>>2XY7:HELIX   28  28 ASN A  780  GLU A  818  1                                  39    
NFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 28 28 ASN A 780 GLU A 818 1 39 ATOM 3718 N ASN A 780 7.624 31.404 6.210 1.00 37.01 N ATOM 3719 CA ASN A 780 8.847 30.767 5.741 1.00 37.17 C ATOM 3720 C ASN A 780 8.586 29.299 5.391 1.00 37.02 C ATOM 3721 O ASN A 780 8.114 28.528 6.229 1.00 37.05 O ATOM 3722 CB ASN A 780 9.958 30.860 6.780 1.00 37.24 C ATOM 3723 CG ASN A 780 11.203 30.115 6.346 1.00 37.78 C ATOM 3724 OD1 ASN A 780 11.688 29.234 7.050 1.00 39.17 O ATOM 3725 ND2 ASN A 780 11.703 30.437 5.158 1.00 38.33 N ATOM 3726 N PHE A 781 8.896 28.920 4.157 1.00 36.84 N ATOM 3727 CA PHE A 781 8.558 27.591 3.677 1.00 36.82 C ATOM 3728 C PHE A 781 9.173 26.516 4.547 1.00 36.85 C ATOM 3729 O PHE A 781 8.493 25.574 4.960 1.00 36.91 O ATOM 3730 CB PHE A 781 9.021 27.392 2.241 1.00 36.92 C ATOM 3731 CG PHE A 781 8.850 25.985 1.751 1.00 37.31 C ATOM 3732 CD1 PHE A 781 7.629 25.562 1.244 1.00 37.48 C ATOM 3733 CD2 PHE A 781 9.905 25.077 1.813 1.00 37.59 C ATOM 3734 CE1 PHE A 781 7.460 24.263 0.792 1.00 37.72 C ATOM 3735 CE2 PHE A 781 9.745 23.775 1.363 1.00 37.76 C ATOM 3736 CZ PHE A 781 8.519 23.367 0.850 1.00 37.83 C ATOM 3737 N ASN A 782 10.463 26.667 4.821 1.00 36.88 N ATOM 3738 CA ASN A 782 11.218 25.661 5.572 1.00 36.85 C ATOM 3739 C ASN A 782 10.702 25.500 6.995 1.00 36.59 C ATOM 3740 O ASN A 782 10.432 24.384 7.444 1.00 36.68 O ATOM 3741 CB ASN A 782 12.697 26.029 5.602 1.00 36.95 C ATOM 3742 CG ASN A 782 13.303 26.092 4.216 1.00 37.60 C ATOM 3743 OD1 ASN A 782 13.284 25.108 3.472 1.00 38.37 O ATOM 3744 ND2 ASN A 782 13.838 27.255 3.858 1.00 38.02 N ATOM 3745 N VAL A 783 10.562 26.630 7.684 1.00 36.21 N ATOM 3746 CA VAL A 783 10.024 26.673 9.044 1.00 35.88 C ATOM 3747 C VAL A 783 8.601 26.111 9.111 1.00 35.64 C ATOM 3748 O VAL A 783 8.283 25.332 10.006 1.00 35.52 O ATOM 3749 CB VAL A 783 10.053 28.116 9.615 1.00 35.88 C ATOM 3750 CG1 VAL A 783 9.269 28.203 10.905 1.00 35.95 C ATOM 3751 CG2 VAL A 783 11.487 28.573 9.848 1.00 35.54 C ATOM 3752 N ARG A 784 7.752 26.500 8.167 1.00 35.51 N ATOM 3753 CA ARG A 784 6.383 25.987 8.128 1.00 35.61 C ATOM 3754 C ARG A 784 6.366 24.484 7.884 1.00 35.35 C ATOM 3755 O ARG A 784 5.543 23.766 8.450 1.00 35.23 O ATOM 3756 CB ARG A 784 5.555 26.685 7.047 1.00 35.84 C ATOM 3757 CG ARG A 784 4.154 26.081 6.872 1.00 36.58 C ATOM 3758 CD ARG A 784 3.367 26.653 5.694 1.00 37.58 C ATOM 3759 NE ARG A 784 4.189 26.905 4.509 1.00 37.86 N ATOM 3760 CZ ARG A 784 4.541 28.116 4.071 1.00 38.42 C ATOM 3761 NH1 ARG A 784 4.149 29.220 4.702 1.00 38.33 N ATOM 3762 NH2 ARG A 784 5.288 28.230 2.981 1.00 39.04 N ATOM 3763 N SER A 785 7.274 24.018 7.035 1.00 35.17 N ATOM 3764 CA SER A 785 7.320 22.603 6.669 1.00 35.14 C ATOM 3765 C SER A 785 7.692 21.693 7.837 1.00 35.15 C ATOM 3766 O SER A 785 7.129 20.608 7.975 1.00 34.98 O ATOM 3767 CB SER A 785 8.291 22.382 5.514 1.00 35.11 C ATOM 3768 OG SER A 785 7.774 22.935 4.319 1.00 35.22 O ATOM 3769 N PHE A 786 8.638 22.136 8.665 1.00 35.22 N ATOM 3770 CA PHE A 786 9.097 21.359 9.824 1.00 35.38 C ATOM 3771 C PHE A 786 7.942 21.118 10.789 1.00 35.25 C ATOM 3772 O PHE A 786 7.689 19.991 11.207 1.00 35.03 O ATOM 3773 CB PHE A 786 10.252 22.090 10.529 1.00 35.53 C ATOM 3774 CG PHE A 786 11.009 21.256 11.562 1.00 36.66 C ATOM 3775 CD1 PHE A 786 10.913 19.860 11.613 1.00 37.40 C ATOM 3776 CD2 PHE A 786 11.870 21.887 12.463 1.00 37.47 C ATOM 3777 CE1 PHE A 786 11.633 19.125 12.567 1.00 37.46 C ATOM 3778 CE2 PHE A 786 12.593 21.153 13.412 1.00 37.57 C ATOM 3779 CZ PHE A 786 12.472 19.774 13.461 1.00 37.53 C ATOM 3780 N ALA A 787 7.240 22.194 11.120 1.00 35.34 N ATOM 3781 CA ALA A 787 6.042 22.129 11.958 1.00 35.32 C ATOM 3782 C ALA A 787 4.956 21.269 11.324 1.00 35.27 C ATOM 3783 O ALA A 787 4.260 20.532 12.014 1.00 35.01 O ATOM 3784 CB ALA A 787 5.514 23.527 12.223 1.00 35.36 C ATOM 3785 N GLU A 788 4.812 21.371 10.010 1.00 35.52 N ATOM 3786 CA GLU A 788 3.866 20.526 9.292 1.00 35.92 C ATOM 3787 C GLU A 788 4.165 19.050 9.535 1.00 35.85 C ATOM 3788 O GLU A 788 3.267 18.300 9.886 1.00 35.75 O ATOM 3789 CB GLU A 788 3.845 20.860 7.795 1.00 36.04 C ATOM 3790 CG GLU A 788 2.800 21.922 7.456 1.00 37.64 C ATOM 3791 CD GLU A 788 2.979 22.570 6.075 1.00 39.74 C ATOM 3792 OE1 GLU A 788 3.639 21.962 5.197 1.00 41.02 O ATOM 3793 OE2 GLU A 788 2.439 23.687 5.861 1.00 40.58 O ATOM 3794 N ARG A 789 5.431 18.661 9.378 1.00 35.96 N ATOM 3795 CA ARG A 789 5.879 17.277 9.599 1.00 36.05 C ATOM 3796 C ARG A 789 5.616 16.818 11.029 1.00 35.85 C ATOM 3797 O ARG A 789 5.013 15.767 11.263 1.00 35.82 O ATOM 3798 CB ARG A 789 7.374 17.146 9.302 1.00 36.20 C ATOM 3799 CG ARG A 789 7.715 17.239 7.826 1.00 37.12 C ATOM 3800 CD ARG A 789 9.144 16.761 7.520 1.00 38.35 C ATOM 3801 NE ARG A 789 10.181 17.595 8.130 1.00 38.62 N ATOM 3802 CZ ARG A 789 10.577 18.784 7.675 1.00 39.13 C ATOM 3803 NH1 ARG A 789 10.019 19.329 6.595 1.00 39.34 N ATOM 3804 NH2 ARG A 789 11.528 19.447 8.322 1.00 39.28 N ATOM 3805 N MET A 790 6.089 17.615 11.978 1.00 35.60 N ATOM 3806 CA MET A 790 5.803 17.386 13.388 1.00 35.29 C ATOM 3807 C MET A 790 4.307 17.198 13.600 1.00 34.86 C ATOM 3808 O MET A 790 3.898 16.309 14.331 1.00 34.95 O ATOM 3809 CB MET A 790 6.273 18.559 14.239 1.00 35.35 C ATOM 3810 CG MET A 790 7.756 18.833 14.198 1.00 35.62 C ATOM 3811 SD MET A 790 8.088 20.283 15.215 1.00 36.74 S ATOM 3812 CE MET A 790 9.758 20.716 14.721 1.00 36.17 C ATOM 3813 N ALA A 791 3.492 18.036 12.961 1.00 34.50 N ATOM 3814 CA ALA A 791 2.033 17.929 13.085 1.00 34.09 C ATOM 3815 C ALA A 791 1.631 16.483 12.855 1.00 33.72 C ATOM 3816 O ALA A 791 1.014 15.854 13.702 1.00 33.45 O ATOM 3817 CB ALA A 791 1.336 18.845 12.088 1.00 33.97 C ATOM 3818 N MET A 792 2.058 15.960 11.718 1.00 33.57 N ATOM 3819 CA MET A 792 1.733 14.606 11.285 1.00 33.58 C ATOM 3820 C MET A 792 2.396 13.575 12.204 1.00 33.49 C ATOM 3821 O MET A 792 1.760 12.620 12.661 1.00 33.31 O ATOM 3822 CB MET A 792 2.206 14.388 9.834 1.00 33.59 C ATOM 3823 CG MET A 792 2.093 15.616 8.921 1.00 33.97 C ATOM 3824 SD MET A 792 2.629 15.442 7.204 1.00 34.52 S ATOM 3825 CE MET A 792 3.524 13.891 7.233 1.00 34.09 C ATOM 3826 N ASN A 793 3.678 13.797 12.474 1.00 33.40 N ATOM 3827 CA ASN A 793 4.520 12.841 13.201 1.00 33.34 C ATOM 3828 C ASN A 793 4.173 12.660 14.681 1.00 33.21 C ATOM 3829 O ASN A 793 4.241 11.557 15.209 1.00 33.24 O ATOM 3830 CB ASN A 793 5.990 13.266 13.077 1.00 33.40 C ATOM 3831 CG ASN A 793 6.932 12.380 13.878 1.00 33.42 C ATOM 3832 OD1 ASN A 793 7.347 12.737 14.979 1.00 33.29 O ATOM 3833 ND2 ASN A 793 7.264 11.218 13.333 1.00 33.36 N ATOM 3834 N THR A 794 3.807 13.744 15.347 1.00 33.21 N ATOM 3835 CA THR A 794 3.749 13.757 16.807 1.00 33.10 C ATOM 3836 C THR A 794 2.675 12.847 17.390 1.00 33.10 C ATOM 3837 O THR A 794 2.947 12.139 18.346 1.00 33.25 O ATOM 3838 CB THR A 794 3.623 15.199 17.366 1.00 33.13 C ATOM 3839 OG1 THR A 794 4.862 15.890 17.166 1.00 32.57 O ATOM 3840 CG2 THR A 794 3.307 15.192 18.858 1.00 33.08 C ATOM 3841 N PRO A 795 1.465 12.826 16.810 1.00 33.09 N ATOM 3842 CA PRO A 795 0.475 11.894 17.361 1.00 33.09 C ATOM 3843 C PRO A 795 0.881 10.426 17.279 1.00 33.12 C ATOM 3844 O PRO A 795 0.317 9.611 18.001 1.00 33.16 O ATOM 3845 CB PRO A 795 -0.761 12.134 16.494 1.00 33.02 C ATOM 3846 CG PRO A 795 -0.599 13.494 15.979 1.00 33.11 C ATOM 3847 CD PRO A 795 0.877 13.696 15.784 1.00 33.08 C ATOM 3848 N ILE A 796 1.833 10.098 16.402 1.00 33.08 N ATOM 3849 CA ILE A 796 2.356 8.733 16.286 1.00 32.92 C ATOM 3850 C ILE A 796 3.392 8.469 17.379 1.00 32.85 C ATOM 3851 O ILE A 796 3.209 7.615 18.242 1.00 32.64 O ATOM 3852 CB ILE A 796 3.001 8.489 14.901 1.00 32.69 C ATOM 3853 CG1 ILE A 796 1.971 8.631 13.783 1.00 32.17 C ATOM 3854 CG2 ILE A 796 3.621 7.113 14.844 1.00 32.90 C ATOM 3855 CD1 ILE A 796 2.598 8.890 12.421 1.00 30.97 C ATOM 3856 N GLN A 797 4.475 9.227 17.337 1.00 32.99 N ATOM 3857 CA GLN A 797 5.575 9.056 18.282 1.00 33.18 C ATOM 3858 C GLN A 797 5.109 9.174 19.735 1.00 32.83 C ATOM 3859 O GLN A 797 5.561 8.434 20.609 1.00 32.81 O ATOM 3860 CB GLN A 797 6.661 10.091 17.996 1.00 33.43 C ATOM 3861 CG GLN A 797 8.018 9.736 18.561 1.00 33.96 C ATOM 3862 CD GLN A 797 9.114 10.621 18.018 1.00 34.82 C ATOM 3863 OE1 GLN A 797 10.080 10.907 18.714 1.00 35.22 O ATOM 3864 NE2 GLN A 797 8.966 11.069 16.772 1.00 35.66 N ATOM 3865 N GLY A 798 4.191 10.103 19.972 1.00 32.48 N ATOM 3866 CA GLY A 798 3.655 10.357 21.307 1.00 32.12 C ATOM 3867 C GLY A 798 2.671 9.312 21.775 1.00 31.73 C ATOM 3868 O GLY A 798 2.687 8.927 22.939 1.00 31.50 O ATOM 3869 N SER A 799 1.812 8.853 20.873 1.00 31.57 N ATOM 3870 CA SER A 799 0.851 7.804 21.202 1.00 31.53 C ATOM 3871 C SER A 799 1.557 6.482 21.467 1.00 31.55 C ATOM 3872 O SER A 799 1.150 5.729 22.342 1.00 31.52 O ATOM 3873 CB SER A 799 -0.166 7.617 20.083 1.00 31.55 C ATOM 3874 OG SER A 799 -1.073 8.702 20.033 1.00 31.26 O ATOM 3875 N ALA A 800 2.603 6.196 20.701 1.00 31.61 N ATOM 3876 CA ALA A 800 3.439 5.025 20.965 1.00 31.73 C ATOM 3877 C ALA A 800 4.078 5.156 22.347 1.00 31.84 C ATOM 3878 O ALA A 800 4.249 4.168 23.069 1.00 31.77 O ATOM 3879 CB ALA A 800 4.517 4.875 19.894 1.00 31.70 C ATOM 3880 N ALA A 801 4.439 6.387 22.699 1.00 32.03 N ATOM 3881 CA ALA A 801 4.983 6.690 24.021 1.00 32.17 C ATOM 3882 C ALA A 801 3.929 6.425 25.086 1.00 32.23 C ATOM 3883 O ALA A 801 4.175 5.693 26.041 1.00 32.07 O ATOM 3884 CB ALA A 801 5.459 8.137 24.089 1.00 32.12 C ATOM 3885 N ASP A 802 2.750 7.012 24.897 1.00 32.48 N ATOM 3886 CA ASP A 802 1.603 6.835 25.809 1.00 32.76 C ATOM 3887 C ASP A 802 1.317 5.390 26.201 1.00 32.78 C ATOM 3888 O ASP A 802 1.063 5.091 27.361 1.00 32.92 O ATOM 3889 CB ASP A 802 0.330 7.348 25.153 1.00 32.84 C ATOM 3890 CG ASP A 802 0.263 8.855 25.072 1.00 33.70 C ATOM 3891 OD1 ASP A 802 1.000 9.551 25.813 1.00 34.42 O ATOM 3892 OD2 ASP A 802 -0.554 9.342 24.256 1.00 34.66 O ATOM 3893 N ILE A 803 1.311 4.511 25.207 1.00 32.89 N ATOM 3894 CA ILE A 803 1.014 3.090 25.406 1.00 32.89 C ATOM 3895 C ILE A 803 2.062 2.358 26.236 1.00 33.06 C ATOM 3896 O ILE A 803 1.724 1.637 27.173 1.00 33.02 O ATOM 3897 CB ILE A 803 0.889 2.361 24.060 1.00 32.84 C ATOM 3898 CG1 ILE A 803 -0.489 2.629 23.444 1.00 32.73 C ATOM 3899 CG2 ILE A 803 1.106 0.853 24.248 1.00 32.81 C ATOM 3900 CD1 ILE A 803 -0.448 2.976 21.976 1.00 32.01 C ATOM 3901 N ILE A 804 3.328 2.525 25.878 1.00 33.24 N ATOM 3902 CA ILE A 804 4.393 1.874 26.613 1.00 33.43 C ATOM 3903 C ILE A 804 4.320 2.300 28.082 1.00 33.63 C ATOM 3904 O ILE A 804 4.447 1.464 28.975 1.00 33.72 O ATOM 3905 CB ILE A 804 5.789 2.171 26.005 1.00 33.46 C ATOM 3906 CG1 ILE A 804 6.843 1.224 26.584 1.00 33.44 C ATOM 3907 CG2 ILE A 804 6.207 3.618 26.222 1.00 33.97 C ATOM 3908 CD1 ILE A 804 7.331 0.204 25.603 1.00 33.23 C ATOM 3909 N LYS A 805 4.075 3.589 28.324 1.00 33.82 N ATOM 3910 CA LYS A 805 3.983 4.115 29.689 1.00 33.94 C ATOM 3911 C LYS A 805 2.815 3.486 30.429 1.00 33.81 C ATOM 3912 O LYS A 805 2.949 3.086 31.587 1.00 33.94 O ATOM 3913 CB LYS A 805 3.837 5.638 29.691 1.00 34.03 C ATOM 3914 CG LYS A 805 5.109 6.380 29.295 1.00 34.63 C ATOM 3915 CD LYS A 805 5.025 7.861 29.659 1.00 35.26 C ATOM 3916 CE LYS A 805 5.894 8.722 28.765 1.00 35.57 C ATOM 3917 NZ LYS A 805 5.997 10.136 29.260 1.00 35.59 N ATOM 3918 N LYS A 806 1.674 3.390 29.755 1.00 33.50 N ATOM 3919 CA LYS A 806 0.521 2.733 30.339 1.00 33.23 C ATOM 3920 C LYS A 806 0.849 1.280 30.636 1.00 33.06 C ATOM 3921 O LYS A 806 0.487 0.763 31.691 1.00 33.00 O ATOM 3922 CB LYS A 806 -0.699 2.826 29.429 1.00 33.23 C ATOM 3923 CG LYS A 806 -1.891 2.031 29.962 1.00 33.21 C ATOM 3924 CD LYS A 806 -3.170 2.835 29.951 1.00 33.40 C ATOM 3925 CE LYS A 806 -4.350 2.030 30.475 1.00 33.61 C ATOM 3926 NZ LYS A 806 -4.150 0.554 30.429 1.00 33.58 N ATOM 3927 N ALA A 807 1.539 0.629 29.706 1.00 32.95 N ATOM 3928 CA ALA A 807 1.973 -0.757 29.895 1.00 32.87 C ATOM 3929 C ALA A 807 2.720 -0.908 31.214 1.00 32.84 C ATOM 3930 O ALA A 807 2.390 -1.782 32.017 1.00 32.93 O ATOM 3931 CB ALA A 807 2.857 -1.208 28.745 1.00 32.80 C ATOM 3932 N MET A 808 3.704 -0.032 31.434 1.00 32.66 N ATOM 3933 CA MET A 808 4.555 -0.073 32.636 1.00 32.45 C ATOM 3934 C MET A 808 3.754 -0.003 33.933 1.00 32.44 C ATOM 3935 O MET A 808 4.014 -0.750 34.868 1.00 32.15 O ATOM 3936 CB MET A 808 5.565 1.066 32.623 1.00 32.38 C ATOM 3937 CG MET A 808 6.436 1.111 31.392 1.00 32.25 C ATOM 3938 SD MET A 808 7.953 2.030 31.668 1.00 31.79 S ATOM 3939 CE MET A 808 7.999 3.019 30.182 1.00 31.52 C ATOM 3940 N ILE A 809 2.789 0.908 33.983 1.00 32.65 N ATOM 3941 CA ILE A 809 1.860 0.995 35.115 1.00 32.79 C ATOM 3942 C ILE A 809 1.203 -0.355 35.361 1.00 32.85 C ATOM 3943 O ILE A 809 1.236 -0.883 36.471 1.00 32.79 O ATOM 3944 CB ILE A 809 0.744 2.054 34.872 1.00 32.85 C ATOM 3945 CG1 ILE A 809 1.194 3.416 35.394 1.00 32.73 C ATOM 3946 CG2 ILE A 809 -0.590 1.632 35.520 1.00 32.42 C ATOM 3947 CD1 ILE A 809 2.352 3.986 34.620 1.00 32.83 C ATOM 3948 N ASP A 810 0.607 -0.902 34.312 1.00 32.90 N ATOM 3949 CA ASP A 810 -0.079 -2.177 34.417 1.00 33.13 C ATOM 3950 C ASP A 810 0.909 -3.276 34.788 1.00 33.00 C ATOM 3951 O ASP A 810 0.603 -4.133 35.611 1.00 32.76 O ATOM 3952 CB ASP A 810 -0.796 -2.512 33.106 1.00 33.32 C ATOM 3953 CG ASP A 810 -1.910 -1.523 32.769 1.00 33.79 C ATOM 3954 OD1 ASP A 810 -2.444 -0.862 33.687 1.00 34.59 O ATOM 3955 OD2 ASP A 810 -2.253 -1.409 31.574 1.00 34.37 O ATOM 3956 N LEU A 811 2.102 -3.210 34.198 1.00 32.97 N ATOM 3957 CA LEU A 811 3.150 -4.216 34.387 1.00 32.77 C ATOM 3958 C LEU A 811 3.598 -4.321 35.834 1.00 32.65 C ATOM 3959 O LEU A 811 3.787 -5.413 36.358 1.00 32.42 O ATOM 3960 CB LEU A 811 4.361 -3.867 33.533 1.00 32.77 C ATOM 3961 CG LEU A 811 5.531 -4.841 33.671 1.00 33.11 C ATOM 3962 CD1 LEU A 811 5.120 -6.216 33.146 1.00 32.94 C ATOM 3963 CD2 LEU A 811 6.757 -4.317 32.947 1.00 32.70 C ATOM 3964 N ASN A 812 3.797 -3.170 36.459 1.00 32.72 N ATOM 3965 CA ASN A 812 4.167 -3.104 37.870 1.00 32.73 C ATOM 3966 C ASN A 812 3.095 -3.721 38.766 1.00 32.60 C ATOM 3967 O ASN A 812 3.407 -4.518 39.644 1.00 32.40 O ATOM 3968 CB ASN A 812 4.421 -1.653 38.292 1.00 32.80 C ATOM 3969 CG ASN A 812 5.420 -1.542 39.424 1.00 33.17 C ATOM 3970 OD1 ASN A 812 6.599 -1.877 39.265 1.00 34.13 O ATOM 3971 ND2 ASN A 812 4.961 -1.062 40.572 1.00 33.02 N ATOM 3972 N ALA A 813 1.837 -3.349 38.535 1.00 32.54 N ATOM 3973 CA ALA A 813 0.728 -3.872 39.322 1.00 32.58 C ATOM 3974 C ALA A 813 0.729 -5.391 39.263 1.00 32.80 C ATOM 3975 O ALA A 813 0.712 -6.068 40.284 1.00 32.85 O ATOM 3976 CB ALA A 813 -0.580 -3.330 38.809 1.00 32.54 C ATOM 3977 N ARG A 814 0.792 -5.918 38.050 1.00 33.02 N ATOM 3978 CA ARG A 814 0.750 -7.359 37.826 1.00 33.15 C ATOM 3979 C ARG A 814 1.905 -8.069 38.539 1.00 33.15 C ATOM 3980 O ARG A 814 1.690 -9.045 39.249 1.00 33.08 O ATOM 3981 CB ARG A 814 0.786 -7.673 36.324 1.00 33.24 C ATOM 3982 CG ARG A 814 -0.312 -6.994 35.465 1.00 33.81 C ATOM 3983 CD ARG A 814 -1.720 -7.476 35.774 1.00 34.42 C ATOM 3984 NE ARG A 814 -1.685 -8.797 36.386 1.00 34.85 N ATOM 3985 CZ ARG A 814 -1.822 -9.955 35.746 1.00 35.37 C ATOM 3986 NH1 ARG A 814 -2.057 -10.001 34.434 1.00 35.56 N ATOM 3987 NH2 ARG A 814 -1.739 -11.086 36.441 1.00 35.07 N ATOM 3988 N LEU A 815 3.122 -7.559 38.366 1.00 33.32 N ATOM 3989 CA LEU A 815 4.303 -8.115 39.035 1.00 33.54 C ATOM 3990 C LEU A 815 4.116 -8.189 40.540 1.00 34.06 C ATOM 3991 O LEU A 815 4.656 -9.072 41.205 1.00 34.23 O ATOM 3992 CB LEU A 815 5.535 -7.259 38.760 1.00 33.41 C ATOM 3993 CG LEU A 815 6.232 -7.440 37.414 1.00 33.25 C ATOM 3994 CD1 LEU A 815 7.304 -6.384 37.227 1.00 32.94 C ATOM 3995 CD2 LEU A 815 6.836 -8.824 37.301 1.00 33.23 C ATOM 3996 N LYS A 816 3.371 -7.228 41.071 1.00 34.65 N ATOM 3997 CA LYS A 816 3.078 -7.163 42.496 1.00 35.02 C ATOM 3998 C LYS A 816 2.070 -8.243 42.891 1.00 35.33 C ATOM 3999 O LYS A 816 2.249 -8.930 43.897 1.00 35.38 O ATOM 4000 CB LYS A 816 2.533 -5.778 42.845 1.00 35.05 C ATOM 4001 CG LYS A 816 2.538 -5.446 44.321 1.00 35.35 C ATOM 4002 CD LYS A 816 1.900 -4.083 44.582 1.00 35.74 C ATOM 4003 CE LYS A 816 1.472 -3.929 46.033 1.00 35.62 C ATOM 4004 NZ LYS A 816 1.273 -2.505 46.419 1.00 35.29 N ATOM 4005 N GLU A 817 1.013 -8.388 42.096 1.00 35.68 N ATOM 4006 CA GLU A 817 0.000 -9.407 42.358 1.00 36.04 C ATOM 4007 C GLU A 817 0.599 -10.800 42.364 1.00 36.19 C ATOM 4008 O GLU A 817 0.300 -11.607 43.246 1.00 36.41 O ATOM 4009 CB GLU A 817 -1.124 -9.360 41.323 1.00 36.20 C ATOM 4010 CG GLU A 817 -2.258 -8.423 41.684 1.00 37.00 C ATOM 4011 CD GLU A 817 -2.049 -7.025 41.141 1.00 38.33 C ATOM 4012 OE1 GLU A 817 -2.313 -6.811 39.930 1.00 39.54 O ATOM 4013 OE2 GLU A 817 -1.625 -6.141 41.925 1.00 38.58 O ATOM 4014 N GLU A 818 1.443 -11.078 41.377 1.00 36.33 N ATOM 4015 CA GLU A 818 2.038 -12.409 41.224 1.00 36.60 C ATOM 4016 C GLU A 818 3.150 -12.663 42.216 1.00 36.36 C ATOM 4017 O GLU A 818 3.587 -13.796 42.384 1.00 36.27 O ATOM 4018 CB GLU A 818 2.580 -12.599 39.813 1.00 36.83 C ATOM 4019 CG GLU A 818 1.629 -12.216 38.684 1.00 38.12 C ATOM 4020 CD GLU A 818 0.157 -12.557 38.952 1.00 39.74 C ATOM 4021 OE1 GLU A 818 -0.329 -12.378 40.093 1.00 39.88 O ATOM 4022 OE2 GLU A 818 -0.527 -12.991 37.997 1.00 40.81 O