.926 -18.218 16.630 1.00 25.98 N ATOM 7263 CA GLY C 271 -29.149 -19.185 17.383 1.00 25.17 C ATOM 7264 C GLY C 271 -28.297 -18.540 18.465 1.00 27.22 C ATOM 7265 O GLY C 271 -28.141 -19.104 19.560 1.00 23.24 O ATOM 7266 N ARG C 272 -27.742 -17.372 18.138 1.00 27.89 N ATOM 7267 CA ARG C 272 -26.850 -16.632 19.033 1.00 23.99 C ATOM 7268 C ARG C 272 -27.507 -16.244 20.342 1.00 23.45 C ATOM 7269 O ARG C 272 -26.840 -16.186 21.378 1.00 21.81 O ATOM 7270 CB ARG C 272 -26.278 -15.409 18.338 1.00 22.03 C ATOM 7271 CG ARG C 272 -25.006 -15.745 17.600 1.00 27.38 C ATOM 7272 CD ARG C 272 -24.738 -14.814 16.463 1.00 27.27 C ATOM 7273 NE ARG C 272 -23.709 -15.358 15.584 1.00 31.33 N ATOM 7274 CZ ARG C 272 -23.211 -14.719 14.534 1.00 33.18 C ATOM 7275 NH1 ARG C 272 -23.661 -13.512 14.214 1.00 31.41 N ATOM 7276 NH2 ARG C 272 -22.274 -15.299 13.792 1.00 31.69 N ATOM 7277 N ILE C 273 -28.816 -16.020 20.297 1.00 19.48 N ATOM 7278 CA ILE C 273 -29.606 -15.749 21.478 1.00 25.12 C ATOM 7279 C ILE C 273 -29.728 -17.003 22.355 1.00 28.61 C ATOM 7280 O ILE C 273 -29.626 -16.918 23.588 1.00 28.68 O ATOM 7281 CB ILE C 273 -31.034 -15.203 21.089 1.00 22.13 C ATOM 7282 CG1 ILE C 273 -30.899 -13.878 20.332 1.00 25.36 C ATOM 7283 CG2 ILE C 273 -31.900 -14.985 22.323 1.00 26.47 C ATOM 7284 CD1 ILE C 273 -32.222 -13.332 19.769 1.00 23.49 C ATOM 7285 N GLY C 274 -29.962 -18.148 21.710 1.00 28.94 N ATOM 7286 CA GLY C 274 -29.985 -19.433 22.386 1.00 24.96 C ATOM 7287 C GLY C 274 -28.688 -19.781 23.076 1.00 23.55 C ATOM 7288 O GLY C 274 -28.700 -20.260 24.217 1.00 25.02 O ATOM 7289 N ILE C 275 -27.580 -19.543 22.387 1.00 20.61 N ATOM 7290 CA ILE C 275 -26.256 -19.801 22.962 1.00 22.83 C ATOM 7291 C ILE C 275 -25.938 -18.807 24.083 1.00 20.46 C ATOM 7292 O ILE C 275 -25.327 -19.186 25.079 1.00 22.30 O ATOM 7293 CB ILE C 275 -25.154 -19.812 21.902 1.00 21.28 C ATOM 7294 CG1 ILE C 275 -25.385 -20.946 20.902 1.00 29.72 C ATOM 7295 CG2 ILE C 275 -23.782 -20.027 22.537 1.00 18.23 C ATOM 7296 CD1 ILE C 275 -25.511 -22.316 21.547 1.00 27.05 C ATOM 7297 N ALA C 276 -26.361 -17.552 23.923 1.00 25.25 N ATOM 7298 CA ALA C 276 -26.243 -16.555 25.001 1.00 25.77 C ATOM 7299 C ALA C 276 -26.970 -17.070 26.250 1.00 24.05 C ATOM 7300 O ALA C 276 -26.440 -17.028 27.352 1.00 23.03 O ATOM 7301 CB ALA C 276 -26.777 -15.180 24.552 1.00 17.76 C ATOM 7302 N SER C 277 -28.163 -17.616 26.066 1.00 24.40 N ATOM 7303 CA SER C 277 -28.932 -18.121 27.185 1.00 25.21 C ATOM 7304 C SER C 277 -28.279 -19.352 27.833 1.00 25.43 C ATOM 7305 O SER C 277 -28.328 -19.523 29.059 1.00 24.37 O ATOM 7306 CB SER C 277 -30.342 -18.442 26.738 1.00 27.32 C ATOM 7307 OG SER C 277 -30.918 -17.307 26.118 1.00 28.53 O ATOM 7308 N GLN C 278 -27.672 -20.203 27.012 1.00 20.16 N ATOM 7309 CA GLN C 278 -27.042 -21.379 27.521 1.00 22.94 C ATOM 7310 C GLN C 278 -25.856 -20.954 28.396 1.00 22.38 C ATOM 7311 O GLN C 278 -25.647 -21.494 29.487 1.00 20.38 O ATOM 7312 CB GLN C 278 -26.570 -22.263 26.379 1.00 26.15 C ATOM 7313 CG GLN C 278 -25.983 -23.597 26.849 1.00 26.44 C ATOM 7314 CD GLN C 278 -24.967 -24.176 25.873 1.00 33.09 C ATOM 7315 OE1 GLN C 278 -24.447 -23.479 24.991 1.00 26.84 O ATOM 7316 NE2 GLN C 278 -24.684 -25.472 26.027 1.00 28.78 N ATOM 7317 N ALA C 279 -25.114 -19.965 27.911 1.00 21.90 N ATOM 7318 CA ALA C 279 -23.956 -19.425 28.612 1.00 19.64 C ATOM 7319 C ALA C 279 -24.386 -18.783 29.931 1.00 18.21 C ATOM 7320 O ALA C 279 -23.725 -18.972 30.949 1.00 19.81 O ATOM 7321 CB ALA C 279 -23.227 -18.425 27.736 1.00 17.03 C ATOM 7322 N LEU C 280 -25.532 -18.103 29.938 1.00 22.67 N ATOM 7323 CA LEU C 280 -26.125 -17.599 31.187 1.00 21.55 C ATOM 7324 C LEU C 280 -26.446 -18.676 32.213 1.00 21.43 C ATOM 7325 O LEU C 280 -26.276 -18.438 33.406 1.00 20.01 O ATOM 7326 CB LEU C 280 -27.403 -16.796 30.954 1.00 23.98 C ATOM 7327 CG LEU C 280 -27.334 -15.612 29.984 1.00 29.84 C ATOM 7328 CD1 LEU C 280 -28.720 -15.078 29.723 1.00 19.70 C ATOM 7329 CD2 LEU C 280 -26.415 -14.515 30.461 1.00 22.85 C ATOM 7330 N GLY C 281 -26.955 -19.822 31.765 1.00 21.43 N ATOM 7331 CA GLY C 281 -27.260 -20.946 32.662 1.00 22.38 C ATOM 7332 C GLY C 281 -26.006 -21.551 33.280 1.00 21.50 C ATOM 7333 O GLY C 281 -25.956 -21.833 34.477 1.00 25.07 O ATOM 7334 N ILE C 282 -24.991 -21.711 32.451 1.00 20.40 N ATOM 7335 CA ILE C 282 -23.680 -22.205 32.887 1.00 21.70 C ATOM 7336 C ILE C 282 -23.042 -21.279 33.929 1.00 24.59 C ATOM 7337 O ILE C 282 -22.572 -21.741 34.987 1.00 18.51 O ATOM 7338 CB ILE C 282 -22.718 -22.348 31.688 1.00 23.06 C ATOM 7339 CG1 ILE C 282 -23.177 -23.484 30.755 1.00 23.15 C ATOM 7340 CG2 ILE C 282 -21.244 -22.595 32.163 1.00 17.97 C ATOM 7341 CD1 ILE C 282 -22.439 -23.527 29.435 1.00 18.43 C ATOM 7342 N ALA C 283 -22.992 -19.986 33.595 1.00 22.25 N ATOM 7343 CA ALA C 283 -22.552 -18.949 34.519 1.00 24.24 C ATOM 7344 C ALA C 283 -23.402 -18.894 35.814 1.00 22.56 C ATOM 7345 O ALA C 283 -22.859 -18.812 36.908 1.00 22.26 O ATOM 7346 CB ALA C 283 -22.531 -17.621 33.813 1.00 21.53 C ATOM 7347 N GLN C 284 -24.727 -18.941 35.700 1.00 21.00 N ATOM 7348 CA GLN C 284 -25.587 -18.893 36.891 1.00 22.13 C ATOM 7349 C GLN C 284 -25.329 -20.050 37.863 1.00 24.48 C ATOM 7350 O GLN C 284 -25.227 -19.845 39.070 1.00 20.61 O ATOM 7351 CB GLN C 284 -27.075 -18.869 36.537 1.00 23.05 C ATOM 7352 CG GLN C 284 -27.982 -18.785 37.776 1.00 23.22 C ATOM 7353 CD GLN C 284 -27.894 -17.440 38.485 1.00 31.44 C ATOM 7354 OE1 GLN C 284 -28.382 -16.445 37.968 1.00 31.79 O ATOM 7355 NE2 GLN C 284 -27.278 -17.406 39.673 1.00 23.55 N ATOM 7356 N THR C 285 -25.217 -21.256 37.320 1.00 23.32 N ATOM 7357 CA THR C 285 -24.966 -22.420 38.128 1.00 24.74 C ATOM 7358 C THR C 285 -23.524 -22.406 38.720 1.00 19.51 C ATOM 7359 O THR C 285 -23.338 -22.796 39.865 1.00 22.62 O ATOM 7360 CB THR C 285 -25.292 -23.738 37.360 1.00 25.88 C ATOM 7361 OG1 THR C 285 -25.574 -24.768 38.307 1.00 29.18 O ATOM 7362 CG2 THR C 285 -24.142 -24.149 36.465 1.00 22.74 C ATOM 7363 N ALA C 286 -22.541 -21.912 37.974 1.00 23.80 N ATOM 7364 CA ALA C 286 -21.176 -21.773 38.514 1.00 19.42 C ATOM 7365 C ALA C 286 -21.118 -20.784 39.710 1.00 23.54 C ATOM 7366 O ALA C 286 -20.425 -21.030 40.736 1.00 19.73 O ATOM 7367 CB ALA C 286 -20.221 -21.350 37.422 1.00 16.30 C ATOM 7368 N LEU C 287 -21.825 -19.663 39.561 1.00 22.60 N ATOM 7369 CA LEU C 287 -21.979 -18.668 40.621 1.00 22.36 C ATOM 7370 C LEU C 287 -22.700 -19.237 41.841 1.00 23.22 C ATOM 7371 O LEU C 287 -22.269 -18.996 42.990 1.00 19.67 O ATOM 7372 CB LEU C 287 -22.715 -17.407 40.110 1.00 21.27 C ATOM 7373 CG LEU C 287 -22.983 -16.282 41.134 1.00 24.91 C ATOM 7374 CD1 LEU C 287 -21.672 -15.927 41.892 1.00 17.68 C ATOM 7375 CD2 LEU C 287 -23.624 -15.017 40.469 1.00 24.10 C ATOM 7376 N ASP C 288 -23.790 -19.975 41.606 1.00 24.88 N ATOM 7377 CA ASP C 288 -24.517 -20.639 42.690 1.00 25.72 C ATOM 7378 C ASP C 288 -23.605 -21.562 43.484 1.00 24.92 C ATOM 7379 O ASP C 288 -23.666 -21.615 44.704 1.00 28.02 O ATOM 7380 CB ASP C 288 -25.650 -21.498 42.174 1.00 26.18 C ATOM 7381 CG ASP C 288 -26.779 -20.701 41.570 1.00 31.19 C ATOM 7382 OD1 ASP C 288 -26.854 -19.477 41.795 1.00 31.72 O ATOM 7383 OD2 ASP C 288 -27.594 -21.324 40.861 1.00 31.49 O ATOM 7384 N CYS C 289 -22.787 -22.301 42.755 1.00 27.70 N ATOM 7385 CA CYS C 289 -21.834 -23.214 43.321 1.00 25.30 C ATOM 7386 C CYS C 289 -20.792 -22.478 44.208 1.00 26.56 C ATOM 7387 O CYS C 289 -20.521 -22.889 45.337 1.00 24.33 O ATOM 7388 CB CYS C 289 -21.164 -23.986 42.176 1.00 27.15 C ATOM 7389 SG CYS C 289 -19.785 -24.976 42.702 1.00 35.48 S ATOM 7390 N ALA C 290 -20.231 -21.388 43.697 1.00 27.42 N ATOM 7391 CA ALA C 290 -19.263 -20.600 44.449 1.00 24.12 C ATOM 7392 C ALA C 290 -19.855 -20.013 45.754 1.00 25.29 C ATOM 7393 O ALA C 290 -19.226 -20.087 46.815 1.00 22.91 O ATOM 7394 CB ALA C 290 -18.640 -19.509 43.559 1.00 20.03 C ATOM 7395 N VAL C 291 -21.086 -19.495 45.688 1.00 21.85 N ATOM 7396 CA VAL C 291 -21.691 -18.804 46.806 1.00 23.81 C ATOM 7397 C VAL C 291 -21.958 -19.759 47.983 1.00 24.92 C ATOM 7398 O VAL C 291 -21.610 -19.466 49.115 1.00 25.68 O ATOM 7399 CB VAL C 291 -22.987 -18.076 46.384 1.00 22.75 C ATOM 7400 CG1 VAL C 291 -23.838 -17.674 47.605 1.00 29.11 C ATOM 7401 CG2 VAL C 291 -22.672 -16.854 45.564 1.00 18.54 C ATOM 7402 N ASN C 292 -22.564 -20.897 47.683 1.00 28.69 N ATOM 7403 CA ASN C 292 -22.848 -21.916 48.669 1.00 26.47 C ATOM 7404 C ASN C 292 -21.576 -22.468 49.306 1.00 27.02 C ATOM 7405 O ASN C 292 -21.473 -22.633 50.537 1.00 25.32 O ATOM 7406 CB ASN C 292 -23.622 -23.049 48.015 1.00 27.63 C ATOM 7407 CG ASN C 292 -24.818 -23.431 48.809 1.00 53.97 C ATOM 7408 OD1 ASN C 292 -25.812 -22.699 48.811 1.00 63.98 O ATOM 7409 ND2 ASN C 292 -24.734 -24.557 49.527 1.00 47.12 N ATOM 7410 N TYR C 293 -20.593 -22.735 48.464 1.00 22.70 N ATOM 7411 CA TYR C 293 -19.321 -23.201 48.967 1.00 23.64 C ATOM 7412 C TYR C 293 -18.703 -22.206 49.938 1.00 25.50 C ATOM 7413 O TYR C 293 -18.425 -22.553 51.082 1.00 23.58 O ATOM 7414 CB TYR C 293 -18.337 -23.493 47.852 1.00 20.94 C ATOM 7415 CG TYR C 293 -17.148 -24.241 48.370 1.00 20.51 C ATOM 7416 CD1 TYR C 293 -17.255 -25.588 48.690 1.00 28.75 C ATOM 7417 CD2 TYR C 293 -15.911 -23.609 48.545 1.00 23.33 C ATOM 7418 CE1 TYR C 293 -16.188 -26.285 49.198 1.00 23.06 C ATOM 7419 CE2 TYR C 293 -14.827 -24.306 49.049 1.00 25.21 C ATOM 7420 CZ TYR C 293 -14.977 -25.645 49.368 1.00 32.60 C ATOM 7421 OH TYR C 293 -13.923 -26.359 49.849 1.00 22.02 O ATOM 7422 N ALA C 294 -18.508 -20.977 49.462 1.00 25.89 N ATOM 7423 CA ALA C 294 -17.858 -19.920 50.210 1.00 24.17 C ATOM 7424 C ALA C 294 -18.577 -19.519 51.512 1.00 24.63 C ATOM 7425 O ALA C 294 -17.947 -19.065 52.456 1.00 23.62 O ATOM 7426 CB ALA C 294 -17.698 -18.720 49.319 1.00 21.58 C ATOM 7427 N GLU C 295 -19.893 -19.698 51.557 1.00 22.01 N ATOM 7428 CA GLU C 295 -20.656 -19.463 52.767 1.00 28.77 C ATOM 7429 C GLU C 295 -20.405 -20.512 53.844 1.00 29.75 C ATOM 7430 O GLU C 295 -20.546 -20.222 55.025 1.00 28.38 O ATOM 7431 CB GLU C 295 -22.154 -19.451 52.461 1.00 24.60 C ATOM 7432 CG GLU C 295 -22.617 -18.228 51.698 1.00 33.88 C ATOM 7433 CD GLU C 295 -22.853 -17.041 52.586 1.00 48.50 C ATOM 7434 OE1 GLU C 295 -21.865 -16.411 53.051 1.00 41.35 O ATOM 7435 OE2 GLU C 295 -24.037 -16.736 52.801 1.00 51.96 O ATOM 7436 N ASN C 296 -20.054 -21.728 53.430 1.00 30.29 N ATOM 7437 CA ASN C 296 -19.913 -22.861 54.348 1.00 30.54 C ATOM 7438 C ASN C 296 -18.470 -23.280 54.654 1.00 28.86 C ATOM 7439 O ASN C 296 -18.222 -23.892 55.688 1.00 33.37 O ATOM 7440 CB ASN C 296 -20.714 -24.036 53.812 1.00 29.89 C ATOM 7441 CG ASN C 296 -22.207 -23.791 53.896 1.00 32.46 C ATOM 7442 OD1 ASN C 296 -22.782 -23.820 54.985 1.00 35.45 O ATOM 7443 ND2 ASN C 296 -22.838 -23.516 52.755 1.00 35.31 N ATOM 7444 N ARG C 297 -17.543 -22.919 53.770 1.00 27.30 N ATOM 7445 CA ARG C 297 -16.114 -23.119 53.969 1.00 27.28 C ATOM 7446 C ARG C 297 -15.526 -22.057 54.900 1.00 29.42 C ATOM 7447 O ARG C 297 -15.653 -20.872 54.654 1.00 27.71 O ATOM 7448 CB ARG C 297 -15.406 -23.091 52.605 1.00 27.80 C ATOM 7449 CG ARG C 297 -13.913 -23.347 52.616 1.00 22.96 C ATOM 7450 CD ARG C 297 -13.542 -24.730 53.069 1.00 21.84 C ATOM 7451 NE ARG C 297 -12.113 -24.992 52.838 1.00 21.80 N ATOM 7452 CZ ARG C 297 -11.520 -26.157 53.113 1.00 24.53 C ATOM 7453 NH1 ARG C 297 -12.205 -27.151 53.682 1.00 26.19 N ATOM 7454 NH2 ARG C 297 -10.233 -26.320 52.849 1.00 24.55 N