>>2VWK:HELIX   10  10 GLY A  304  GLY A  338  1                                  35    
GLERVARYSMEDAKVTYELGKEFFPMEAQLSRLVG
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 10 10 GLY A 304 GLY A 338 1 35 ATOM 2367 N GLY A 304 17.393 -21.687 -4.426 1.00 59.42 N ATOM 2368 CA GLY A 304 17.304 -20.300 -3.986 1.00 58.67 C ATOM 2369 C GLY A 304 17.550 -20.152 -2.495 1.00 58.10 C ATOM 2370 O GLY A 304 17.222 -19.116 -1.909 1.00 58.13 O ATOM 2371 N LEU A 305 18.135 -21.186 -1.886 1.00 57.36 N ATOM 2372 CA LEU A 305 18.435 -21.190 -0.450 1.00 56.65 C ATOM 2373 C LEU A 305 19.489 -20.166 -0.041 1.00 56.03 C ATOM 2374 O LEU A 305 19.312 -19.462 0.949 1.00 55.88 O ATOM 2375 CB LEU A 305 18.861 -22.584 0.024 1.00 56.72 C ATOM 2376 CG LEU A 305 17.791 -23.559 0.512 1.00 56.65 C ATOM 2377 CD1 LEU A 305 18.440 -24.891 0.854 1.00 57.10 C ATOM 2378 CD2 LEU A 305 17.055 -23.007 1.716 1.00 56.41 C ATOM 2379 N GLU A 306 20.577 -20.087 -0.805 1.00 55.46 N ATOM 2380 CA GLU A 306 21.657 -19.131 -0.532 1.00 54.89 C ATOM 2381 C GLU A 306 21.200 -17.673 -0.651 1.00 54.27 C ATOM 2382 O GLU A 306 21.721 -16.799 0.042 1.00 54.20 O ATOM 2383 CB GLU A 306 22.858 -19.384 -1.450 1.00 54.96 C ATOM 2384 CG GLU A 306 23.374 -20.821 -1.435 1.00 55.62 C ATOM 2385 CD GLU A 306 24.843 -20.932 -1.834 1.00 56.42 C ATOM 2386 OE1 GLU A 306 25.327 -20.084 -2.620 1.00 56.43 O ATOM 2387 OE2 GLU A 306 25.515 -21.874 -1.355 1.00 56.19 O ATOM 2388 N ARG A 307 20.231 -17.424 -1.531 1.00 53.57 N ATOM 2389 CA ARG A 307 19.629 -16.097 -1.690 1.00 52.88 C ATOM 2390 C ARG A 307 18.750 -15.716 -0.493 1.00 52.24 C ATOM 2391 O ARG A 307 18.666 -14.541 -0.132 1.00 52.01 O ATOM 2392 CB ARG A 307 18.826 -16.011 -2.996 1.00 52.98 C ATOM 2393 N VAL A 308 18.100 -16.711 0.111 1.00 51.59 N ATOM 2394 CA VAL A 308 17.300 -16.502 1.330 1.00 50.96 C ATOM 2395 C VAL A 308 18.197 -16.174 2.531 1.00 50.53 C ATOM 2396 O VAL A 308 17.889 -15.276 3.315 1.00 50.38 O ATOM 2397 CB VAL A 308 16.400 -17.719 1.649 1.00 50.84 C ATOM 2398 CG1 VAL A 308 15.556 -17.456 2.883 1.00 50.58 C ATOM 2399 CG2 VAL A 308 15.505 -18.036 0.469 1.00 50.69 C ATOM 2400 N ALA A 309 19.309 -16.897 2.650 1.00 50.19 N ATOM 2401 CA ALA A 309 20.303 -16.656 3.702 1.00 49.86 C ATOM 2402 C ALA A 309 20.968 -15.282 3.593 1.00 49.60 C ATOM 2403 O ALA A 309 21.324 -14.692 4.609 1.00 49.40 O ATOM 2404 CB ALA A 309 21.352 -17.763 3.714 1.00 49.83 C ATOM 2405 N ARG A 310 21.136 -14.784 2.368 1.00 49.47 N ATOM 2406 CA ARG A 310 21.626 -13.420 2.148 1.00 49.48 C ATOM 2407 C ARG A 310 20.572 -12.417 2.611 1.00 49.45 C ATOM 2408 O ARG A 310 20.889 -11.425 3.276 1.00 49.25 O ATOM 2409 CB ARG A 310 21.974 -13.182 0.672 1.00 49.42 C ATOM 2410 N TYR A 311 19.320 -12.702 2.254 1.00 49.36 N ATOM 2411 CA TYR A 311 18.178 -11.874 2.613 1.00 49.24 C ATOM 2412 C TYR A 311 18.019 -11.825 4.118 1.00 48.55 C ATOM 2413 O TYR A 311 17.887 -10.746 4.694 1.00 48.30 O ATOM 2414 CB TYR A 311 16.913 -12.428 1.962 1.00 49.84 C ATOM 2415 CG TYR A 311 15.611 -11.826 2.455 1.00 51.33 C ATOM 2416 CD1 TYR A 311 15.122 -10.628 1.922 1.00 52.12 C ATOM 2417 CD2 TYR A 311 14.847 -12.475 3.434 1.00 53.20 C ATOM 2418 CE1 TYR A 311 13.913 -10.085 2.359 1.00 52.83 C ATOM 2419 CE2 TYR A 311 13.634 -11.939 3.879 1.00 53.36 C ATOM 2420 CZ TYR A 311 13.176 -10.747 3.337 1.00 53.33 C ATOM 2421 OH TYR A 311 11.983 -10.219 3.778 1.00 52.89 O ATOM 2422 N SER A 312 18.042 -13.001 4.744 1.00 47.95 N ATOM 2423 CA SER A 312 17.907 -13.118 6.191 1.00 47.25 C ATOM 2424 C SER A 312 19.015 -12.338 6.891 1.00 46.80 C ATOM 2425 O SER A 312 18.753 -11.574 7.816 1.00 46.45 O ATOM 2426 CB SER A 312 17.925 -14.583 6.610 1.00 47.10 C ATOM 2427 OG SER A 312 17.305 -14.752 7.868 1.00 47.26 O ATOM 2428 N MET A 313 20.246 -12.523 6.418 1.00 46.63 N ATOM 2429 CA MET A 313 21.398 -11.755 6.879 1.00 46.35 C ATOM 2430 C MET A 313 21.129 -10.261 6.764 1.00 46.01 C ATOM 2431 O MET A 313 21.343 -9.519 7.721 1.00 46.07 O ATOM 2432 CB MET A 313 22.642 -12.119 6.072 1.00 46.40 C ATOM 2433 CG MET A 313 23.944 -11.705 6.723 1.00 47.22 C ATOM 2434 SD MET A 313 25.084 -10.933 5.552 1.00 49.49 S ATOM 2435 CE MET A 313 24.492 -9.238 5.540 1.00 47.87 C ATOM 2436 N GLU A 314 20.643 -9.833 5.599 1.00 45.72 N ATOM 2437 CA GLU A 314 20.346 -8.418 5.343 1.00 45.64 C ATOM 2438 C GLU A 314 19.231 -7.835 6.229 1.00 45.19 C ATOM 2439 O GLU A 314 19.334 -6.679 6.646 1.00 45.24 O ATOM 2440 CB GLU A 314 20.069 -8.160 3.853 1.00 45.78 C ATOM 2441 CG GLU A 314 21.328 -8.143 2.959 1.00 47.48 C ATOM 2442 CD GLU A 314 22.211 -6.897 3.146 1.00 50.56 C ATOM 2443 OE1 GLU A 314 23.455 -7.051 3.216 1.00 51.22 O ATOM 2444 OE2 GLU A 314 21.670 -5.765 3.216 1.00 51.37 O ATOM 2445 N ASP A 315 18.184 -8.619 6.521 1.00 44.44 N ATOM 2446 CA ASP A 315 17.192 -8.245 7.547 1.00 43.68 C ATOM 2447 C ASP A 315 17.885 -7.789 8.823 1.00 43.09 C ATOM 2448 O ASP A 315 17.605 -6.709 9.336 1.00 42.84 O ATOM 2449 CB ASP A 315 16.278 -9.414 7.912 1.00 43.84 C ATOM 2450 CG ASP A 315 15.228 -9.700 6.863 1.00 44.52 C ATOM 2451 OD1 ASP A 315 14.935 -8.811 6.030 1.00 45.76 O ATOM 2452 OD2 ASP A 315 14.689 -10.829 6.882 1.00 44.68 O ATOM 2453 N ALA A 316 18.798 -8.622 9.318 1.00 42.43 N ATOM 2454 CA ALA A 316 19.519 -8.336 10.548 1.00 42.05 C ATOM 2455 C ALA A 316 20.353 -7.064 10.440 1.00 41.91 C ATOM 2456 O ALA A 316 20.198 -6.157 11.255 1.00 41.87 O ATOM 2457 CB ALA A 316 20.379 -9.514 10.942 1.00 41.79 C ATOM 2458 N LYS A 317 21.221 -7.000 9.431 1.00 41.76 N ATOM 2459 CA LYS A 317 22.134 -5.865 9.242 1.00 41.54 C ATOM 2460 C LYS A 317 21.373 -4.540 9.167 1.00 41.18 C ATOM 2461 O LYS A 317 21.724 -3.582 9.850 1.00 41.21 O ATOM 2462 CB LYS A 317 22.990 -6.074 7.985 1.00 41.59 C ATOM 2463 CG LYS A 317 24.195 -5.162 7.879 1.00 41.70 C ATOM 2464 N VAL A 318 20.327 -4.512 8.344 1.00 40.63 N ATOM 2465 CA VAL A 318 19.430 -3.367 8.221 1.00 40.23 C ATOM 2466 C VAL A 318 18.779 -3.012 9.563 1.00 40.10 C ATOM 2467 O VAL A 318 18.811 -1.850 9.986 1.00 40.37 O ATOM 2468 CB VAL A 318 18.362 -3.635 7.123 1.00 40.36 C ATOM 2469 CG1 VAL A 318 17.155 -2.717 7.254 1.00 40.33 C ATOM 2470 CG2 VAL A 318 18.989 -3.515 5.733 1.00 39.99 C ATOM 2471 N THR A 319 18.207 -4.015 10.230 1.00 39.83 N ATOM 2472 CA THR A 319 17.576 -3.840 11.543 1.00 39.43 C ATOM 2473 C THR A 319 18.543 -3.208 12.536 1.00 39.34 C ATOM 2474 O THR A 319 18.177 -2.278 13.249 1.00 39.33 O ATOM 2475 CB THR A 319 16.997 -5.178 12.090 1.00 39.39 C ATOM 2476 OG1 THR A 319 15.939 -5.627 11.232 1.00 39.13 O ATOM 2477 CG2 THR A 319 16.437 -5.014 13.490 1.00 39.10 C ATOM 2478 N TYR A 320 19.779 -3.697 12.554 1.00 39.37 N ATOM 2479 CA TYR A 320 20.847 -3.112 13.370 1.00 39.52 C ATOM 2480 C TYR A 320 21.128 -1.649 13.022 1.00 39.70 C ATOM 2481 O TYR A 320 21.179 -0.782 13.900 1.00 39.46 O ATOM 2482 CB TYR A 320 22.140 -3.921 13.230 1.00 39.46 C ATOM 2483 CG TYR A 320 23.223 -3.454 14.171 1.00 39.54 C ATOM 2484 CD1 TYR A 320 23.096 -3.649 15.545 1.00 39.39 C ATOM 2485 CD2 TYR A 320 24.367 -2.804 13.695 1.00 39.79 C ATOM 2486 CE1 TYR A 320 24.069 -3.221 16.427 1.00 39.77 C ATOM 2487 CE2 TYR A 320 25.360 -2.365 14.575 1.00 40.11 C ATOM 2488 CZ TYR A 320 25.194 -2.583 15.945 1.00 40.58 C ATOM 2489 OH TYR A 320 26.140 -2.174 16.851 1.00 40.82 O ATOM 2490 N GLU A 321 21.316 -1.392 11.732 1.00 40.01 N ATOM 2491 CA GLU A 321 21.655 -0.067 11.246 1.00 40.31 C ATOM 2492 C GLU A 321 20.510 0.902 11.487 1.00 40.01 C ATOM 2493 O GLU A 321 20.748 2.023 11.939 1.00 40.16 O ATOM 2494 CB GLU A 321 22.068 -0.118 9.770 1.00 40.70 C ATOM 2495 CG GLU A 321 23.329 -0.967 9.535 1.00 42.27 C ATOM 2496 CD GLU A 321 23.718 -1.089 8.073 1.00 44.79 C ATOM 2497 OE1 GLU A 321 22.813 -1.166 7.205 1.00 44.97 O ATOM 2498 OE2 GLU A 321 24.942 -1.118 7.797 1.00 45.57 O ATOM 2499 N LEU A 322 19.275 0.463 11.225 1.00 39.66 N ATOM 2500 CA LEU A 322 18.093 1.262 11.582 1.00 39.39 C ATOM 2501 C LEU A 322 18.072 1.565 13.082 1.00 39.24 C ATOM 2502 O LEU A 322 17.756 2.678 13.488 1.00 39.35 O ATOM 2503 CB LEU A 322 16.788 0.579 11.157 1.00 39.32 C ATOM 2504 CG LEU A 322 16.372 0.623 9.680 1.00 39.59 C ATOM 2505 CD1 LEU A 322 15.115 -0.205 9.440 1.00 38.84 C ATOM 2506 CD2 LEU A 322 16.165 2.050 9.183 1.00 39.65 C ATOM 2507 N GLY A 323 18.431 0.574 13.893 1.00 39.09 N ATOM 2508 CA GLY A 323 18.516 0.738 15.338 1.00 39.03 C ATOM 2509 C GLY A 323 19.566 1.736 15.795 1.00 39.14 C ATOM 2510 O GLY A 323 19.364 2.437 16.785 1.00 38.86 O ATOM 2511 N LYS A 324 20.689 1.798 15.078 1.00 39.35 N ATOM 2512 CA LYS A 324 21.748 2.766 15.382 1.00 39.53 C ATOM 2513 C LYS A 324 21.304 4.195 15.055 1.00 39.55 C ATOM 2514 O LYS A 324 21.811 5.156 15.637 1.00 39.43 O ATOM 2515 CB LYS A 324 23.050 2.421 14.642 1.00 39.63 C ATOM 2516 CG LYS A 324 23.841 1.274 15.262 1.00 39.46 C ATOM 2517 N GLU A 325 20.357 4.322 14.127 1.00 39.46 N ATOM 2518 CA GLU A 325 19.780 5.613 13.781 1.00 39.72 C ATOM 2519 C GLU A 325 18.798 6.128 14.830 1.00 39.51 C ATOM 2520 O GLU A 325 18.933 7.263 15.302 1.00 39.73 O ATOM 2521 CB GLU A 325 19.090 5.555 12.414 1.00 39.94 C ATOM 2522 CG GLU A 325 19.996 5.909 11.243 1.00 41.53 C ATOM 2523 CD GLU A 325 20.494 7.351 11.288 1.00 43.29 C ATOM 2524 OE1 GLU A 325 19.670 8.280 11.088 1.00 43.67 O ATOM 2525 OE2 GLU A 325 21.713 7.546 11.514 1.00 43.27 O ATOM 2526 N PHE A 326 17.820 5.295 15.191 1.00 38.99 N ATOM 2527 CA PHE A 326 16.696 5.721 16.032 1.00 38.50 C ATOM 2528 C PHE A 326 16.946 5.695 17.528 1.00 37.95 C ATOM 2529 O PHE A 326 16.238 6.364 18.275 1.00 38.33 O ATOM 2530 CB PHE A 326 15.444 4.908 15.715 1.00 38.73 C ATOM 2531 CG PHE A 326 14.880 5.199 14.372 1.00 39.44 C ATOM 2532 CD1 PHE A 326 13.989 6.251 14.199 1.00 39.94 C ATOM 2533 CD2 PHE A 326 15.257 4.444 13.269 1.00 40.32 C ATOM 2534 CE1 PHE A 326 13.473 6.545 12.953 1.00 40.36 C ATOM 2535 CE2 PHE A 326 14.747 4.730 12.012 1.00 41.23 C ATOM 2536 CZ PHE A 326 13.847 5.787 11.858 1.00 40.98 C ATOM 2537 N PHE A 327 17.940 4.932 17.967 1.00 37.17 N ATOM 2538 CA PHE A 327 18.191 4.788 19.395 1.00 36.47 C ATOM 2539 C PHE A 327 18.504 6.113 20.108 1.00 36.19 C ATOM 2540 O PHE A 327 17.812 6.449 21.076 1.00 36.17 O ATOM 2541 CB PHE A 327 19.262 3.724 19.687 1.00 36.23 C ATOM 2542 CG PHE A 327 19.359 3.348 21.141 1.00 35.76 C ATOM 2543 CD1 PHE A 327 18.512 2.383 21.680 1.00 35.47 C ATOM 2544 CD2 PHE A 327 20.284 3.971 21.977 1.00 35.23 C ATOM 2545 CE1 PHE A 327 18.586 2.040 23.024 1.00 35.08 C ATOM 2546 CE2 PHE A 327 20.371 3.636 23.318 1.00 34.60 C ATOM 2547 CZ PHE A 327 19.523 2.665 23.845 1.00 35.07 C ATOM 2548 N PRO A 328 19.514 6.881 19.627 1.00 35.76 N ATOM 2549 CA PRO A 328 19.912 8.094 20.351 1.00 35.34 C ATOM 2550 C PRO A 328 18.754 9.070 20.505 1.00 34.87 C ATOM 2551 O PRO A 328 18.620 9.691 21.554 1.00 34.86 O ATOM 2552 CB PRO A 328 20.993 8.709 19.452 1.00 35.08 C ATOM 2553 CG PRO A 328 21.507 7.587 18.665 1.00 35.53 C ATOM 2554 CD PRO A 328 20.316 6.716 18.401 1.00 35.86 C ATOM 2555 N MET A 329 17.930 9.183 19.465 1.00 34.44 N ATOM 2556 CA MET A 329 16.725 10.004 19.499 1.00 34.30 C ATOM 2557 C MET A 329 15.799 9.558 20.611 1.00 33.38 C ATOM 2558 O MET A 329 15.323 10.374 21.401 1.00 33.53 O ATOM 2559 CB MET A 329 15.986 9.919 18.167 1.00 34.87 C ATOM 2560 CG MET A 329 14.881 10.945 17.981 1.00 37.34 C ATOM 2561 SD MET A 329 15.513 12.639 17.965 1.00 42.96 S ATOM 2562 CE MET A 329 15.152 13.135 19.640 1.00 41.62 C ATOM 2563 N GLU A 330 15.559 8.252 20.671 1.00 32.28 N ATOM 2564 CA GLU A 330 14.663 7.675 21.658 1.00 30.96 C ATOM 2565 C GLU A 330 15.267 7.731 23.061 1.00 29.86 C ATOM 2566 O GLU A 330 14.542 7.776 24.053 1.00 29.38 O ATOM 2567 CB GLU A 330 14.309 6.250 21.258 1.00 30.92 C ATOM 2568 CG GLU A 330 12.923 5.831 21.691 1.00 32.80 C ATOM 2569 CD GLU A 330 11.801 6.652 21.043 1.00 33.86 C ATOM 2570 OE1 GLU A 330 11.772 6.787 19.801 1.00 33.76 O ATOM 2571 OE2 GLU A 330 10.942 7.161 21.790 1.00 34.62 O ATOM 2572 N ALA A 331 16.599 7.740 23.127 1.00 28.84 N ATOM 2573 CA ALA A 331 17.329 7.942 24.380 1.00 28.00 C ATOM 2574 C ALA A 331 17.190 9.379 24.899 1.00 27.47 C ATOM 2575 O ALA A 331 17.140 9.601 26.109 1.00 27.24 O ATOM 2576 CB ALA A 331 18.801 7.572 24.214 1.00 28.12 C ATOM 2577 N GLN A 332 17.123 10.342 23.979 1.00 26.60 N ATOM 2578 CA GLN A 332 16.843 11.733 24.334 1.00 25.99 C ATOM 2579 C GLN A 332 15.428 11.934 24.890 1.00 25.63 C ATOM 2580 O GLN A 332 15.279 12.568 25.938 1.00 25.71 O ATOM 2581 CB GLN A 332 17.104 12.687 23.154 1.00 26.04 C ATOM 2582 CG GLN A 332 18.583 12.898 22.812 1.00 25.10 C ATOM 2583 CD GLN A 332 19.407 13.259 24.014 1.00 24.68 C ATOM 2584 OE1 GLN A 332 19.369 14.393 24.485 1.00 24.19 O ATOM 2585 NE2 GLN A 332 20.154 12.284 24.536 1.00 25.94 N ATOM 2586 N LEU A 333 14.408 11.399 24.208 1.00 24.77 N ATOM 2587 CA LEU A 333 13.022 11.480 24.699 1.00 24.51 C ATOM 2588 C LEU A 333 12.875 10.820 26.066 1.00 24.62 C ATOM 2589 O LEU A 333 12.189 11.333 26.951 1.00 24.69 O ATOM 2590 CB LEU A 333 12.026 10.837 23.726 1.00 24.03 C ATOM 2591 CG LEU A 333 11.622 11.587 22.459 1.00 23.32 C ATOM 2592 CD1 LEU A 333 10.775 10.683 21.582 1.00 21.80 C ATOM 2593 CD2 LEU A 333 10.891 12.907 22.774 1.00 20.83 C ATOM 2594 N SER A 334 13.532 9.685 26.247 1.00 24.43 N ATOM 2595 CA SER A 334 13.418 8.993 27.503 1.00 24.60 C ATOM 2596 C SER A 334 14.135 9.811 28.585 1.00 24.48 C ATOM 2597 O SER A 334 13.691 9.855 29.735 1.00 24.62 O ATOM 2598 CB SER A 334 13.921 7.548 27.377 1.00 24.49 C ATOM 2599 OG SER A 334 15.229 7.393 27.905 1.00 26.22 O ATOM 2600 N ARG A 335 15.213 10.493 28.195 1.00 24.45 N ATOM 2601 CA ARG A 335 15.922 11.426 29.085 1.00 24.39 C ATOM 2602 C ARG A 335 15.074 12.670 29.387 1.00 23.32 C ATOM 2603 O ARG A 335 15.102 13.206 30.487 1.00 22.76 O ATOM 2604 CB ARG A 335 17.297 11.822 28.494 1.00 24.92 C ATOM 2605 CG ARG A 335 18.226 12.561 29.470 1.00 27.22 C ATOM 2606 CD ARG A 335 19.552 12.998 28.832 1.00 32.25 C ATOM 2607 NE ARG A 335 20.054 14.256 29.417 1.00 35.27 N ATOM 2608 CZ ARG A 335 19.955 15.454 28.838 1.00 36.63 C ATOM 2609 NH1 ARG A 335 19.386 15.576 27.645 1.00 38.32 N ATOM 2610 NH2 ARG A 335 20.425 16.536 29.446 1.00 37.26 N ATOM 2611 N LEU A 336 14.311 13.121 28.406 1.00 22.76 N ATOM 2612 CA LEU A 336 13.537 14.342 28.570 1.00 22.44 C ATOM 2613 C LEU A 336 12.250 14.102 29.355 1.00 22.00 C ATOM 2614 O LEU A 336 11.828 14.958 30.144 1.00 22.19 O ATOM 2615 CB LEU A 336 13.257 14.969 27.201 1.00 22.62 C ATOM 2616 CG LEU A 336 12.336 16.179 27.096 1.00 23.20 C ATOM 2617 CD1 LEU A 336 12.957 17.393 27.779 1.00 24.71 C ATOM 2618 CD2 LEU A 336 12.055 16.464 25.645 1.00 22.19 C ATOM 2619 N VAL A 337 11.646 12.934 29.145 1.00 21.38 N ATOM 2620 CA VAL A 337 10.388 12.556 29.801 1.00 20.71 C ATOM 2621 C VAL A 337 10.588 11.999 31.220 1.00 20.40 C ATOM 2622 O VAL A 337 9.666 12.057 32.039 1.00 20.43 O ATOM 2623 CB VAL A 337 9.590 11.544 28.940 1.00 20.70 C ATOM 2624 CG1 VAL A 337 8.494 10.900 29.732 1.00 19.93 C ATOM 2625 CG2 VAL A 337 9.004 12.229 27.701 1.00 21.17 C ATOM 2626 N GLY A 338 11.774 11.455 31.506 1.00 19.46 N ATOM 2627 CA GLY A 338 12.050 10.860 32.819 1.00 18.36 C ATOM 2628 C GLY A 338 11.588 9.422 33.006 1.00 17.95 C ATOM 2629 O GLY A 338 11.411 8.954 34.134 1.00 17.43 O