>>2VIG:HELIX   60  60 MET D  259  ARG D  297  1                                  39    
MGFKIAMQTLDMGRIGIASQALGIAQTALDCAVNYAENR
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 60 60 MET D 259 ARG D 297 1 39 ATOM 9999 N MET D 259 9.493 -25.792 64.785 1.00 29.86 N ATOM 10000 CA MET D 259 10.006 -25.177 63.541 1.00 33.83 C ATOM 10001 C MET D 259 9.153 -25.488 62.305 1.00 29.44 C ATOM 10002 O MET D 259 9.465 -25.013 61.219 1.00 31.70 O ATOM 10003 CB MET D 259 11.423 -25.675 63.226 1.00 33.54 C ATOM 10004 CG MET D 259 12.527 -24.904 63.870 1.00 40.37 C ATOM 10005 SD MET D 259 14.131 -25.731 63.616 1.00 53.71 S ATOM 10006 CE MET D 259 14.393 -25.655 61.834 1.00 45.21 C ATOM 10007 N GLY D 260 8.111 -26.306 62.464 1.00 25.05 N ATOM 10008 CA GLY D 260 7.330 -26.809 61.334 1.00 28.15 C ATOM 10009 C GLY D 260 6.802 -25.745 60.396 1.00 28.14 C ATOM 10010 O GLY D 260 7.016 -25.833 59.179 1.00 25.65 O ATOM 10011 N PHE D 261 6.137 -24.727 60.947 1.00 31.38 N ATOM 10012 CA PHE D 261 5.543 -23.680 60.102 1.00 29.39 C ATOM 10013 C PHE D 261 6.588 -22.963 59.238 1.00 31.35 C ATOM 10014 O PHE D 261 6.382 -22.733 58.035 1.00 28.84 O ATOM 10015 CB PHE D 261 4.742 -22.658 60.916 1.00 31.82 C ATOM 10016 CG PHE D 261 3.882 -21.790 60.053 1.00 31.38 C ATOM 10017 CD1 PHE D 261 2.681 -22.280 59.541 1.00 42.58 C ATOM 10018 CD2 PHE D 261 4.307 -20.524 59.676 1.00 36.27 C ATOM 10019 CE1 PHE D 261 1.898 -21.499 58.698 1.00 43.33 C ATOM 10020 CE2 PHE D 261 3.524 -19.731 58.842 1.00 40.59 C ATOM 10021 CZ PHE D 261 2.324 -20.220 58.350 1.00 37.50 C ATOM 10022 N LYS D 262 7.713 -22.641 59.858 1.00 27.39 N ATOM 10023 CA LYS D 262 8.815 -21.994 59.180 1.00 30.05 C ATOM 10024 C LYS D 262 9.398 -22.877 58.059 1.00 29.17 C ATOM 10025 O LYS D 262 9.725 -22.376 56.967 1.00 27.53 O ATOM 10026 CB LYS D 262 9.883 -21.618 60.217 1.00 28.43 C ATOM 10027 CG LYS D 262 11.225 -21.160 59.646 1.00 44.11 C ATOM 10028 CD LYS D 262 12.341 -21.234 60.715 1.00 35.23 C ATOM 10029 CE LYS D 262 13.716 -21.606 60.131 1.00 52.61 C ATOM 10030 NZ LYS D 262 14.636 -22.166 61.171 1.00 56.34 N ATOM 10031 N ILE D 263 9.532 -24.178 58.331 1.00 26.77 N ATOM 10032 CA ILE D 263 10.062 -25.122 57.354 1.00 27.28 C ATOM 10033 C ILE D 263 9.152 -25.189 56.138 1.00 23.40 C ATOM 10034 O ILE D 263 9.602 -25.091 55.014 1.00 25.40 O ATOM 10035 CB ILE D 263 10.241 -26.549 57.973 1.00 27.90 C ATOM 10036 CG1 ILE D 263 11.387 -26.518 58.987 1.00 25.59 C ATOM 10037 CG2 ILE D 263 10.541 -27.608 56.880 1.00 21.20 C ATOM 10038 CD1 ILE D 263 11.417 -27.712 59.945 1.00 23.86 C ATOM 10039 N ALA D 264 7.868 -25.357 56.400 1.00 24.53 N ATOM 10040 CA ALA D 264 6.865 -25.388 55.375 1.00 26.57 C ATOM 10041 C ALA D 264 6.936 -24.118 54.507 1.00 28.45 C ATOM 10042 O ALA D 264 6.997 -24.215 53.289 1.00 26.80 O ATOM 10043 CB ALA D 264 5.506 -25.542 56.008 1.00 21.95 C ATOM 10044 N MET D 265 7.000 -22.942 55.140 1.00 27.95 N ATOM 10045 CA MET D 265 6.937 -21.669 54.414 1.00 31.07 C ATOM 10046 C MET D 265 8.161 -21.445 53.561 1.00 25.86 C ATOM 10047 O MET D 265 8.046 -20.998 52.433 1.00 24.67 O ATOM 10048 CB MET D 265 6.724 -20.477 55.352 1.00 31.00 C ATOM 10049 CG MET D 265 5.373 -20.456 56.039 1.00 34.84 C ATOM 10050 SD MET D 265 3.933 -20.476 54.929 1.00 43.78 S ATOM 10051 CE MET D 265 3.306 -22.154 55.125 1.00 34.42 C ATOM 10052 N GLN D 266 9.335 -21.777 54.083 1.00 27.27 N ATOM 10053 CA GLN D 266 10.550 -21.682 53.310 1.00 26.89 C ATOM 10054 C GLN D 266 10.627 -22.761 52.228 1.00 29.05 C ATOM 10055 O GLN D 266 11.347 -22.579 51.229 1.00 28.72 O ATOM 10056 CB GLN D 266 11.787 -21.772 54.213 1.00 28.86 C ATOM 10057 CG GLN D 266 11.914 -20.628 55.205 1.00 34.41 C ATOM 10058 CD GLN D 266 13.187 -20.719 56.034 1.00 32.95 C ATOM 10059 OE1 GLN D 266 14.271 -20.875 55.502 1.00 42.53 O ATOM 10060 NE2 GLN D 266 13.050 -20.601 57.335 1.00 50.33 N ATOM 10061 N THR D 267 9.913 -23.872 52.424 1.00 27.46 N ATOM 10062 CA THR D 267 9.914 -24.939 51.421 1.00 30.92 C ATOM 10063 C THR D 267 9.074 -24.479 50.244 1.00 27.28 C ATOM 10064 O THR D 267 9.504 -24.568 49.097 1.00 26.06 O ATOM 10065 CB THR D 267 9.373 -26.288 51.956 1.00 27.41 C ATOM 10066 OG1 THR D 267 10.205 -26.741 53.032 1.00 29.36 O ATOM 10067 CG2 THR D 267 9.356 -27.365 50.846 1.00 22.85 C ATOM 10068 N LEU D 268 7.894 -23.955 50.559 1.00 25.80 N ATOM 10069 CA LEU D 268 6.985 -23.429 49.543 1.00 28.43 C ATOM 10070 C LEU D 268 7.593 -22.305 48.721 1.00 29.42 C ATOM 10071 O LEU D 268 7.306 -22.194 47.526 1.00 26.67 O ATOM 10072 CB LEU D 268 5.691 -22.967 50.179 1.00 28.00 C ATOM 10073 CG LEU D 268 4.802 -24.055 50.762 1.00 29.28 C ATOM 10074 CD1 LEU D 268 3.802 -23.379 51.666 1.00 29.83 C ATOM 10075 CD2 LEU D 268 4.140 -24.878 49.655 1.00 34.66 C ATOM 10076 N ASP D 269 8.450 -21.494 49.337 1.00 27.36 N ATOM 10077 CA ASP D 269 9.172 -20.480 48.603 1.00 28.64 C ATOM 10078 C ASP D 269 9.969 -21.120 47.464 1.00 30.69 C ATOM 10079 O ASP D 269 9.902 -20.642 46.314 1.00 26.55 O ATOM 10080 CB ASP D 269 10.105 -19.668 49.517 1.00 29.03 C ATOM 10081 CG ASP D 269 9.344 -18.843 50.573 1.00 39.94 C ATOM 10082 OD1 ASP D 269 8.191 -18.397 50.320 1.00 39.30 O ATOM 10083 OD2 ASP D 269 9.902 -18.638 51.676 1.00 39.54 O ATOM 10084 N MET D 270 10.724 -22.178 47.774 1.00 27.75 N ATOM 10085 CA MET D 270 11.490 -22.913 46.744 1.00 31.01 C ATOM 10086 C MET D 270 10.562 -23.599 45.754 1.00 24.66 C ATOM 10087 O MET D 270 10.779 -23.548 44.550 1.00 27.58 O ATOM 10088 CB MET D 270 12.427 -23.969 47.363 1.00 32.99 C ATOM 10089 CG MET D 270 13.509 -23.401 48.273 1.00 39.74 C ATOM 10090 SD MET D 270 14.596 -24.698 48.961 1.00 42.31 S ATOM 10091 CE MET D 270 13.431 -25.647 49.949 1.00 32.01 C ATOM 10092 N GLY D 271 9.503 -24.214 46.271 1.00 26.13 N ATOM 10093 CA GLY D 271 8.542 -24.915 45.442 1.00 24.99 C ATOM 10094 C GLY D 271 7.930 -24.011 44.391 1.00 27.84 C ATOM 10095 O GLY D 271 7.746 -24.408 43.228 1.00 24.43 O ATOM 10096 N ARG D 272 7.630 -22.785 44.811 1.00 27.50 N ATOM 10097 CA ARG D 272 6.989 -21.806 43.956 1.00 25.48 C ATOM 10098 C ARG D 272 7.840 -21.493 42.715 1.00 25.31 C ATOM 10099 O ARG D 272 7.290 -21.192 41.671 1.00 25.48 O ATOM 10100 CB ARG D 272 6.642 -20.543 44.769 1.00 23.23 C ATOM 10101 CG ARG D 272 5.408 -20.729 45.640 1.00 27.55 C ATOM 10102 CD ARG D 272 5.324 -19.732 46.789 1.00 27.20 C ATOM 10103 NE ARG D 272 4.159 -20.050 47.622 1.00 30.06 N ATOM 10104 CZ ARG D 272 3.815 -19.408 48.739 1.00 33.92 C ATOM 10105 NH1 ARG D 272 4.531 -18.387 49.186 1.00 29.03 N ATOM 10106 NH2 ARG D 272 2.729 -19.790 49.410 1.00 32.51 N ATOM 10107 N ILE D 273 9.167 -21.608 42.803 1.00 23.34 N ATOM 10108 CA ILE D 273 10.005 -21.382 41.624 1.00 25.70 C ATOM 10109 C ILE D 273 9.861 -22.572 40.672 1.00 26.69 C ATOM 10110 O ILE D 273 9.895 -22.418 39.453 1.00 22.29 O ATOM 10111 CB ILE D 273 11.480 -21.173 42.003 1.00 25.66 C ATOM 10112 CG1 ILE D 273 11.605 -19.945 42.916 1.00 27.46 C ATOM 10113 CG2 ILE D 273 12.366 -21.050 40.733 1.00 28.83 C ATOM 10114 CD1 ILE D 273 12.948 -19.834 43.623 1.00 20.60 C ATOM 10115 N GLY D 274 9.679 -23.750 41.256 1.00 29.48 N ATOM 10116 CA GLY D 274 9.390 -24.959 40.501 1.00 27.36 C ATOM 10117 C GLY D 274 8.060 -24.901 39.778 1.00 23.42 C ATOM 10118 O GLY D 274 7.990 -25.214 38.605 1.00 28.14 O ATOM 10119 N ILE D 275 7.009 -24.501 40.476 1.00 23.41 N ATOM 10120 CA ILE D 275 5.687 -24.407 39.860 1.00 22.83 C ATOM 10121 C ILE D 275 5.634 -23.288 38.811 1.00 23.18 C ATOM 10122 O ILE D 275 5.021 -23.460 37.765 1.00 23.91 O ATOM 10123 CB ILE D 275 4.535 -24.288 40.910 1.00 24.43 C ATOM 10124 CG1 ILE D 275 4.499 -25.527 41.820 1.00 29.99 C ATOM 10125 CG2 ILE D 275 3.173 -24.098 40.249 1.00 19.93 C ATOM 10126 CD1 ILE D 275 4.607 -26.910 41.095 1.00 23.20 C ATOM 10127 N ALA D 276 6.260 -22.148 39.081 1.00 26.10 N ATOM 10128 CA ALA D 276 6.391 -21.124 38.060 1.00 25.71 C ATOM 10129 C ALA D 276 7.025 -21.699 36.788 1.00 23.12 C ATOM 10130 O ALA D 276 6.546 -21.417 35.678 1.00 24.27 O ATOM 10131 CB ALA D 276 7.169 -19.915 38.574 1.00 17.77 C ATOM 10132 N SER D 277 8.082 -22.505 36.936 1.00 27.52 N ATOM 10133 CA SER D 277 8.748 -23.118 35.788 1.00 22.76 C ATOM 10134 C SER D 277 7.869 -24.142 35.034 1.00 23.64 C ATOM 10135 O SER D 277 7.969 -24.228 33.806 1.00 23.83 O ATOM 10136 CB SER D 277 10.047 -23.770 36.219 1.00 28.86 C ATOM 10137 OG SER D 277 10.970 -22.800 36.672 1.00 25.71 O ATOM 10138 N GLN D 278 7.060 -24.927 35.762 1.00 20.05 N ATOM 10139 CA GLN D 278 6.062 -25.819 35.162 1.00 25.24 C ATOM 10140 C GLN D 278 5.029 -25.022 34.338 1.00 23.49 C ATOM 10141 O GLN D 278 4.680 -25.413 33.227 1.00 21.27 O ATOM 10142 CB GLN D 278 5.323 -26.620 36.241 1.00 23.82 C ATOM 10143 CG GLN D 278 4.339 -27.679 35.724 1.00 25.09 C ATOM 10144 CD GLN D 278 3.161 -27.967 36.679 1.00 32.25 C ATOM 10145 OE1 GLN D 278 2.903 -27.230 37.647 1.00 28.35 O ATOM 10146 NE2 GLN D 278 2.430 -29.036 36.385 1.00 28.62 N ATOM 10147 N ALA D 279 4.514 -23.942 34.924 1.00 22.51 N ATOM 10148 CA ALA D 279 3.579 -23.042 34.257 1.00 20.66 C ATOM 10149 C ALA D 279 4.164 -22.438 32.977 1.00 23.51 C ATOM 10150 O ALA D 279 3.493 -22.310 31.964 1.00 18.58 O ATOM 10151 CB ALA D 279 3.135 -21.931 35.221 1.00 17.01 C ATOM 10152 N LEU D 280 5.441 -22.076 33.025 1.00 17.86 N ATOM 10153 CA LEU D 280 6.130 -21.612 31.847 1.00 21.24 C ATOM 10154 C LEU D 280 6.175 -22.651 30.723 1.00 23.36 C ATOM 10155 O LEU D 280 6.056 -22.292 29.553 1.00 21.19 O ATOM 10156 CB LEU D 280 7.550 -21.219 32.218 1.00 22.29 C ATOM 10157 CG LEU D 280 7.778 -19.990 33.096 1.00 29.85 C ATOM 10158 CD1 LEU D 280 9.280 -19.944 33.452 1.00 22.70 C ATOM 10159 CD2 LEU D 280 7.314 -18.684 32.409 1.00 25.03 C ATOM 10160 N GLY D 281 6.415 -23.914 31.089 1.00 23.15 N ATOM 10161 CA GLY D 281 6.497 -24.999 30.144 1.00 21.62 C ATOM 10162 C GLY D 281 5.150 -25.261 29.504 1.00 20.36 C ATOM 10163 O GLY D 281 5.087 -25.515 28.308 1.00 20.29 O ATOM 10164 N ILE D 282 4.086 -25.168 30.296 1.00 20.05 N ATOM 10165 CA ILE D 282 2.740 -25.338 29.773 1.00 23.75 C ATOM 10166 C ILE D 282 2.379 -24.177 28.807 1.00 23.58 C ATOM 10167 O ILE D 282 1.873 -24.402 27.714 1.00 20.57 O ATOM 10168 CB ILE D 282 1.717 -25.438 30.918 1.00 23.27 C ATOM 10169 CG1 ILE D 282 1.921 -26.727 31.709 1.00 26.91 C ATOM 10170 CG2 ILE D 282 0.304 -25.386 30.377 1.00 20.71 C ATOM 10171 CD1 ILE D 282 1.186 -26.781 33.039 1.00 22.44 C ATOM 10172 N ALA D 283 2.646 -22.942 29.233 1.00 22.40 N ATOM 10173 CA ALA D 283 2.493 -21.774 28.392 1.00 24.62 C ATOM 10174 C ALA D 283 3.307 -21.841 27.092 1.00 23.92 C ATOM 10175 O ALA D 283 2.818 -21.505 26.027 1.00 20.34 O ATOM 10176 CB ALA D 283 2.848 -20.486 29.206 1.00 22.03 C ATOM 10177 N GLN D 284 4.570 -22.243 27.167 1.00 24.81 N ATOM 10178 CA GLN D 284 5.381 -22.279 25.975 1.00 22.01 C ATOM 10179 C GLN D 284 4.851 -23.272 24.926 1.00 25.06 C ATOM 10180 O GLN D 284 4.898 -22.989 23.734 1.00 21.49 O ATOM 10181 CB GLN D 284 6.822 -22.637 26.310 1.00 23.63 C ATOM 10182 CG GLN D 284 7.753 -22.618 25.107 1.00 27.08 C ATOM 10183 CD GLN D 284 7.993 -21.226 24.544 1.00 33.89 C ATOM 10184 OE1 GLN D 284 8.656 -20.412 25.172 1.00 34.80 O ATOM 10185 NE2 GLN D 284 7.497 -20.965 23.329 1.00 25.41 N ATOM 10186 N THR D 285 4.377 -24.434 25.379 1.00 24.61 N ATOM 10187 CA THR D 285 3.982 -25.484 24.467 1.00 25.17 C ATOM 10188 C THR D 285 2.599 -25.137 23.879 1.00 21.79 C ATOM 10189 O THR D 285 2.328 -25.429 22.710 1.00 24.06 O ATOM 10190 CB THR D 285 4.048 -26.901 25.123 1.00 28.20 C ATOM 10191 OG1 THR D 285 4.041 -27.908 24.103 1.00 32.43 O ATOM 10192 CG2 THR D 285 2.926 -27.142 26.088 1.00 19.66 C ATOM 10193 N ALA D 286 1.774 -24.464 24.677 1.00 22.84 N ATOM 10194 CA ALA D 286 0.482 -23.945 24.188 1.00 21.83 C ATOM 10195 C ALA D 286 0.675 -22.866 23.095 1.00 24.05 C ATOM 10196 O ALA D 286 -0.025 -22.871 22.084 1.00 22.85 O ATOM 10197 CB ALA D 286 -0.339 -23.433 25.327 1.00 20.66 C ATOM 10198 N LEU D 287 1.637 -21.968 23.304 1.00 26.66 N ATOM 10199 CA LEU D 287 2.018 -20.955 22.323 1.00 26.09 C ATOM 10200 C LEU D 287 2.650 -21.599 21.063 1.00 22.69 C ATOM 10201 O LEU D 287 2.337 -21.197 19.935 1.00 22.61 O ATOM 10202 CB LEU D 287 2.973 -19.901 22.959 1.00 22.79 C ATOM 10203 CG LEU D 287 3.499 -18.756 22.076 1.00 25.75 C ATOM 10204 CD1 LEU D 287 2.318 -17.891 21.507 1.00 20.15 C ATOM 10205 CD2 LEU D 287 4.554 -17.861 22.814 1.00 24.83 C ATOM 10206 N ASP D 288 3.528 -22.591 21.243 1.00 26.87 N ATOM 10207 CA ASP D 288 4.089 -23.331 20.107 1.00 25.81 C ATOM 10208 C ASP D 288 2.967 -23.955 19.258 1.00 24.42 C ATOM 10209 O ASP D 288 2.950 -23.866 18.024 1.00 26.41 O ATOM 10210 CB ASP D 288 5.010 -24.462 20.573 1.00 27.47 C ATOM 10211 CG ASP D 288 6.293 -23.975 21.223 1.00 28.08 C ATOM 10212 OD1 ASP D 288 6.702 -22.806 21.040 1.00 31.61 O ATOM 10213 OD2 ASP D 288 6.896 -24.793 21.945 1.00 34.38 O ATOM 10214 N CYS D 289 2.024 -24.573 19.942 1.00 27.39 N ATOM 10215 CA CYS D 289 0.852 -25.138 19.316 1.00 24.70 C ATOM 10216 C CYS D 289 0.025 -24.103 18.468 1.00 28.52 C ATOM 10217 O CYS D 289 -0.363 -24.384 17.316 1.00 26.25 O ATOM 10218 CB CYS D 289 -0.001 -25.750 20.427 1.00 24.90 C ATOM 10219 SG CYS D 289 -1.579 -26.456 19.910 1.00 32.78 S ATOM 10220 N ALA D 290 -0.262 -22.942 19.058 1.00 27.46 N ATOM 10221 CA ALA D 290 -1.088 -21.900 18.414 1.00 25.67 C ATOM 10222 C ALA D 290 -0.388 -21.320 17.170 1.00 24.24 C ATOM 10223 O ALA D 290 -0.995 -21.118 16.120 1.00 23.61 O ATOM 10224 CB ALA D 290 -1.428 -20.770 19.434 1.00 22.22 C ATOM 10225 N VAL D 291 0.916 -21.102 17.284 1.00 23.81 N ATOM 10226 CA VAL D 291 1.680 -20.541 16.204 1.00 26.60 C ATOM 10227 C VAL D 291 1.788 -21.496 15.001 1.00 26.76 C ATOM 10228 O VAL D 291 1.652 -21.070 13.848 1.00 27.81 O ATOM 10229 CB VAL D 291 3.093 -20.139 16.669 1.00 18.73 C ATOM 10230 CG1 VAL D 291 3.948 -19.705 15.465 1.00 29.01 C ATOM 10231 CG2 VAL D 291 3.040 -19.012 17.726 1.00 20.57 C ATOM 10232 N ASN D 292 2.045 -22.777 15.266 1.00 28.44 N ATOM 10233 CA ASN D 292 2.213 -23.741 14.188 1.00 28.25 C ATOM 10234 C ASN D 292 0.891 -23.946 13.481 1.00 28.81 C ATOM 10235 O ASN D 292 0.843 -24.047 12.240 1.00 28.38 O ATOM 10236 CB ASN D 292 2.774 -25.066 14.722 1.00 29.85 C ATOM 10237 CG ASN D 292 4.243 -24.948 15.124 1.00 50.51 C ATOM 10238 OD1 ASN D 292 5.028 -24.242 14.466 1.00 52.72 O ATOM 10239 ND2 ASN D 292 4.620 -25.628 16.209 1.00 58.58 N ATOM 10240 N TYR D 293 -0.179 -23.953 14.266 1.00 22.84 N ATOM 10241 CA TYR D 293 -1.510 -24.095 13.697 1.00 24.32 C ATOM 10242 C TYR D 293 -1.897 -22.880 12.834 1.00 23.98 C ATOM 10243 O TYR D 293 -2.349 -23.045 11.713 1.00 22.83 O ATOM 10244 CB TYR D 293 -2.553 -24.307 14.795 1.00 20.95 C ATOM 10245 CG TYR D 293 -3.907 -24.650 14.236 1.00 22.84 C ATOM 10246 CD1 TYR D 293 -4.192 -25.950 13.844 1.00 29.69 C ATOM 10247 CD2 TYR D 293 -4.901 -23.678 14.077 1.00 22.00 C ATOM 10248 CE1 TYR D 293 -5.434 -26.287 13.315 1.00 26.95 C ATOM 10249 CE2 TYR D 293 -6.147 -24.008 13.536 1.00 27.09 C ATOM 10250 CZ TYR D 293 -6.403 -25.318 13.157 1.00 31.54 C ATOM 10251 OH TYR D 293 -7.623 -25.680 12.620 1.00 23.48 O ATOM 10252 N ALA D 294 -1.720 -21.673 13.374 1.00 25.75 N ATOM 10253 CA ALA D 294 -2.109 -20.436 12.688 1.00 25.43 C ATOM 10254 C ALA D 294 -1.302 -20.176 11.412 1.00 25.68 C ATOM 10255 O ALA D 294 -1.811 -19.559 10.474 1.00 24.06 O ATOM 10256 CB ALA D 294 -2.043 -19.209 13.642 1.00 20.27 C ATOM 10257 N GLU D 295 -0.060 -20.663 11.366 1.00 25.97 N ATOM 10258 CA GLU D 295 0.758 -20.545 10.162 1.00 27.63 C ATOM 10259 C GLU D 295 0.229 -21.419 9.015 1.00 31.36 C ATOM 10260 O GLU D 295 0.500 -21.154 7.841 1.00 27.70 O ATOM 10261 CB GLU D 295 2.217 -20.918 10.461 1.00 29.31 C ATOM 10262 CG GLU D 295 2.994 -19.877 11.276 1.00 33.72 C ATOM 10263 CD GLU D 295 3.475 -18.703 10.440 1.00 49.95 C ATOM 10264 OE1 GLU D 295 2.626 -17.926 9.942 1.00 42.49 O ATOM 10265 OE2 GLU D 295 4.706 -18.544 10.303 1.00 52.74 O ATOM 10266 N ASN D 296 -0.522 -22.458 9.364 1.00 30.46 N ATOM 10267 CA ASN D 296 -0.923 -23.476 8.399 1.00 31.42 C ATOM 10268 C ASN D 296 -2.413 -23.499 8.119 1.00 27.28 C ATOM 10269 O ASN D 296 -2.828 -24.023 7.101 1.00 35.33 O ATOM 10270 CB ASN D 296 -0.440 -24.837 8.872 1.00 29.96 C ATOM 10271 CG ASN D 296 1.059 -24.979 8.725 1.00 33.03 C ATOM 10272 OD1 ASN D 296 1.548 -25.177 7.623 1.00 35.55 O ATOM 10273 ND2 ASN D 296 1.796 -24.829 9.823 1.00 36.00 N ATOM 10274 N ARG D 297 -3.203 -22.917 9.006 1.00 25.95 N ATOM 10275 CA ARG D 297 -4.662 -22.825 8.819 1.00 24.46 C ATOM 10276 C ARG D 297 -5.002 -21.621 7.934 1.00 29.05 C ATOM 10277 O ARG D 297 -4.546 -20.499 8.185 1.00 25.84 O ATOM 10278 CB ARG D 297 -5.348 -22.729 10.186 1.00 25.78 C ATOM 10279 CG ARG D 297 -6.887 -22.590 10.178 1.00 18.61 C ATOM 10280 CD ARG D 297 -7.581 -23.757 9.523 1.00 25.64 C ATOM 10281 NE ARG D 297 -9.027 -23.652 9.690 1.00 23.04 N ATOM 10282 CZ ARG D 297 -9.912 -24.604 9.382 1.00 26.33 C ATOM 10283 NH1 ARG D 297 -9.535 -25.747 8.840 1.00 28.29 N ATOM 10284 NH2 ARG D 297 -11.191 -24.393 9.608 1.00 25.05 N