>>2YPT:HELIX   19  19 ALA B   15  THR B   48  1                                  34    
AEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTT
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 19 19 ALA B 15 THR B 48 1 34 ATOM 3186 N ALA B 15 177.870 187.776 203.095 1.00194.73 N ANISOU 3186 N ALA B 15 15646 23842 34502 -1155 -8755 500 N ATOM 3187 CA ALA B 15 177.378 186.836 204.109 1.00194.33 C ANISOU 3187 CA ALA B 15 16101 23734 34000 -1069 -9275 512 C ATOM 3188 C ALA B 15 175.847 186.680 204.088 1.00192.72 C ANISOU 3188 C ALA B 15 16628 23349 33247 -1022 -9090 331 C ATOM 3189 O ALA B 15 175.362 185.585 203.794 1.00189.47 O ANISOU 3189 O ALA B 15 16392 22962 32635 -684 -8830 373 O ATOM 3190 CB ALA B 15 177.840 187.266 205.493 1.00196.41 C ANISOU 3190 CB ALA B 15 16713 24392 33523 -1399 -9666 423 C ATOM 3191 N GLU B 16 175.095 187.756 204.416 1.00186.67 N ANISOU 3191 N GLU B 16 16368 22559 32000 -1348 -9039 103 N ATOM 3192 CA GLU B 16 173.629 187.755 204.464 1.00180.45 C ANISOU 3192 CA GLU B 16 16351 21789 30425 -1326 -8668 -99 C ATOM 3193 C GLU B 16 173.018 187.562 203.076 1.00178.99 C ANISOU 3193 C GLU B 16 16078 21677 30251 -1038 -7817 -134 C ATOM 3194 O GLU B 16 171.983 186.911 202.956 1.00174.67 O ANISOU 3194 O GLU B 16 15994 21165 29206 -854 -7528 -207 O ATOM 3195 CB GLU B 16 173.101 189.054 205.092 1.00181.40 C ANISOU 3195 CB GLU B 16 16945 21841 30137 -1733 -8791 -324 C ATOM 3196 N LYS B 17 173.661 188.113 202.032 1.00175.66 N ANISOU 3196 N LYS B 17 15068 21278 30395 -1005 -7423 -73 N ATOM 3197 CA LYS B 17 173.191 188.015 200.647 1.00171.01 C ANISOU 3197 CA LYS B 17 14377 20769 29829 -744 -6623 -94 C ATOM 3198 C LYS B 17 173.362 186.589 200.097 1.00174.42 C ANISOU 3198 C LYS B 17 14608 21244 30418 -319 -6427 27 C ATOM 3199 O LYS B 17 172.572 186.169 199.250 1.00169.63 O ANISOU 3199 O LYS B 17 14214 20699 29538 -88 -5872 -48 O ATOM 3200 CB LYS B 17 173.915 189.037 199.751 1.00174.62 C ANISOU 3200 CB LYS B 17 14274 21225 30848 -845 -6274 -36 C ATOM 3201 CG LYS B 17 173.544 190.487 200.070 1.00176.66 C ANISOU 3201 CG LYS B 17 14799 21413 30913 -1235 -6304 -183 C ATOM 3202 CD LYS B 17 174.104 191.474 199.059 1.00179.87 C ANISOU 3202 CD LYS B 17 14708 21803 31829 -1314 -5851 -112 C ATOM 3203 CE LYS B 17 174.213 192.879 199.610 1.00182.55 C ANISOU 3203 CE LYS B 17 15139 22006 32216 -1754 -6090 -210 C ATOM 3204 NZ LYS B 17 172.891 193.535 199.774 1.00179.32 N ANISOU 3204 NZ LYS B 17 15440 21563 31131 -1865 -5868 -423 N ATOM 3205 N ARG B 18 174.371 185.847 200.604 1.00175.85 N ANISOU 3205 N ARG B 18 14401 21379 31034 -220 -6906 210 N ATOM 3206 CA ARG B 18 174.674 184.471 200.201 1.00176.58 C ANISOU 3206 CA ARG B 18 14272 21464 31354 189 -6782 342 C ATOM 3207 C ARG B 18 173.615 183.471 200.698 1.00177.82 C ANISOU 3207 C ARG B 18 15093 21599 30872 325 -6857 263 C ATOM 3208 O ARG B 18 173.231 182.581 199.934 1.00175.36 O ANISOU 3208 O ARG B 18 14838 21293 30499 643 -6414 245 O ATOM 3209 CB ARG B 18 176.061 184.051 200.703 1.00182.55 C ANISOU 3209 CB ARG B 18 14410 22161 32790 241 -7326 585 C ATOM 3210 N ILE B 19 173.151 183.608 201.965 1.00174.33 N ANISOU 3210 N ILE B 19 15163 21121 29955 79 -7400 215 N ATOM 3211 CA ILE B 19 172.148 182.711 202.562 1.00171.30 C ANISOU 3211 CA ILE B 19 15423 20701 28961 168 -7492 165 C ATOM 3212 C ILE B 19 170.755 182.966 201.974 1.00168.41 C ANISOU 3212 C ILE B 19 15556 20396 28037 161 -6903 -53 C ATOM 3213 O ILE B 19 169.964 182.028 201.887 1.00164.87 O ANISOU 3213 O ILE B 19 15459 19927 27256 347 -6719 -85 O ATOM 3214 CB ILE B 19 172.126 182.728 204.114 1.00177.08 C ANISOU 3214 CB ILE B 19 16563 21377 29345 -75 -8237 205 C ATOM 3215 CG1 ILE B 19 172.250 184.152 204.701 1.00178.81 C ANISOU 3215 CG1 ILE B 19 16872 21609 29460 -495 -8522 91 C ATOM 3216 CG2 ILE B 19 173.207 181.791 204.661 1.00183.75 C ANISOU 3216 CG2 ILE B 19 17043 22150 30624 92 -8797 468 C ATOM 3217 CD1 ILE B 19 171.858 184.293 206.165 1.00188.07 C ANISOU 3217 CD1 ILE B 19 18664 22734 30060 -760 -9117 45 C ATOM 3218 N PHE B 20 170.469 184.212 201.547 1.00163.62 N ANISOU 3218 N PHE B 20 14955 19851 27363 -47 -6613 -186 N ATOM 3219 CA PHE B 20 169.201 184.564 200.907 1.00158.73 C ANISOU 3219 CA PHE B 20 14732 19299 26280 -47 -6057 -367 C ATOM 3220 C PHE B 20 169.111 183.897 199.528 1.00161.46 C ANISOU 3220 C PHE B 20 14835 19704 26810 288 -5466 -360 C ATOM 3221 O PHE B 20 168.062 183.354 199.174 1.00157.48 O ANISOU 3221 O PHE B 20 14705 19229 25902 412 -5155 -461 O ATOM 3222 CB PHE B 20 169.040 186.092 200.783 1.00160.00 C ANISOU 3222 CB PHE B 20 14913 19484 26396 -334 -5913 -477 C ATOM 3223 CG PHE B 20 167.875 186.525 199.917 1.00157.14 C ANISOU 3223 CG PHE B 20 14828 19201 25679 -292 -5302 -618 C ATOM 3224 CD1 PHE B 20 166.575 186.516 200.413 1.00157.32 C ANISOU 3224 CD1 PHE B 20 15465 19224 25085 -367 -5249 -751 C ATOM 3225 CD2 PHE B 20 168.075 186.923 198.600 1.00158.79 C ANISOU 3225 CD2 PHE B 20 14676 19484 26172 -169 -4776 -600 C ATOM 3226 CE1 PHE B 20 165.497 186.899 199.606 1.00154.21 C ANISOU 3226 CE1 PHE B 20 15283 18909 24402 -318 -4718 -859 C ATOM 3227 CE2 PHE B 20 166.996 187.297 197.792 1.00157.66 C ANISOU 3227 CE2 PHE B 20 14793 19424 25688 -119 -4256 -708 C ATOM 3228 CZ PHE B 20 165.716 187.295 198.304 1.00152.53 C ANISOU 3228 CZ PHE B 20 14715 18776 24462 -196 -4250 -835 C ATOM 3229 N GLY B 21 170.205 183.973 198.769 1.00161.40 N ANISOU 3229 N GLY B 21 14208 19709 27406 417 -5312 -248 N ATOM 3230 CA GLY B 21 170.331 183.384 197.441 1.00160.70 C ANISOU 3230 CA GLY B 21 13849 19667 27542 741 -4748 -238 C ATOM 3231 C GLY B 21 170.246 181.872 197.474 1.00164.95 C ANISOU 3231 C GLY B 21 14489 20132 28053 1039 -4789 -204 C ATOM 3232 O GLY B 21 169.639 181.270 196.585 1.00162.65 O ANISOU 3232 O GLY B 21 14353 19868 27579 1256 -4329 -301 O ATOM 3233 N ALA B 22 170.829 181.258 198.530 1.00163.94 N ANISOU 3233 N ALA B 22 14305 19897 28087 1041 -5366 -66 N ATOM 3234 CA ALA B 22 170.831 179.815 198.776 1.00164.59 C ANISOU 3234 CA ALA B 22 14494 19863 28180 1308 -5502 6 C ATOM 3235 C ALA B 22 169.404 179.280 198.923 1.00163.95 C ANISOU 3235 C ALA B 22 15086 19768 27438 1300 -5361 -146 C ATOM 3236 O ALA B 22 169.104 178.202 198.407 1.00162.73 O ANISOU 3236 O ALA B 22 15030 19543 27257 1561 -5108 -177 O ATOM 3237 CB ALA B 22 171.636 179.506 200.026 1.00169.81 C ANISOU 3237 CB ALA B 22 15029 20426 29065 1244 -6220 204 C ATOM 3238 N VAL B 23 168.526 180.054 199.604 1.00157.84 N ANISOU 3238 N VAL B 23 14765 19050 26156 997 -5501 -247 N ATOM 3239 CA VAL B 23 167.108 179.751 199.836 1.00153.46 C ANISOU 3239 CA VAL B 23 14831 18496 24980 934 -5367 -382 C ATOM 3240 C VAL B 23 166.369 179.686 198.485 1.00152.74 C ANISOU 3240 C VAL B 23 14775 18491 24768 1078 -4724 -539 C ATOM 3241 O VAL B 23 165.695 178.692 198.205 1.00150.29 O ANISOU 3241 O VAL B 23 14717 18126 24262 1232 -4547 -599 O ATOM 3242 CB VAL B 23 166.482 180.794 200.810 1.00156.08 C ANISOU 3242 CB VAL B 23 15557 18870 24876 583 -5610 -450 C ATOM 3243 CG1 VAL B 23 164.956 180.832 200.715 1.00151.34 C ANISOU 3243 CG1 VAL B 23 15488 18313 23702 511 -5288 -611 C ATOM 3244 CG2 VAL B 23 166.929 180.540 202.247 1.00159.34 C ANISOU 3244 CG2 VAL B 23 16132 19184 25225 457 -6268 -316 C ATOM 3245 N LEU B 24 166.533 180.735 197.653 1.00148.34 N ANISOU 3245 N LEU B 24 13966 18057 24337 1020 -4397 -596 N ATOM 3246 CA LEU B 24 165.915 180.865 196.337 1.00145.59 C ANISOU 3246 CA LEU B 24 13639 17818 23863 1136 -3815 -725 C ATOM 3247 C LEU B 24 166.465 179.857 195.338 1.00151.20 C ANISOU 3247 C LEU B 24 14074 18487 24887 1472 -3518 -715 C ATOM 3248 O LEU B 24 165.691 179.344 194.527 1.00149.15 O ANISOU 3248 O LEU B 24 14035 18259 24376 1601 -3158 -848 O ATOM 3249 CB LEU B 24 166.097 182.284 195.797 1.00145.45 C ANISOU 3249 CB LEU B 24 13408 17919 23935 987 -3583 -738 C ATOM 3250 CG LEU B 24 164.949 183.243 196.095 1.00147.61 C ANISOU 3250 CG LEU B 24 14087 18263 23735 740 -3530 -845 C ATOM 3251 CD1 LEU B 24 165.088 183.867 197.482 1.00149.31 C ANISOU 3251 CD1 LEU B 24 14454 18404 23874 461 -4022 -811 C ATOM 3252 CD2 LEU B 24 164.869 184.325 195.045 1.00149.45 C ANISOU 3252 CD2 LEU B 24 14154 18615 24014 714 -3096 -872 C ATOM 3253 N LEU B 25 167.785 179.563 195.395 1.00151.42 N ANISOU 3253 N LEU B 25 13626 18438 25469 1615 -3667 -565 N ATOM 3254 CA LEU B 25 168.430 178.592 194.507 1.00153.29 C ANISOU 3254 CA LEU B 25 13575 18604 26064 1964 -3370 -547 C ATOM 3255 C LEU B 25 167.889 177.187 194.772 1.00156.90 C ANISOU 3255 C LEU B 25 14377 18908 26330 2129 -3459 -596 C ATOM 3256 O LEU B 25 167.692 176.426 193.825 1.00155.87 O ANISOU 3256 O LEU B 25 14299 18738 26187 2367 -3067 -709 O ATOM 3257 CB LEU B 25 169.956 178.612 194.660 1.00158.24 C ANISOU 3257 CB LEU B 25 13583 19167 27373 2073 -3549 -345 C ATOM 3258 CG LEU B 25 170.727 178.027 193.487 1.00165.74 C ANISOU 3258 CG LEU B 25 14137 20082 28755 2424 -3073 -331 C ATOM 3259 CD1 LEU B 25 171.392 179.120 192.675 1.00167.16 C ANISOU 3259 CD1 LEU B 25 13877 20393 29242 2382 -2719 -283 C ATOM 3260 CD2 LEU B 25 171.738 176.994 193.955 1.00173.07 C ANISOU 3260 CD2 LEU B 25 14731 20824 30204 2670 -3353 -161 C ATOM 3261 N PHE B 26 167.619 176.862 196.052 1.00154.40 N ANISOU 3261 N PHE B 26 14331 18495 25839 1992 -3963 -518 N ATOM 3262 CA PHE B 26 167.072 175.568 196.443 1.00154.72 C ANISOU 3262 CA PHE B 26 14727 18365 25694 2112 -4080 -532 C ATOM 3263 C PHE B 26 165.610 175.464 196.040 1.00155.59 C ANISOU 3263 C PHE B 26 15335 18531 25252 2019 -3789 -739 C ATOM 3264 O PHE B 26 165.200 174.432 195.509 1.00154.78 O ANISOU 3264 O PHE B 26 15405 18318 25089 2197 -3570 -837 O ATOM 3265 CB PHE B 26 167.232 175.323 197.951 1.00158.47 C ANISOU 3265 CB PHE B 26 15361 18729 26120 1981 -4700 -355 C ATOM 3266 CG PHE B 26 166.825 173.931 198.374 1.00160.99 C ANISOU 3266 CG PHE B 26 16005 18837 26328 2128 -4824 -317 C ATOM 3267 CD1 PHE B 26 167.654 172.842 198.128 1.00168.01 C ANISOU 3267 CD1 PHE B 26 16630 19535 27673 2454 -4827 -211 C ATOM 3268 CD2 PHE B 26 165.607 173.708 199.006 1.00160.51 C ANISOU 3268 CD2 PHE B 26 16506 18748 25732 1946 -4906 -377 C ATOM 3269 CE1 PHE B 26 167.270 171.554 198.503 1.00169.94 C ANISOU 3269 CE1 PHE B 26 17189 19547 27833 2589 -4925 -169 C ATOM 3270 CE2 PHE B 26 165.224 172.419 199.381 1.00164.32 C ANISOU 3270 CE2 PHE B 26 17288 19012 26133 2066 -4997 -327 C ATOM 3271 CZ PHE B 26 166.058 171.351 199.126 1.00166.15 C ANISOU 3271 CZ PHE B 26 17274 19040 26816 2383 -5013 -224 C ATOM 3272 N SER B 27 164.831 176.534 196.286 1.00150.75 N ANISOU 3272 N SER B 27 14940 18075 24264 1738 -3789 -805 N ATOM 3273 CA SER B 27 163.404 176.614 195.969 1.00147.51 C ANISOU 3273 CA SER B 27 14952 17743 23351 1620 -3542 -976 C ATOM 3274 C SER B 27 163.144 176.415 194.478 1.00150.42 C ANISOU 3274 C SER B 27 15253 18187 23711 1796 -3032 -1137 C ATOM 3275 O SER B 27 162.104 175.860 194.118 1.00148.49 O ANISOU 3275 O SER B 27 15334 17931 23154 1795 -2865 -1276 O ATOM 3276 CB SER B 27 162.831 177.956 196.417 1.00150.24 C ANISOU 3276 CB SER B 27 15439 18240 23404 1328 -3599 -996 C ATOM 3277 OG SER B 27 163.003 178.157 197.811 1.00164.09 O ANISOU 3277 OG SER B 27 17333 19924 25090 1148 -4066 -877 O ATOM 3278 N TRP B 28 164.095 176.846 193.621 1.00148.21 N ANISOU 3278 N TRP B 28 14559 17980 23776 1939 -2790 -1114 N ATOM 3279 CA TRP B 28 163.982 176.723 192.171 1.00147.61 C ANISOU 3279 CA TRP B 28 14424 17986 23674 2119 -2288 -1257 C ATOM 3280 C TRP B 28 164.468 175.370 191.659 1.00153.64 C ANISOU 3280 C TRP B 28 15129 18568 24678 2427 -2145 -1307 C ATOM 3281 O TRP B 28 163.863 174.856 190.719 1.00152.64 O ANISOU 3281 O TRP B 28 15215 18451 24332 2531 -1823 -1490 O ATOM 3282 CB TRP B 28 164.706 177.861 191.452 1.00147.20 C ANISOU 3282 CB TRP B 28 13995 18093 23841 2124 -2028 -1200 C ATOM 3283 CG TRP B 28 163.830 179.059 191.282 1.00144.95 C ANISOU 3283 CG TRP B 28 13887 17997 23192 1892 -1920 -1246 C ATOM 3284 CD1 TRP B 28 163.801 180.169 192.072 1.00146.96 C ANISOU 3284 CD1 TRP B 28 14116 18304 23419 1639 -2152 -1156 C ATOM 3285 CD2 TRP B 28 162.763 179.211 190.334 1.00142.42 C ANISOU 3285 CD2 TRP B 28 13837 17814 22463 1888 -1588 -1396 C ATOM 3286 NE1 TRP B 28 162.817 181.029 191.645 1.00143.64 N ANISOU 3286 NE1 TRP B 28 13908 18034 22634 1502 -1945 -1230 N ATOM 3287 CE2 TRP B 28 162.156 180.462 190.585 1.00144.11 C ANISOU 3287 CE2 TRP B 28 14140 18160 22455 1651 -1617 -1364 C ATOM 3288 CE3 TRP B 28 162.274 178.419 189.278 1.00143.62 C ANISOU 3288 CE3 TRP B 28 14168 17983 22417 2061 -1282 -1559 C ATOM 3289 CZ2 TRP B 28 161.085 180.945 189.816 1.00140.91 C ANISOU 3289 CZ2 TRP B 28 13960 17914 21666 1600 -1358 -1456 C ATOM 3290 CZ3 TRP B 28 161.215 178.899 188.517 1.00142.76 C ANISOU 3290 CZ3 TRP B 28 14298 18048 21898 1987 -1058 -1664 C ATOM 3291 CH2 TRP B 28 160.631 180.146 188.789 1.00141.03 C ANISOU 3291 CH2 TRP B 28 14127 17968 21491 1767 -1101 -1597 C ATOM 3292 N THR B 29 165.530 174.786 192.262 1.00152.96 N ANISOU 3292 N THR B 29 14770 18308 25039 2574 -2390 -1151 N ATOM 3293 CA THR B 29 166.036 173.468 191.843 1.00155.60 C ANISOU 3293 CA THR B 29 15042 18425 25652 2895 -2252 -1185 C ATOM 3294 C THR B 29 165.004 172.379 192.176 1.00157.28 C ANISOU 3294 C THR B 29 15746 18469 25543 2872 -2364 -1298 C ATOM 3295 O THR B 29 164.781 171.486 191.356 1.00157.39 O ANISOU 3295 O THR B 29 15911 18366 25526 3061 -2069 -1469 O ATOM 3296 CB THR B 29 167.412 173.151 192.447 1.00167.14 C ANISOU 3296 CB THR B 29 16057 19740 27710 3067 -2512 -955 C ATOM 3297 OG1 THR B 29 167.388 173.369 193.859 1.00167.11 O ANISOU 3297 OG1 THR B 29 16123 19705 27666 2852 -3079 -780 O ATOM 3298 CG2 THR B 29 168.537 173.943 191.793 1.00167.15 C ANISOU 3298 CG2 THR B 29 15507 19860 28141 3169 -2263 -867 C ATOM 3299 N VAL B 30 164.350 172.488 193.358 1.00151.54 N ANISOU 3299 N VAL B 30 15289 17726 24564 2625 -2767 -1212 N ATOM 3300 CA VAL B 30 163.292 171.582 193.820 1.00149.80 C ANISOU 3300 CA VAL B 30 15535 17353 24029 2543 -2888 -1282 C ATOM 3301 C VAL B 30 162.124 171.702 192.847 1.00151.25 C ANISOU 3301 C VAL B 30 15996 17664 23807 2454 -2536 -1532 C ATOM 3302 O VAL B 30 161.601 170.678 192.402 1.00151.40 O ANISOU 3302 O VAL B 30 16261 17527 23738 2541 -2397 -1682 O ATOM 3303 CB VAL B 30 162.888 171.877 195.293 1.00152.30 C ANISOU 3303 CB VAL B 30 16065 17662 24141 2284 -3348 -1116 C ATOM 3304 CG1 VAL B 30 161.506 171.324 195.637 1.00149.80 C ANISOU 3304 CG1 VAL B 30 16245 17272 23401 2117 -3364 -1206 C ATOM 3305 CG2 VAL B 30 163.929 171.326 196.249 1.00155.89 C ANISOU 3305 CG2 VAL B 30 16342 17926 24963 2409 -3747 -874 C ATOM 3306 N TYR B 31 161.765 172.955 192.475 1.00145.58 N ANISOU 3306 N TYR B 31 15225 17219 22871 2288 -2399 -1572 N ATOM 3307 CA TYR B 31 160.706 173.246 191.514 1.00142.95 C ANISOU 3307 CA TYR B 31 15104 17048 22161 2205 -2095 -1774 C ATOM 3308 C TYR B 31 161.024 172.620 190.154 1.00148.54 C ANISOU 3308 C TYR B 31 15761 17719 22957 2462 -1709 -1952 C ATOM 3309 O TYR B 31 160.162 171.940 189.598 1.00147.93 O ANISOU 3309 O TYR B 31 15985 17594 22629 2455 -1581 -2145 O ATOM 3310 CB TYR B 31 160.470 174.758 191.363 1.00142.05 C ANISOU 3310 CB TYR B 31 14886 17211 21875 2026 -2018 -1737 C ATOM 3311 CG TYR B 31 159.484 175.078 190.261 1.00143.09 C ANISOU 3311 CG TYR B 31 15192 17523 21653 1981 -1708 -1914 C ATOM 3312 CD1 TYR B 31 158.128 174.797 190.409 1.00143.53 C ANISOU 3312 CD1 TYR B 31 15593 17590 21351 1812 -1766 -2014 C ATOM 3313 CD2 TYR B 31 159.911 175.617 189.051 1.00144.89 C ANISOU 3313 CD2 TYR B 31 15236 17907 21909 2112 -1357 -1969 C ATOM 3314 CE1 TYR B 31 157.218 175.055 189.385 1.00143.67 C ANISOU 3314 CE1 TYR B 31 15749 17779 21059 1771 -1532 -2165 C ATOM 3315 CE2 TYR B 31 159.009 175.885 188.020 1.00144.66 C ANISOU 3315 CE2 TYR B 31 15390 18051 21523 2079 -1109 -2116 C ATOM 3316 CZ TYR B 31 157.662 175.606 188.195 1.00150.60 C ANISOU 3316 CZ TYR B 31 16467 18820 21933 1907 -1222 -2214 C ATOM 3317 OH TYR B 31 156.759 175.848 187.191 1.00150.03 O ANISOU 3317 OH TYR B 31 16556 18925 21523 1869 -1033 -2347 O ATOM 3318 N LEU B 32 162.259 172.837 189.634 1.00147.01 N ANISOU 3318 N LEU B 32 15193 17539 23125 2681 -1519 -1891 N ATOM 3319 CA LEU B 32 162.710 172.301 188.345 1.00149.05 C ANISOU 3319 CA LEU B 32 15392 17758 23481 2955 -1098 -2051 C ATOM 3320 C LEU B 32 162.763 170.774 188.358 1.00155.41 C ANISOU 3320 C LEU B 32 16381 18247 24422 3146 -1108 -2160 C ATOM 3321 O LEU B 32 162.502 170.157 187.325 1.00156.43 O ANISOU 3321 O LEU B 32 16704 18322 24409 3282 -796 -2392 O ATOM 3322 CB LEU B 32 164.072 172.875 187.930 1.00151.67 C ANISOU 3322 CB LEU B 32 15244 18153 24230 3145 -881 -1921 C ATOM 3323 CG LEU B 32 164.084 174.330 187.443 1.00154.53 C ANISOU 3323 CG LEU B 32 15437 18811 24467 3012 -698 -1862 C ATOM 3324 CD1 LEU B 32 165.498 174.866 187.393 1.00157.84 C ANISOU 3324 CD1 LEU B 32 15328 19245 25399 3147 -589 -1672 C ATOM 3325 CD2 LEU B 32 163.419 174.482 186.079 1.00155.51 C ANISOU 3325 CD2 LEU B 32 15800 19097 24191 3052 -281 -2068 C ATOM 3326 N TRP B 33 163.066 170.168 189.522 1.00152.91 N ANISOU 3326 N TRP B 33 16036 17711 24352 3151 -1474 -1995 N ATOM 3327 CA TRP B 33 163.080 168.714 189.696 1.00155.35 C ANISOU 3327 CA TRP B 33 16537 17677 24813 3318 -1527 -2056 C ATOM 3328 C TRP B 33 161.652 168.170 189.574 1.00155.99 C ANISOU 3328 C TRP B 33 17110 17706 24452 3123 -1543 -2261 C ATOM 3329 O TRP B 33 161.423 167.187 188.869 1.00157.26 O ANISOU 3329 O TRP B 33 17491 17674 24586 3256 -1337 -2478 O ATOM 3330 CB TRP B 33 163.705 168.335 191.053 1.00155.97 C ANISOU 3330 CB TRP B 33 16474 17560 25226 3345 -1960 -1778 C ATOM 3331 CG TRP B 33 163.380 166.947 191.529 1.00158.73 C ANISOU 3331 CG TRP B 33 17123 17557 25630 3418 -2110 -1792 C ATOM 3332 CD1 TRP B 33 162.558 166.609 192.563 1.00160.17 C ANISOU 3332 CD1 TRP B 33 17624 17638 25594 3196 -2445 -1702 C ATOM 3333 CD2 TRP B 33 163.843 165.712 190.962 1.00162.41 C ANISOU 3333 CD2 TRP B 33 17620 17703 26387 3734 -1891 -1903 C ATOM 3334 NE1 TRP B 33 162.499 165.241 192.693 1.00162.36 N ANISOU 3334 NE1 TRP B 33 18117 17548 26025 3345 -2468 -1729 N ATOM 3335 CE2 TRP B 33 163.276 164.665 191.722 1.00167.01 C ANISOU 3335 CE2 TRP B 33 18540 17986 26932 3678 -2137 -1862 C ATOM 3336 CE3 TRP B 33 164.690 165.387 189.888 1.00166.91 C ANISOU 3336 CE3 TRP B 33 17977 18192 27250 4068 -1481 -2032 C ATOM 3337 CZ2 TRP B 33 163.541 163.316 191.453 1.00170.06 C ANISOU 3337 CZ2 TRP B 33 19053 17977 27587 3942 -2011 -1945 C ATOM 3338 CZ3 TRP B 33 164.936 164.051 189.611 1.00172.15 C ANISOU 3338 CZ3 TRP B 33 18778 18472 28159 4339 -1337 -2136 C ATOM 3339 CH2 TRP B 33 164.366 163.033 190.388 1.00173.30 C ANISOU 3339 CH2 TRP B 33 19258 18306 28281 4274 -1611 -2094 C ATOM 3340 N GLU B 34 160.702 168.837 190.247 1.00148.45 N ANISOU 3340 N GLU B 34 16316 16919 23170 2805 -1775 -2197 N ATOM 3341 CA GLU B 34 159.285 168.489 190.248 1.00146.06 C ANISOU 3341 CA GLU B 34 16415 16604 22478 2575 -1818 -2347 C ATOM 3342 C GLU B 34 158.654 168.750 188.874 1.00148.65 C ANISOU 3342 C GLU B 34 16863 17119 22500 2557 -1488 -2614 C ATOM 3343 O GLU B 34 157.751 168.009 188.477 1.00148.72 O ANISOU 3343 O GLU B 34 17182 17023 22300 2477 -1448 -2815 O ATOM 3344 CB GLU B 34 158.541 169.262 191.349 1.00144.26 C ANISOU 3344 CB GLU B 34 16272 16521 22021 2267 -2108 -2181 C ATOM 3345 CG GLU B 34 158.848 168.747 192.750 1.00156.09 C ANISOU 3345 CG GLU B 34 17815 17797 23696 2242 -2467 -1948 C ATOM 3346 CD GLU B 34 158.137 169.408 193.917 1.00170.70 C ANISOU 3346 CD GLU B 34 19811 19754 25292 1951 -2733 -1791 C ATOM 3347 OE1 GLU B 34 157.553 170.501 193.735 1.00159.46 O ANISOU 3347 OE1 GLU B 34 18375 18600 23612 1775 -2653 -1830 O ATOM 3348 OE2 GLU B 34 158.185 168.835 195.029 1.00164.17 O ANISOU 3348 OE2 GLU B 34 19127 18729 24522 1913 -3012 -1618 O ATOM 3349 N THR B 35 159.143 169.784 188.147 1.00143.85 N ANISOU 3349 N THR B 35 16013 16776 21868 2625 -1265 -2608 N ATOM 3350 CA THR B 35 158.671 170.144 186.804 1.00142.94 C ANISOU 3350 CA THR B 35 16003 16867 21440 2632 -951 -2823 C ATOM 3351 C THR B 35 159.185 169.103 185.801 1.00149.69 C ANISOU 3351 C THR B 35 16951 17524 22400 2910 -656 -3047 C ATOM 3352 O THR B 35 158.435 168.718 184.901 1.00150.10 O ANISOU 3352 O THR B 35 17298 17597 22137 2874 -514 -3302 O ATOM 3353 CB THR B 35 159.073 171.581 186.442 1.00149.68 C ANISOU 3353 CB THR B 35 16582 18037 22254 2618 -803 -2700 C ATOM 3354 OG1 THR B 35 158.570 172.459 187.447 1.00147.22 O ANISOU 3354 OG1 THR B 35 16230 17853 21855 2363 -1081 -2518 O ATOM 3355 CG2 THR B 35 158.527 172.026 185.090 1.00147.89 C ANISOU 3355 CG2 THR B 35 16492 18043 21656 2618 -504 -2880 C ATOM 3356 N PHE B 36 160.443 168.627 185.974 1.00148.07 N ANISOU 3356 N PHE B 36 16503 17115 22642 3186 -576 -2956 N ATOM 3357 CA PHE B 36 161.034 167.581 185.128 1.00151.41 C ANISOU 3357 CA PHE B 36 17004 17295 23229 3490 -266 -3159 C ATOM 3358 C PHE B 36 160.200 166.301 185.263 1.00153.64 C ANISOU 3358 C PHE B 36 17698 17277 23400 3420 -399 -3356 C ATOM 3359 O PHE B 36 159.904 165.650 184.260 1.00154.96 O ANISOU 3359 O PHE B 36 18147 17348 23383 3502 -157 -3656 O ATOM 3360 CB PHE B 36 162.517 167.336 185.490 1.00156.63 C ANISOU 3360 CB PHE B 36 17268 17778 24468 3795 -201 -2967 C ATOM 3361 CG PHE B 36 163.066 165.977 185.114 1.00163.02 C ANISOU 3361 CG PHE B 36 18176 18208 25558 4109 2 -3121 C ATOM 3362 CD1 PHE B 36 163.296 165.643 183.783 1.00169.37 C ANISOU 3362 CD1 PHE B 36 19110 18982 26260 4332 477 -3394 C ATOM 3363 CD2 PHE B 36 163.357 165.032 186.090 1.00167.06 C ANISOU 3363 CD2 PHE B 36 18674 18376 26425 4194 -270 -2989 C ATOM 3364 CE1 PHE B 36 163.787 164.380 183.435 1.00175.00 C ANISOU 3364 CE1 PHE B 36 19946 19311 27234 4633 695 -3561 C ATOM 3365 CE2 PHE B 36 163.852 163.771 185.742 1.00174.52 C ANISOU 3365 CE2 PHE B 36 19718 18934 27658 4500 -67 -3127 C ATOM 3366 CZ PHE B 36 164.066 163.455 184.417 1.00175.61 C ANISOU 3366 CZ PHE B 36 19987 19031 27706 4720 424 -3424 C ATOM 3367 N LEU B 37 159.801 165.979 186.508 1.00147.47 N ANISOU 3367 N LEU B 37 16971 16348 22712 3250 -784 -3187 N ATOM 3368 CA LEU B 37 158.959 164.842 186.862 1.00147.43 C ANISOU 3368 CA LEU B 37 17330 16046 22640 3130 -954 -3306 C ATOM 3369 C LEU B 37 157.576 165.004 186.258 1.00148.66 C ANISOU 3369 C LEU B 37 17799 16372 22314 2848 -949 -3535 C ATOM 3370 O LEU B 37 157.036 164.040 185.716 1.00150.84 O ANISOU 3370 O LEU B 37 18392 16431 22488 2830 -883 -3798 O ATOM 3371 CB LEU B 37 158.861 164.736 188.387 1.00146.03 C ANISOU 3371 CB LEU B 37 17112 15748 22626 2989 -1352 -3009 C ATOM 3372 CG LEU B 37 159.618 163.600 189.041 1.00154.10 C ANISOU 3372 CG LEU B 37 18118 16354 24078 3212 -1460 -2887 C ATOM 3373 CD1 LEU B 37 161.114 163.773 188.888 1.00157.10 C ANISOU 3373 CD1 LEU B 37 18094 16716 24881 3558 -1322 -2756 C ATOM 3374 CD2 LEU B 37 159.288 163.533 190.493 1.00154.77 C ANISOU 3374 CD2 LEU B 37 18259 16354 24191 3020 -1861 -2606 C ATOM 3375 N ALA B 38 157.016 166.231 186.333 1.00140.37 N ANISOU 3375 N ALA B 38 16649 15696 20989 2631 -1025 -3435 N ATOM 3376 CA ALA B 38 155.712 166.569 185.773 1.00138.01 C ANISOU 3376 CA ALA B 38 16571 15611 20256 2370 -1044 -3601 C ATOM 3377 C ALA B 38 155.726 166.416 184.254 1.00143.90 C ANISOU 3377 C ALA B 38 17471 16434 20772 2500 -738 -3908 C ATOM 3378 O ALA B 38 154.760 165.905 183.697 1.00144.36 O ANISOU 3378 O ALA B 38 17829 16457 20563 2347 -773 -4149 O ATOM 3379 CB ALA B 38 155.326 167.985 186.157 1.00134.98 C ANISOU 3379 CB ALA B 38 15999 15592 19695 2183 -1145 -3398 C ATOM 3380 N GLN B 39 156.839 166.821 183.599 1.00142.01 N ANISOU 3380 N GLN B 39 17032 16284 20642 2777 -437 -3897 N ATOM 3381 CA GLN B 39 157.060 166.703 182.152 1.00144.81 C ANISOU 3381 CA GLN B 39 17541 16707 20774 2953 -81 -4168 C ATOM 3382 C GLN B 39 157.158 165.227 181.757 1.00152.98 C ANISOU 3382 C GLN B 39 18880 17343 21901 3096 23 -4458 C ATOM 3383 O GLN B 39 156.599 164.828 180.735 1.00154.06 O ANISOU 3383 O GLN B 39 19354 17482 21699 3062 141 -4774 O ATOM 3384 CB GLN B 39 158.343 167.460 181.746 1.00147.28 C ANISOU 3384 CB GLN B 39 17518 17169 21274 3226 244 -4027 C ATOM 3385 CG GLN B 39 158.661 167.452 180.251 1.00165.55 C ANISOU 3385 CG GLN B 39 19992 19578 23333 3430 678 -4272 C ATOM 3386 N ARG B 40 157.862 164.428 182.584 1.00151.93 N ANISOU 3386 N ARG B 40 18641 16858 22226 3252 -41 -4345 N ATOM 3387 CA ARG B 40 158.081 162.992 182.404 1.00156.16 C ANISOU 3387 CA ARG B 40 19433 16942 22959 3420 54 -4570 C ATOM 3388 C ARG B 40 156.753 162.218 182.430 1.00159.95 C ANISOU 3388 C ARG B 40 20322 17258 23193 3118 -184 -4791 C ATOM 3389 O ARG B 40 156.566 161.325 181.603 1.00163.20 O ANISOU 3389 O ARG B 40 21076 17441 23491 3177 -29 -5136 O ATOM 3390 CB ARG B 40 159.034 162.466 183.488 1.00157.84 C ANISOU 3390 CB ARG B 40 19393 16845 23733 3621 -47 -4306 C ATOM 3391 CG ARG B 40 159.903 161.314 183.027 1.00174.25 C ANISOU 3391 CG ARG B 40 21560 18509 26136 3984 245 -4480 C ATOM 3392 CD ARG B 40 161.073 161.081 183.964 1.00187.01 C ANISOU 3392 CD ARG B 40 22803 19912 28340 4247 180 -4157 C ATOM 3393 NE ARG B 40 161.876 159.929 183.547 1.00205.11 N ANISOU 3393 NE ARG B 40 25171 21771 30989 4620 471 -4312 N ATOM 3394 CZ ARG B 40 162.867 159.981 182.660 1.00226.31 C ANISOU 3394 CZ ARG B 40 27699 24456 33832 4971 925 -4413 C ATOM 3395 NH1 ARG B 40 163.197 161.132 182.087 1.00213.05 N ANISOU 3395 NH1 ARG B 40 25775 23192 31983 4985 1134 -4360 N ATOM 3396 NH2 ARG B 40 163.533 158.880 182.338 1.00219.82 N ANISOU 3396 NH2 ARG B 40 26967 23202 33353 5318 1200 -4559 N ATOM 3397 N GLN B 41 155.833 162.577 183.354 1.00152.57 N ANISOU 3397 N GLN B 41 19353 16437 22179 2790 -542 -4601 N ATOM 3398 CA GLN B 41 154.525 161.929 183.476 1.00152.20 C ANISOU 3398 CA GLN B 41 19625 16255 21949 2468 -777 -4760 C ATOM 3399 C GLN B 41 153.515 162.490 182.474 1.00155.09 C ANISOU 3399 C GLN B 41 20153 16954 21820 2247 -780 -4981 C ATOM 3400 O GLN B 41 152.579 161.777 182.114 1.00155.95 O ANISOU 3400 O GLN B 41 20569 16921 21765 2037 -896 -5233 O ATOM 3401 CB GLN B 41 153.974 162.033 184.900 1.00150.60 C ANISOU 3401 CB GLN B 41 19318 16017 21888 2226 -1111 -4450 C ATOM 3402 CG GLN B 41 153.570 160.675 185.465 1.00174.07 C ANISOU 3402 CG GLN B 41 22551 18514 25074 2133 -1254 -4509 C ATOM 3403 CD GLN B 41 152.082 160.452 185.531 1.00199.57 C ANISOU 3403 CD GLN B 41 25996 21755 28077 1731 -1462 -4615 C ATOM 3404 OE1 GLN B 41 151.523 159.614 184.813 1.00199.13 O ANISOU 3404 OE1 GLN B 41 26239 21492 27930 1632 -1441 -4938 O ATOM 3405 NE2 GLN B 41 151.415 161.143 186.444 1.00191.38 N ANISOU 3405 NE2 GLN B 41 24815 20926 26975 1487 -1667 -4346 N ATOM 3406 N ARG B 42 153.697 163.751 182.020 1.00150.02 N ANISOU 3406 N ARG B 42 19304 16742 20954 2287 -670 -4878 N ATOM 3407 CA ARG B 42 152.823 164.369 181.015 1.00149.64 C ANISOU 3407 CA ARG B 42 19395 17036 20427 2117 -674 -5047 C ATOM 3408 C ARG B 42 153.024 163.673 179.671 1.00158.78 C ANISOU 3408 C ARG B 42 20892 18080 21358 2271 -431 -5444 C ATOM 3409 O ARG B 42 152.072 163.537 178.903 1.00159.77 O ANISOU 3409 O ARG B 42 21291 18305 21109 2072 -540 -5691 O ATOM 3410 CB ARG B 42 153.084 165.876 180.890 1.00147.14 C ANISOU 3410 CB ARG B 42 18780 17162 19966 2157 -587 -4806 C ATOM 3411 N ARG B 43 154.263 163.202 179.413 1.00158.82 N ANISOU 3411 N ARG B 43 20883 17859 21600 2626 -107 -5506 N ATOM 3412 CA ARG B 43 154.636 162.463 178.207 1.00164.03 C ANISOU 3412 CA ARG B 43 21887 18349 22089 2832 201 -5890 C ATOM 3413 C ARG B 43 153.908 161.124 178.165 1.00170.90 C ANISOU 3413 C ARG B 43 23157 18818 22960 2667 29 -6209 C ATOM 3414 O ARG B 43 153.459 160.727 177.095 1.00173.97 O ANISOU 3414 O ARG B 43 23932 19194 22976 2612 89 -6581 O ATOM 3415 CB ARG B 43 156.158 162.259 178.134 1.00167.98 C ANISOU 3415 CB ARG B 43 22209 18664 22950 3266 604 -5831 C ATOM 3416 CG ARG B 43 156.908 163.502 177.663 1.00180.30 C ANISOU 3416 CG ARG B 43 23476 20617 24414 3447 890 -5639 C ATOM 3417 CD ARG B 43 158.365 163.496 178.079 1.00195.76 C ANISOU 3417 CD ARG B 43 25062 22422 26895 3804 1166 -5423 C ATOM 3418 NE ARG B 43 159.194 162.714 177.159 1.00215.50 N ANISOU 3418 NE ARG B 43 27757 24668 29454 4156 1627 -5699 N ATOM 3419 CZ ARG B 43 160.517 162.613 177.245 1.00236.20 C ANISOU 3419 CZ ARG B 43 30074 27141 32528 4523 1963 -5565 C ATOM 3420 NH1 ARG B 43 161.179 163.240 178.209 1.00222.43 N ANISOU 3420 NH1 ARG B 43 27815 25484 31215 4567 1844 -5162 N ATOM 3421 NH2 ARG B 43 161.189 161.881 176.363 1.00229.51 N ANISOU 3421 NH2 ARG B 43 29435 26052 31715 4848 2422 -5839 N ATOM 3422 N ILE B 44 153.748 160.459 179.335 1.00166.43 N ANISOU 3422 N ILE B 44 22515 17929 22791 2565 -204 -6056 N ATOM 3423 CA ILE B 44 153.055 159.171 179.490 1.00168.99 C ANISOU 3423 CA ILE B 44 23181 17821 23208 2380 -383 -6297 C ATOM 3424 C ILE B 44 151.585 159.318 179.045 1.00171.79 C ANISOU 3424 C ILE B 44 23745 18382 23146 1961 -680 -6480 C ATOM 3425 O ILE B 44 151.097 158.472 178.298 1.00175.11 O ANISOU 3425 O ILE B 44 24562 18584 23390 1853 -705 -6870 O ATOM 3426 CB ILE B 44 153.173 158.611 180.951 1.00170.90 C ANISOU 3426 CB ILE B 44 23257 17727 23950 2345 -577 -5998 C ATOM 3427 CG1 ILE B 44 154.633 158.618 181.512 1.00171.87 C ANISOU 3427 CG1 ILE B 44 23084 17704 24513 2751 -362 -5738 C ATOM 3428 CG2 ILE B 44 152.496 157.245 181.119 1.00174.80 C ANISOU 3428 CG2 ILE B 44 24108 17728 24582 2156 -730 -6226 C ATOM 3429 CD1 ILE B 44 155.757 157.841 180.718 1.00185.46 C ANISOU 3429 CD1 ILE B 44 24948 19102 26416 3174 49 -5987 C ATOM 3430 N TYR B 45 150.907 160.406 179.469 1.00163.92 N ANISOU 3430 N TYR B 45 22478 17801 22003 1734 -901 -6207 N ATOM 3431 CA TYR B 45 149.513 160.698 179.119 1.00163.01 C ANISOU 3431 CA TYR B 45 22461 17931 21544 1350 -1199 -6308 C ATOM 3432 C TYR B 45 149.346 160.935 177.617 1.00168.81 C ANISOU 3432 C TYR B 45 23465 18906 21769 1380 -1101 -6639 C ATOM 3433 O TYR B 45 148.344 160.507 177.048 1.00170.51 O ANISOU 3433 O TYR B 45 23947 19107 21734 1104 -1331 -6911 O ATOM 3434 CB TYR B 45 148.987 161.926 179.895 1.00159.30 C ANISOU 3434 CB TYR B 45 21609 17858 21061 1179 -1382 -5912 C ATOM 3435 CG TYR B 45 148.973 161.783 181.404 1.00159.09 C ANISOU 3435 CG TYR B 45 21360 17642 21443 1098 -1515 -5581 C ATOM 3436 CD1 TYR B 45 148.411 160.665 182.015 1.00163.18 C ANISOU 3436 CD1 TYR B 45 22043 17758 22201 897 -1685 -5642 C ATOM 3437 CD2 TYR B 45 149.444 162.803 182.224 1.00155.97 C ANISOU 3437 CD2 TYR B 45 20615 17476 21169 1191 -1487 -5204 C ATOM 3438 CE1 TYR B 45 148.386 160.533 183.403 1.00162.43 C ANISOU 3438 CE1 TYR B 45 21786 17494 22436 824 -1795 -5319 C ATOM 3439 CE2 TYR B 45 149.408 162.691 183.615 1.00155.06 C ANISOU 3439 CE2 TYR B 45 20349 17202 21366 1107 -1623 -4906 C ATOM 3440 CZ TYR B 45 148.871 161.555 184.201 1.00166.08 C ANISOU 3440 CZ TYR B 45 21928 18206 22969 929 -1771 -4955 C ATOM 3441 OH TYR B 45 148.818 161.432 185.570 1.00167.58 O ANISOU 3441 OH TYR B 45 22010 18240 23424 847 -1893 -4645 O ATOM 3442 N LYS B 46 150.328 161.605 176.984 1.00165.42 N ANISOU 3442 N LYS B 46 22970 18694 21188 1704 -766 -6607 N ATOM 3443 CA LYS B 46 150.321 161.934 175.557 1.00168.18 C ANISOU 3443 CA LYS B 46 23589 19299 21014 1783 -611 -6874 C ATOM 3444 C LYS B 46 150.741 160.748 174.672 1.00178.35 C ANISOU 3444 C LYS B 46 25353 20213 22197 1942 -387 -7338 C ATOM 3445 O LYS B 46 150.228 160.623 173.557 1.00181.28 O ANISOU 3445 O LYS B 46 26100 20696 22082 1844 -432 -7671 O ATOM 3446 CB LYS B 46 151.238 163.136 175.282 1.00168.63 C ANISOU 3446 CB LYS B 46 23378 19714 20979 2067 -293 -6621 C ATOM 3447 N THR B 47 151.673 159.895 175.151 1.00176.75 N ANISOU 3447 N THR B 47 25151 19567 22439 2196 -149 -7362 N ATOM 3448 CA THR B 47 152.175 158.747 174.390 1.00182.57 C ANISOU 3448 CA THR B 47 26331 19889 23147 2396 124 -7794 C ATOM 3449 C THR B 47 151.210 157.554 174.482 1.00189.29 C ANISOU 3449 C THR B 47 27539 20344 24039 2077 -195 -8108 C ATOM 3450 O THR B 47 150.757 157.078 173.439 1.00193.44 O ANISOU 3450 O THR B 47 28528 20812 24159 1972 -219 -8543 O ATOM 3451 CB THR B 47 153.602 158.356 174.832 1.00191.92 C ANISOU 3451 CB THR B 47 27333 20755 24833 2832 528 -7668 C ATOM 3452 OG1 THR B 47 154.413 159.528 174.917 1.00189.44 O ANISOU 3452 OG1 THR B 47 26605 20815 24557 3060 756 -7321 O ATOM 3453 CG2 THR B 47 154.260 157.358 173.885 1.00197.35 C ANISOU 3453 CG2 THR B 47 28465 21063 25456 3120 926 -8109 C ATOM 3454 N THR B 48 150.908 157.064 175.707 1.00183.85 N ATOM 3455 CA THR B 48 150.041 155.897 175.908 1.00186.76 C ATOM 3456 C THR B 48 148.574 156.257 175.586 1.00191.07 C ATOM 3457 O THR B 48 147.788 156.583 176.477 1.00186.82 O ATOM 3458 CB THR B 48 150.217 155.284 177.319 1.00193.17 C ATOM 3459 OG1 THR B 48 149.773 156.208 178.308 1.00189.34 O ATOM 3460 CG2 THR B 48 151.652 154.855 177.610 1.00192.68 C