>>2YPT:HELIX   38  38 ASP D   60  GLY D   96  1                                  37    
DSETFEKSRLYQLDKSTFSFWSGLYSETEGTLILLFG
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 38 38 ASP D 60 GLY D 96 1 37 ATOM 6601 N ASP D 60 145.098 208.277 138.206 1.00173.94 N ANISOU 6601 N ASP D 60 25146 20269 20675 3198 1178 -4086 N ATOM 6602 CA ASP D 60 144.754 208.421 139.620 1.00177.75 C ANISOU 6602 CA ASP D 60 25987 20829 20721 3520 1365 -4396 C ATOM 6603 C ASP D 60 145.312 207.220 140.400 1.00179.58 C ANISOU 6603 C ASP D 60 26223 21517 20492 3454 1260 -4383 C ATOM 6604 O ASP D 60 145.629 206.196 139.788 1.00174.92 O ANISOU 6604 O ASP D 60 25271 21198 19993 3237 1151 -4066 O ATOM 6605 CB ASP D 60 143.237 208.576 139.830 1.00181.67 C ANISOU 6605 CB ASP D 60 26438 21297 21292 3980 1855 -4265 C ATOM 6606 CG ASP D 60 142.395 207.448 139.277 1.00186.60 C ANISOU 6606 CG ASP D 60 26570 22245 22084 4055 2074 -3786 C ATOM 6607 OD1 ASP D 60 142.218 207.393 138.042 1.00184.09 O ANISOU 6607 OD1 ASP D 60 25915 21844 22188 3908 1957 -3488 O ATOM 6608 OD2 ASP D 60 141.874 206.647 140.084 1.00191.84 O ANISOU 6608 OD2 ASP D 60 27215 23219 22458 4269 2374 -3712 O ATOM 6609 N SER D 61 145.431 207.350 141.743 1.00179.56 N ANISOU 6609 N SER D 61 26672 21578 19973 3658 1287 -4728 N ATOM 6610 CA SER D 61 145.972 206.334 142.662 1.00179.09 C ANISOU 6610 CA SER D 61 26753 21909 19385 3657 1155 -4756 C ATOM 6611 C SER D 61 145.280 204.971 142.529 1.00177.89 C ANISOU 6611 C SER D 61 26256 22156 19179 3767 1471 -4282 C ATOM 6612 O SER D 61 145.957 203.945 142.620 1.00174.95 O ANISOU 6612 O SER D 61 25762 22083 18629 3597 1250 -4140 O ATOM 6613 CB SER D 61 145.878 206.798 144.115 1.00189.31 C ANISOU 6613 CB SER D 61 28684 23162 20081 3965 1236 -5175 C ATOM 6614 OG SER D 61 145.631 208.187 144.265 1.00202.96 O ANISOU 6614 OG SER D 61 30741 24451 21923 4090 1301 -5545 O ATOM 6615 N GLU D 62 143.946 204.964 142.321 1.00173.62 N ANISOU 6615 N GLU D 62 25534 21594 18838 4048 1975 -4048 N ATOM 6616 CA GLU D 62 143.156 203.737 142.172 1.00170.50 C ANISOU 6616 CA GLU D 62 24770 21521 18491 4148 2314 -3609 C ATOM 6617 C GLU D 62 143.500 203.019 140.861 1.00167.44 C ANISOU 6617 C GLU D 62 23854 21235 18531 3799 2059 -3261 C ATOM 6618 O GLU D 62 143.753 201.815 140.884 1.00164.45 O ANISOU 6618 O GLU D 62 23293 21165 18026 3690 2026 -3021 O ATOM 6619 CB GLU D 62 141.649 204.034 142.249 1.00174.35 C ANISOU 6619 CB GLU D 62 25136 21905 19203 4525 2893 -3488 C ATOM 6620 N THR D 63 143.538 203.764 139.735 1.00161.53 N ANISOU 6620 N THR D 63 22916 20204 18255 3635 1887 -3238 N ATOM 6621 CA THR D 63 143.862 203.250 138.399 1.00156.07 C ANISOU 6621 CA THR D 63 21814 19545 17940 3315 1659 -2939 C ATOM 6622 C THR D 63 145.334 202.808 138.341 1.00157.11 C ANISOU 6622 C THR D 63 21980 19791 17926 2956 1254 -3028 C ATOM 6623 O THR D 63 145.630 201.778 137.730 1.00153.09 O ANISOU 6623 O THR D 63 21164 19491 17512 2756 1167 -2756 O ATOM 6624 CB THR D 63 143.540 204.311 137.332 1.00164.43 C ANISOU 6624 CB THR D 63 22802 20222 19452 3279 1596 -2919 C ATOM 6625 OG1 THR D 63 142.198 204.759 137.517 1.00168.58 O ANISOU 6625 OG1 THR D 63 23284 20631 20139 3657 1950 -2871 O ATOM 6626 CG2 THR D 63 143.696 203.788 135.908 1.00158.21 C ANISOU 6626 CG2 THR D 63 21660 19452 18999 3003 1414 -2586 C ATOM 6627 N PHE D 64 146.241 203.577 138.990 1.00155.71 N ANISOU 6627 N PHE D 64 22155 19457 17550 2881 1002 -3424 N ATOM 6628 CA PHE D 64 147.682 203.310 139.054 1.00154.21 C ANISOU 6628 CA PHE D 64 21973 19331 17289 2558 581 -3573 C ATOM 6629 C PHE D 64 147.972 201.987 139.773 1.00154.80 C ANISOU 6629 C PHE D 64 22011 19816 16992 2604 537 -3448 C ATOM 6630 O PHE D 64 148.793 201.212 139.284 1.00151.45 O ANISOU 6630 O PHE D 64 21321 19533 16691 2342 313 -3306 O ATOM 6631 CB PHE D 64 148.427 204.471 139.745 1.00160.76 C ANISOU 6631 CB PHE D 64 23195 19880 18004 2512 309 -4066 C ATOM 6632 CG PHE D 64 149.925 204.305 139.867 1.00162.80 C ANISOU 6632 CG PHE D 64 23414 20165 18278 2179 -169 -4268 C ATOM 6633 CD1 PHE D 64 150.760 204.571 138.789 1.00163.99 C ANISOU 6633 CD1 PHE D 64 23285 20110 18914 1793 -354 -4227 C ATOM 6634 CD2 PHE D 64 150.501 203.913 141.071 1.00168.05 C ANISOU 6634 CD2 PHE D 64 24331 21036 18485 2264 -434 -4503 C ATOM 6635 CE1 PHE D 64 152.144 204.417 138.903 1.00165.87 C ANISOU 6635 CE1 PHE D 64 23406 20354 19262 1486 -768 -4418 C ATOM 6636 CE2 PHE D 64 151.886 203.759 141.183 1.00171.83 C ANISOU 6636 CE2 PHE D 64 24708 21528 19050 1970 -932 -4696 C ATOM 6637 CZ PHE D 64 152.698 204.018 140.101 1.00167.92 C ANISOU 6637 CZ PHE D 64 23852 20828 19124 1577 -1084 -4659 C ATOM 6638 N GLU D 65 147.305 201.732 140.918 1.00152.33 N ANISOU 6638 N GLU D 65 21983 19668 16226 2946 783 -3490 N ATOM 6639 CA GLU D 65 147.486 200.507 141.699 1.00151.24 C ANISOU 6639 CA GLU D 65 21900 19888 15677 3040 787 -3345 C ATOM 6640 C GLU D 65 146.850 199.307 140.983 1.00149.52 C ANISOU 6640 C GLU D 65 21240 19885 15687 3012 1059 -2864 C ATOM 6641 O GLU D 65 147.390 198.202 141.062 1.00147.07 O ANISOU 6641 O GLU D 65 20803 19812 15264 2913 927 -2685 O ATOM 6642 CB GLU D 65 146.926 200.672 143.124 1.00157.56 C ANISOU 6642 CB GLU D 65 23221 20755 15888 3428 1034 -3526 C ATOM 6643 CG GLU D 65 147.453 199.664 144.137 1.00165.17 C ANISOU 6643 CG GLU D 65 24437 22021 16298 3520 893 -3484 C ATOM 6644 CD GLU D 65 148.961 199.509 144.231 1.00173.04 C ANISOU 6644 CD GLU D 65 25449 23062 17237 3259 234 -3678 C ATOM 6645 OE1 GLU D 65 149.677 200.536 144.295 1.00152.48 O ANISOU 6645 OE1 GLU D 65 23006 20224 14707 3124 -145 -4080 O ATOM 6646 OE2 GLU D 65 149.425 198.347 144.242 1.00164.91 O ANISOU 6646 OE2 GLU D 65 24244 22280 16134 3191 97 -3428 O ATOM 6647 N LYS D 66 145.727 199.534 140.265 1.00144.26 N ANISOU 6647 N LYS D 66 20331 19108 15373 3097 1399 -2669 N ATOM 6648 CA LYS D 66 145.041 198.507 139.473 1.00140.51 C ANISOU 6648 CA LYS D 66 19414 18781 15193 3048 1611 -2250 C ATOM 6649 C LYS D 66 145.952 198.046 138.329 1.00140.67 C ANISOU 6649 C LYS D 66 19132 18806 15508 2672 1270 -2125 C ATOM 6650 O LYS D 66 145.975 196.856 137.993 1.00137.65 O ANISOU 6650 O LYS D 66 18491 18623 15186 2575 1299 -1846 O ATOM 6651 CB LYS D 66 143.712 199.044 138.922 1.00143.24 C ANISOU 6651 CB LYS D 66 19563 18956 15905 3220 1935 -2131 C ATOM 6652 CG LYS D 66 142.533 198.862 139.862 1.00161.29 C ANISOU 6652 CG LYS D 66 21924 21327 18031 3590 2446 -2064 C ATOM 6653 CD LYS D 66 141.261 199.444 139.267 1.00173.15 C ANISOU 6653 CD LYS D 66 23152 22634 20003 3763 2717 -1962 C ATOM 6654 N SER D 67 146.723 199.005 137.765 1.00137.20 N ANISOU 6654 N SER D 67 18755 18122 15255 2463 982 -2343 N ATOM 6655 CA SER D 67 147.702 198.829 136.692 1.00133.92 C ANISOU 6655 CA SER D 67 18119 17639 15126 2102 708 -2285 C ATOM 6656 C SER D 67 148.997 198.197 137.217 1.00138.74 C ANISOU 6656 C SER D 67 18746 18417 15553 1946 412 -2392 C ATOM 6657 O SER D 67 149.624 197.427 136.494 1.00135.73 O ANISOU 6657 O SER D 67 18097 18112 15361 1716 307 -2226 O ATOM 6658 CB SER D 67 148.010 200.175 136.040 1.00137.62 C ANISOU 6658 CB SER D 67 18691 17739 15859 1960 583 -2481 C ATOM 6659 OG SER D 67 149.120 200.109 135.161 1.00142.18 O ANISOU 6659 OG SER D 67 19117 18222 16683 1604 362 -2471 O ATOM 6660 N ARG D 68 149.397 198.535 138.463 1.00139.23 N ANISOU 6660 N ARG D 68 19133 18518 15251 2085 262 -2681 N ATOM 6661 CA ARG D 68 150.602 198.038 139.140 1.00140.28 C ANISOU 6661 CA ARG D 68 19321 18798 15182 1994 -105 -2825 C ATOM 6662 C ARG D 68 150.522 196.523 139.357 1.00142.39 C ANISOU 6662 C ARG D 68 19437 19384 15279 2071 -19 -2503 C ATOM 6663 O ARG D 68 151.442 195.807 138.968 1.00140.23 O ANISOU 6663 O ARG D 68 18915 19191 15175 1869 -242 -2419 O ATOM 6664 CB ARG D 68 150.793 198.772 140.485 1.00145.42 C ANISOU 6664 CB ARG D 68 20445 19410 15399 2194 -287 -3208 C ATOM 6665 CG ARG D 68 152.172 198.633 141.109 1.00156.31 C ANISOU 6665 CG ARG D 68 21892 20845 16653 2067 -819 -3461 C ATOM 6666 CD ARG D 68 152.267 199.404 142.417 1.00170.51 C ANISOU 6666 CD ARG D 68 24229 22582 17973 2279 -1032 -3869 C ATOM 6667 NE ARG D 68 153.345 198.898 143.262 1.00181.44 N ANISOU 6667 NE ARG D 68 25732 24125 19082 2275 -1548 -4029 N ATOM 6668 CZ ARG D 68 153.201 197.936 144.167 1.00197.15 C ANISOU 6668 CZ ARG D 68 27963 26400 20545 2538 -1553 -3874 C ATOM 6669 NH1 ARG D 68 152.015 197.369 144.358 1.00183.55 N ANISOU 6669 NH1 ARG D 68 26368 24828 18545 2802 -1009 -3559 N ATOM 6670 NH2 ARG D 68 154.239 197.526 144.880 1.00187.08 N ANISOU 6670 NH2 ARG D 68 26793 25242 19046 2540 -2101 -4020 N ATOM 6671 N LEU D 69 149.415 196.037 139.936 1.00139.49 N ANISOU 6671 N LEU D 69 19202 19168 14631 2359 344 -2314 N ATOM 6672 CA LEU D 69 149.200 194.617 140.214 1.00137.97 C ANISOU 6672 CA LEU D 69 18908 19236 14277 2450 495 -1987 C ATOM 6673 C LEU D 69 148.979 193.809 138.929 1.00135.49 C ANISOU 6673 C LEU D 69 18133 18937 14409 2242 624 -1663 C ATOM 6674 O LEU D 69 149.442 192.670 138.861 1.00133.59 O ANISOU 6674 O LEU D 69 17735 18848 14174 2172 553 -1466 O ATOM 6675 CB LEU D 69 148.017 194.433 141.175 1.00141.05 C ANISOU 6675 CB LEU D 69 19571 19729 14293 2802 929 -1877 C ATOM 6676 CG LEU D 69 148.180 195.082 142.550 1.00151.70 C ANISOU 6676 CG LEU D 69 21482 21080 15076 3056 849 -2187 C ATOM 6677 CD1 LEU D 69 146.837 195.454 143.146 1.00155.05 C ANISOU 6677 CD1 LEU D 69 22143 21471 15299 3377 1395 -2158 C ATOM 6678 CD2 LEU D 69 148.984 194.200 143.488 1.00157.05 C ANISOU 6678 CD2 LEU D 69 22409 21967 15295 3141 582 -2152 C ATOM 6679 N TYR D 70 148.281 194.389 137.918 1.00128.87 N ANISOU 6679 N TYR D 70 17113 17924 13926 2159 787 -1613 N ATOM 6680 CA TYR D 70 148.020 193.732 136.630 1.00124.28 C ANISOU 6680 CA TYR D 70 16164 17325 13731 1967 866 -1343 C ATOM 6681 C TYR D 70 149.329 193.442 135.897 1.00125.18 C ANISOU 6681 C TYR D 70 16117 17404 14040 1665 571 -1379 C ATOM 6682 O TYR D 70 149.520 192.320 135.423 1.00122.62 O ANISOU 6682 O TYR D 70 15575 17186 13829 1560 594 -1160 O ATOM 6683 CB TYR D 70 147.072 194.576 135.749 1.00124.69 C ANISOU 6683 CB TYR D 70 16131 17169 14075 1971 1010 -1319 C ATOM 6684 CG TYR D 70 146.893 194.089 134.321 1.00122.86 C ANISOU 6684 CG TYR D 70 15607 16875 14197 1760 997 -1096 C ATOM 6685 CD1 TYR D 70 146.401 192.813 134.051 1.00123.11 C ANISOU 6685 CD1 TYR D 70 15405 17058 14313 1748 1130 -819 C ATOM 6686 CD2 TYR D 70 147.147 194.928 133.242 1.00122.72 C ANISOU 6686 CD2 TYR D 70 15596 16619 14415 1585 866 -1162 C ATOM 6687 CE1 TYR D 70 146.205 192.371 132.743 1.00121.41 C ANISOU 6687 CE1 TYR D 70 14978 16770 14383 1563 1085 -650 C ATOM 6688 CE2 TYR D 70 146.956 194.497 131.929 1.00121.36 C ANISOU 6688 CE2 TYR D 70 15247 16378 14485 1416 846 -965 C ATOM 6689 CZ TYR D 70 146.485 193.217 131.684 1.00127.60 C ANISOU 6689 CZ TYR D 70 15818 17333 15332 1407 935 -726 C ATOM 6690 OH TYR D 70 146.295 192.789 130.393 1.00127.85 O ANISOU 6690 OH TYR D 70 15729 17284 15565 1245 879 -567 O ATOM 6691 N GLN D 71 150.233 194.436 135.831 1.00122.38 N ANISOU 6691 N GLN D 71 15861 16881 13756 1525 322 -1662 N ATOM 6692 CA GLN D 71 151.529 194.292 135.167 1.00120.99 C ANISOU 6692 CA GLN D 71 15501 16634 13835 1232 91 -1723 C ATOM 6693 C GLN D 71 152.464 193.388 135.978 1.00126.15 C ANISOU 6693 C GLN D 71 16108 17490 14334 1258 -135 -1743 C ATOM 6694 O GLN D 71 153.355 192.763 135.399 1.00124.00 O ANISOU 6694 O GLN D 71 15585 17224 14306 1064 -237 -1681 O ATOM 6695 CB GLN D 71 152.179 195.662 134.912 1.00123.99 C ANISOU 6695 CB GLN D 71 15975 16735 14399 1064 -74 -2019 C ATOM 6696 CG GLN D 71 151.413 196.584 133.945 1.00136.77 C ANISOU 6696 CG GLN D 71 17651 18099 16214 1020 115 -1973 C ATOM 6697 CD GLN D 71 151.238 196.051 132.542 1.00151.85 C ANISOU 6697 CD GLN D 71 19368 19958 18371 850 262 -1701 C ATOM 6698 OE1 GLN D 71 152.104 195.361 131.989 1.00148.12 O ANISOU 6698 OE1 GLN D 71 18709 19518 18053 644 222 -1632 O ATOM 6699 NE2 GLN D 71 150.123 196.408 131.917 1.00140.70 N ANISOU 6699 NE2 GLN D 71 18012 18441 17007 945 421 -1558 N ATOM 6700 N LEU D 72 152.243 193.302 137.308 1.00126.28 N ANISOU 6700 N LEU D 72 16389 17658 13932 1520 -200 -1819 N ATOM 6701 CA LEU D 72 153.021 192.449 138.206 1.00128.21 C ANISOU 6701 CA LEU D 72 16673 18095 13947 1613 -454 -1813 C ATOM 6702 C LEU D 72 152.675 190.969 137.967 1.00131.52 C ANISOU 6702 C LEU D 72 16910 18684 14376 1662 -242 -1435 C ATOM 6703 O LEU D 72 153.587 190.144 137.876 1.00131.55 O ANISOU 6703 O LEU D 72 16724 18754 14504 1581 -436 -1366 O ATOM 6704 CB LEU D 72 152.783 192.836 139.672 1.00132.26 C ANISOU 6704 CB LEU D 72 17632 18697 13925 1905 -559 -1992 C ATOM 6705 CG LEU D 72 153.793 192.302 140.670 1.00139.82 C ANISOU 6705 CG LEU D 72 18721 19799 14607 2003 -984 -2084 C ATOM 6706 CD1 LEU D 72 155.085 193.101 140.630 1.00141.73 C ANISOU 6706 CD1 LEU D 72 18858 19892 15100 1791 -1486 -2454 C ATOM 6707 CD2 LEU D 72 153.208 192.298 142.059 1.00147.13 C ANISOU 6707 CD2 LEU D 72 20170 20855 14879 2358 -933 -2116 C ATOM 6708 N ASP D 73 151.365 190.643 137.839 1.00126.82 N ANISOU 6708 N ASP D 73 16343 18132 13713 1787 156 -1200 N ATOM 6709 CA ASP D 73 150.864 189.290 137.566 1.00124.59 C ANISOU 6709 CA ASP D 73 15884 17961 13493 1812 398 -847 C ATOM 6710 C ASP D 73 151.298 188.830 136.181 1.00124.60 C ANISOU 6710 C ASP D 73 15537 17868 13937 1530 381 -751 C ATOM 6711 O ASP D 73 151.587 187.645 135.987 1.00123.59 O ANISOU 6711 O ASP D 73 15251 17810 13898 1494 402 -552 O ATOM 6712 CB ASP D 73 149.331 189.250 137.673 1.00126.74 C ANISOU 6712 CB ASP D 73 16204 18247 13702 1974 820 -668 C ATOM 6713 CG ASP D 73 148.776 189.252 139.085 1.00146.86 C ANISOU 6713 CG ASP D 73 19106 20913 15781 2290 997 -653 C ATOM 6714 OD1 ASP D 73 149.477 189.741 140.003 1.00151.93 O ANISOU 6714 OD1 ASP D 73 20062 21593 16073 2403 738 -881 O ATOM 6715 OD2 ASP D 73 147.621 188.810 139.266 1.00155.22 O ANISOU 6715 OD2 ASP D 73 20140 22007 16831 2425 1404 -429 O ATOM 6716 N LYS D 74 151.348 189.780 135.221 1.00118.76 N ANISOU 6716 N LYS D 74 14723 16945 13455 1343 360 -893 N ATOM 6717 CA LYS D 74 151.766 189.543 133.844 1.00115.27 C ANISOU 6717 CA LYS D 74 14046 16376 13376 1077 376 -832 C ATOM 6718 C LYS D 74 153.267 189.210 133.804 1.00118.84 C ANISOU 6718 C LYS D 74 14350 16823 13981 934 141 -936 C ATOM 6719 O LYS D 74 153.656 188.286 133.089 1.00116.90 O ANISOU 6719 O LYS D 74 13905 16571 13942 814 206 -795 O ATOM 6720 CB LYS D 74 151.433 190.760 132.962 1.00116.72 C ANISOU 6720 CB LYS D 74 14282 16343 13723 953 420 -947 C ATOM 6721 N SER D 75 154.088 189.923 134.615 1.00117.24 N ANISOU 6721 N SER D 75 14234 16615 13697 960 -142 -1193 N ATOM 6722 CA SER D 75 155.543 189.743 134.722 1.00118.21 C ANISOU 6722 CA SER D 75 14162 16721 14031 840 -430 -1334 C ATOM 6723 C SER D 75 155.906 188.360 135.290 1.00121.11 C ANISOU 6723 C SER D 75 14435 17273 14307 986 -522 -1150 C ATOM 6724 O SER D 75 156.817 187.709 134.769 1.00120.60 O ANISOU 6724 O SER D 75 14089 17173 14562 861 -574 -1111 O ATOM 6725 CB SER D 75 156.157 190.843 135.585 1.00125.42 C ANISOU 6725 CB SER D 75 15212 17581 14861 858 -769 -1670 C ATOM 6726 OG SER D 75 157.573 190.786 135.594 1.00136.25 O ANISOU 6726 OG SER D 75 16317 18898 16552 709 -1076 -1835 O ATOM 6727 N THR D 76 155.183 187.917 136.343 1.00117.25 N ANISOU 6727 N THR D 76 14198 16957 13393 1262 -502 -1024 N ATOM 6728 CA THR D 76 155.384 186.623 137.002 1.00117.67 C ANISOU 6728 CA THR D 76 14255 17166 13290 1443 -565 -807 C ATOM 6729 C THR D 76 155.129 185.488 136.008 1.00117.94 C ANISOU 6729 C THR D 76 14048 17165 13599 1338 -273 -531 C ATOM 6730 O THR D 76 155.959 184.579 135.901 1.00117.59 O ANISOU 6730 O THR D 76 13809 17127 13745 1327 -383 -446 O ATOM 6731 CB THR D 76 154.484 186.493 138.243 1.00129.11 C ANISOU 6731 CB THR D 76 16094 18763 14198 1750 -482 -701 C ATOM 6732 OG1 THR D 76 154.418 187.739 138.936 1.00133.22 O ANISOU 6732 OG1 THR D 76 16895 19269 14455 1826 -646 -990 O ATOM 6733 CG2 THR D 76 154.954 185.399 139.192 1.00130.77 C ANISOU 6733 CG2 THR D 76 16418 19111 14159 1972 -666 -528 C ATOM 6734 N PHE D 77 153.993 185.562 135.266 1.00111.97 N ANISOU 6734 N PHE D 77 13304 16352 12888 1265 72 -411 N ATOM 6735 CA PHE D 77 153.606 184.576 134.253 1.00109.14 C ANISOU 6735 CA PHE D 77 12764 15932 12774 1147 326 -190 C ATOM 6736 C PHE D 77 154.618 184.567 133.119 1.00111.16 C ANISOU 6736 C PHE D 77 12782 16043 13412 902 281 -293 C ATOM 6737 O PHE D 77 155.044 183.489 132.702 1.00109.52 O ANISOU 6737 O PHE D 77 12414 15807 13392 863 344 -164 O ATOM 6738 CB PHE D 77 152.188 184.846 133.711 1.00109.25 C ANISOU 6738 CB PHE D 77 12833 15899 12780 1120 606 -94 C ATOM 6739 CG PHE D 77 151.767 183.937 132.572 1.00108.85 C ANISOU 6739 CG PHE D 77 12618 15755 12986 970 797 79 C ATOM 6740 CD1 PHE D 77 151.292 182.652 132.822 1.00112.41 C ANISOU 6740 CD1 PHE D 77 13021 16249 13440 1049 950 326 C ATOM 6741 CD2 PHE D 77 151.839 184.368 131.253 1.00109.30 C ANISOU 6741 CD2 PHE D 77 12612 15655 13261 751 824 -7 C ATOM 6742 CE1 PHE D 77 150.906 181.812 131.769 1.00111.59 C ANISOU 6742 CE1 PHE D 77 12786 16032 13584 897 1091 446 C ATOM 6743 CE2 PHE D 77 151.458 183.527 130.203 1.00110.63 C ANISOU 6743 CE2 PHE D 77 12696 15726 13612 622 959 121 C ATOM 6744 CZ PHE D 77 150.997 182.255 130.468 1.00108.83 C ANISOU 6744 CZ PHE D 77 12398 15541 13412 689 1074 328 C ATOM 6745 N SER D 78 155.007 185.771 132.639 1.00108.04 N ANISOU 6745 N SER D 78 12382 15529 13139 744 211 -522 N ATOM 6746 CA SER D 78 155.975 185.989 131.560 1.00107.39 C ANISOU 6746 CA SER D 78 12110 15274 13420 497 241 -635 C ATOM 6747 C SER D 78 157.287 185.245 131.819 1.00111.26 C ANISOU 6747 C SER D 78 12345 15784 14146 502 83 -662 C ATOM 6748 O SER D 78 157.865 184.696 130.877 1.00110.23 O ANISOU 6748 O SER D 78 12027 15535 14320 358 248 -626 O ATOM 6749 CB SER D 78 156.253 187.481 131.386 1.00112.87 C ANISOU 6749 CB SER D 78 12870 15833 14182 365 162 -877 C ATOM 6750 OG SER D 78 157.125 187.740 130.298 1.00123.89 O ANISOU 6750 OG SER D 78 14110 17029 15935 113 279 -960 O ATOM 6751 N PHE D 79 157.731 185.199 133.095 1.00108.92 N ANISOU 6751 N PHE D 79 12061 15626 13699 690 -240 -722 N ATOM 6752 CA PHE D 79 158.959 184.518 133.488 1.00110.56 C ANISOU 6752 CA PHE D 79 12012 15858 14138 747 -485 -746 C ATOM 6753 C PHE D 79 158.846 182.996 133.347 1.00112.26 C ANISOU 6753 C PHE D 79 12153 16110 14389 859 -332 -470 C ATOM 6754 O PHE D 79 159.637 182.409 132.610 1.00111.18 O ANISOU 6754 O PHE D 79 11742 15859 14641 757 -233 -460 O ATOM 6755 CB PHE D 79 159.373 184.880 134.926 1.00115.86 C ANISOU 6755 CB PHE D 79 12792 16665 14566 949 -947 -883 C ATOM 6756 CG PHE D 79 160.477 183.997 135.465 1.00120.15 C ANISOU 6756 CG PHE D 79 13099 17256 15297 1084 -1267 -849 C ATOM 6757 CD1 PHE D 79 161.760 184.058 134.936 1.00124.53 C ANISOU 6757 CD1 PHE D 79 13221 17677 16417 921 -1386 -1006 C ATOM 6758 CD2 PHE D 79 160.224 183.079 136.476 1.00123.90 C ANISOU 6758 CD2 PHE D 79 13775 17886 15416 1385 -1423 -640 C ATOM 6759 CE1 PHE D 79 162.771 183.225 135.415 1.00128.63 C ANISOU 6759 CE1 PHE D 79 13471 18227 17177 1073 -1703 -970 C ATOM 6760 CE2 PHE D 79 161.239 182.246 136.955 1.00129.73 C ANISOU 6760 CE2 PHE D 79 14307 18649 16336 1542 -1755 -585 C ATOM 6761 CZ PHE D 79 162.505 182.330 136.427 1.00129.25 C ANISOU 6761 CZ PHE D 79 13774 18462 16871 1393 -1918 -759 C ATOM 6762 N TRP D 80 157.900 182.369 134.086 1.00108.00 N ANISOU 6762 N TRP D 80 11862 15705 13469 1074 -287 -253 N ATOM 6763 CA TRP D 80 157.694 180.919 134.118 1.00107.43 C ANISOU 6763 CA TRP D 80 11768 15644 13407 1196 -145 29 C ATOM 6764 C TRP D 80 157.281 180.338 132.763 1.00110.37 C ANISOU 6764 C TRP D 80 12039 15864 14032 1002 230 124 C ATOM 6765 O TRP D 80 157.752 179.250 132.416 1.00110.63 O ANISOU 6765 O TRP D 80 11920 15816 14300 1017 312 239 O ATOM 6766 CB TRP D 80 156.675 180.543 135.184 1.00106.55 C ANISOU 6766 CB TRP D 80 11972 15672 12840 1435 -106 240 C ATOM 6767 CG TRP D 80 157.161 180.818 136.570 1.00111.19 C ANISOU 6767 CG TRP D 80 12742 16398 13105 1677 -489 182 C ATOM 6768 CD1 TRP D 80 156.770 181.836 137.388 1.00115.52 C ANISOU 6768 CD1 TRP D 80 13573 17047 13272 1772 -622 36 C ATOM 6769 CD2 TRP D 80 158.162 180.086 137.287 1.00114.44 C ANISOU 6769 CD2 TRP D 80 13097 16848 13538 1872 -829 248 C ATOM 6770 NE1 TRP D 80 157.439 181.763 138.588 1.00119.12 N ANISOU 6770 NE1 TRP D 80 14199 17607 13453 2010 -1033 0 N ATOM 6771 CE2 TRP D 80 158.304 180.699 138.551 1.00121.94 C ANISOU 6771 CE2 TRP D 80 14341 17933 14057 2080 -1195 139 C ATOM 6772 CE3 TRP D 80 158.953 178.960 136.987 1.00116.61 C ANISOU 6772 CE3 TRP D 80 13112 17038 14154 1913 -875 386 C ATOM 6773 CZ2 TRP D 80 159.207 180.226 139.516 1.00125.78 C ANISOU 6773 CZ2 TRP D 80 14884 18484 14424 2327 -1659 171 C ATOM 6774 CZ3 TRP D 80 159.847 178.493 137.941 1.00122.30 C ANISOU 6774 CZ3 TRP D 80 13841 17816 14812 2166 -1309 432 C ATOM 6775 CH2 TRP D 80 159.969 179.123 139.187 1.00126.55 C ANISOU 6775 CH2 TRP D 80 14685 18500 14899 2370 -1722 329 C ATOM 6776 N SER D 81 156.427 181.054 131.993 1.00105.26 N ANISOU 6776 N SER D 81 11497 15162 13334 836 431 67 N ATOM 6777 CA SER D 81 156.028 180.615 130.651 1.00102.77 C ANISOU 6777 CA SER D 81 11151 14692 13206 648 720 120 C ATOM 6778 C SER D 81 157.236 180.707 129.707 1.00106.68 C ANISOU 6778 C SER D 81 11448 15030 14054 474 777 -35 C ATOM 6779 O SER D 81 157.411 179.842 128.848 1.00106.68 O ANISOU 6779 O SER D 81 11389 14899 14247 396 984 25 O ATOM 6780 CB SER D 81 154.853 181.435 130.125 1.00104.32 C ANISOU 6780 CB SER D 81 11521 14864 13251 549 837 95 C ATOM 6781 OG SER D 81 155.193 182.796 129.920 1.00112.97 O ANISOU 6781 OG SER D 81 12654 15920 14350 447 751 -116 O ATOM 6782 N GLY D 82 158.072 181.727 129.923 1.00102.93 N ANISOU 6782 N GLY D 82 10874 14552 13682 418 610 -239 N ATOM 6783 CA GLY D 82 159.295 181.959 129.167 1.00103.21 C ANISOU 6783 CA GLY D 82 10673 14428 14113 249 693 -396 C ATOM 6784 C GLY D 82 160.387 180.974 129.528 1.00107.34 C ANISOU 6784 C GLY D 82 10895 14946 14943 365 597 -365 C ATOM 6785 O GLY D 82 161.121 180.513 128.646 1.00107.79 O ANISOU 6785 O GLY D 82 10764 14839 15352 260 836 -395 O ATOM 6786 N LEU D 83 160.495 180.641 130.835 1.00103.41 N ANISOU 6786 N LEU D 83 10376 14616 14300 605 252 -299 N ATOM 6787 CA LEU D 83 161.483 179.701 131.366 1.00105.04 C ANISOU 6787 CA LEU D 83 10315 14828 14766 781 60 -242 C ATOM 6788 C LEU D 83 161.196 178.294 130.861 1.00108.26 C ANISOU 6788 C LEU D 83 10742 15148 15244 845 339 -20 C ATOM 6789 O LEU D 83 162.138 177.608 130.454 1.00109.45 O ANISOU 6789 O LEU D 83 10612 15168 15807 860 420 -30 O ATOM 6790 CB LEU D 83 161.515 179.744 132.907 1.00106.92 C ANISOU 6790 CB LEU D 83 10655 15262 14707 1047 -408 -204 C ATOM 6791 CG LEU D 83 162.472 178.801 133.639 1.00114.28 C ANISOU 6791 CG LEU D 83 11368 16215 15838 1292 -721 -115 C ATOM 6792 CD1 LEU D 83 163.924 179.068 133.274 1.00117.02 C ANISOU 6792 CD1 LEU D 83 11225 16440 16798 1194 -865 -334 C ATOM 6793 CD2 LEU D 83 162.277 178.900 135.131 1.00118.67 C ANISOU 6793 CD2 LEU D 83 12186 16964 15939 1565 -1168 -55 C ATOM 6794 N TYR D 84 159.901 177.882 130.854 1.00102.67 N ANISOU 6794 N TYR D 84 10341 14484 14187 873 503 163 N ATOM 6795 CA TYR D 84 159.461 176.569 130.374 1.00101.77 C ANISOU 6795 CA TYR D 84 10283 14255 14131 903 762 361 C ATOM 6796 C TYR D 84 159.857 176.391 128.907 1.00105.89 C ANISOU 6796 C TYR D 84 10709 14558 14968 687 1098 244 C ATOM 6797 O TYR D 84 160.387 175.339 128.548 1.00107.07 O ANISOU 6797 O TYR D 84 10731 14560 15390 741 1243 301 O ATOM 6798 CB TYR D 84 157.943 176.381 130.565 1.00100.72 C ANISOU 6798 CB TYR D 84 10448 14186 13635 913 877 535 C ATOM 6799 CG TYR D 84 157.421 175.030 130.108 1.00102.45 C ANISOU 6799 CG TYR D 84 10720 14256 13949 915 1119 724 C ATOM 6800 CD1 TYR D 84 157.529 173.903 130.923 1.00106.52 C ANISOU 6800 CD1 TYR D 84 11236 14759 14477 1136 1068 954 C ATOM 6801 CD2 TYR D 84 156.791 174.883 128.874 1.00101.30 C ANISOU 6801 CD2 TYR D 84 10663 13960 13867 700 1377 672 C ATOM 6802 CE1 TYR D 84 157.045 172.659 130.510 1.00107.05 C ANISOU 6802 CE1 TYR D 84 11357 14646 14672 1121 1300 1120 C ATOM 6803 CE2 TYR D 84 156.298 173.645 128.453 1.00102.16 C ANISOU 6803 CE2 TYR D 84 10830 13903 14083 681 1565 809 C ATOM 6804 CZ TYR D 84 156.423 172.536 129.276 1.00110.39 C ANISOU 6804 CZ TYR D 84 11841 14916 15188 882 1543 1030 C ATOM 6805 OH TYR D 84 155.935 171.316 128.870 1.00109.58 O ANISOU 6805 OH TYR D 84 11799 14608 15229 848 1737 1158 O ATOM 6806 N SER D 85 159.636 177.434 128.082 1.00101.09 N ANISOU 6806 N SER D 85 10195 13907 14307 464 1232 81 N ATOM 6807 CA SER D 85 159.962 177.456 126.658 1.00100.75 C ANISOU 6807 CA SER D 85 10171 13652 14459 255 1577 -35 C ATOM 6808 C SER D 85 161.464 177.290 126.433 1.00106.77 C ANISOU 6808 C SER D 85 10585 14290 15693 255 1672 -153 C ATOM 6809 O SER D 85 161.863 176.428 125.650 1.00107.28 O ANISOU 6809 O SER D 85 10607 14170 15984 238 1968 -151 O ATOM 6810 CB SER D 85 159.479 178.756 126.022 1.00103.80 C ANISOU 6810 CB SER D 85 10762 14023 14656 55 1643 -157 C ATOM 6811 OG SER D 85 158.117 179.008 126.323 1.00112.83 O ANISOU 6811 OG SER D 85 12154 15284 15432 82 1525 -59 O ATOM 6812 N GLU D 86 162.291 178.084 127.149 1.00104.64 N ANISOU 6812 N GLU D 86 10050 14106 15603 284 1413 -269 N ATOM 6813 CA GLU D 86 163.751 178.042 127.038 1.00107.77 C ANISOU 6813 CA GLU D 86 10014 14386 16548 281 1455 -397 C ATOM 6814 C GLU D 86 164.297 176.694 127.497 1.00112.84 C ANISOU 6814 C GLU D 86 10425 15001 17447 528 1372 -270 C ATOM 6815 O GLU D 86 165.250 176.199 126.891 1.00115.38 O ANISOU 6815 O GLU D 86 10461 15136 18241 521 1629 -333 O ATOM 6816 CB GLU D 86 164.405 179.189 127.829 1.00111.29 C ANISOU 6816 CB GLU D 86 10219 14929 17139 254 1093 -562 C ATOM 6817 CG GLU D 86 165.879 179.427 127.505 1.00126.27 C ANISOU 6817 CG GLU D 86 11616 16661 19699 164 1189 -739 C ATOM 6818 CD GLU D 86 166.215 179.845 126.084 1.00149.96 C ANISOU 6818 CD GLU D 86 14627 19413 22940 -109 1770 -843 C ATOM 6819 OE1 GLU D 86 165.715 180.901 125.631 1.00153.67 O ANISOU 6819 OE1 GLU D 86 15370 19850 23168 -315 1894 -908 O ATOM 6820 OE2 GLU D 86 167.005 179.126 125.432 1.00143.16 O ANISOU 6820 OE2 GLU D 86 13516 18369 22508 -102 2121 -855 O ATOM 6821 N THR D 87 163.687 176.094 128.544 1.00107.34 N ANISOU 6821 N THR D 87 9870 14466 16449 756 1055 -79 N ATOM 6822 CA THR D 87 164.097 174.782 129.048 1.00108.67 C ANISOU 6822 CA THR D 87 9891 14589 16809 1019 956 90 C ATOM 6823 C THR D 87 163.708 173.717 128.023 1.00110.22 C ANISOU 6823 C THR D 87 10244 14574 17062 969 1409 174 C ATOM 6824 O THR D 87 164.544 172.882 127.685 1.00112.32 O ANISOU 6824 O THR D 87 10265 14657 17754 1066 1572 172 O ATOM 6825 CB THR D 87 163.506 174.512 130.435 1.00114.98 C ANISOU 6825 CB THR D 87 10884 15593 17210 1267 542 293 C ATOM 6826 OG1 THR D 87 163.851 175.596 131.295 1.00114.81 O ANISOU 6826 OG1 THR D 87 10785 15749 17087 1293 122 159 O ATOM 6827 CG2 THR D 87 163.999 173.207 131.043 1.00116.19 C ANISOU 6827 CG2 THR D 87 10913 15680 17553 1569 395 498 C ATOM 6828 N GLU D 88 162.465 173.779 127.498 1.00102.82 N ANISOU 6828 N GLU D 88 9698 13639 15730 819 1600 222 N ATOM 6829 CA GLU D 88 161.961 172.840 126.497 1.00101.72 C ANISOU 6829 CA GLU D 88 9769 13289 15592 740 1971 263 C ATOM 6830 C GLU D 88 162.828 172.814 125.249 1.00106.08 C ANISOU 6830 C GLU D 88 10212 13606 16487 605 2374 71 C ATOM 6831 O GLU D 88 163.196 171.730 124.800 1.00107.59 O ANISOU 6831 O GLU D 88 10363 13585 16930 684 2615 91 O ATOM 6832 CB GLU D 88 160.516 173.157 126.104 1.00100.10 C ANISOU 6832 CB GLU D 88 9953 13133 14947 572 2027 297 C ATOM 6833 CG GLU D 88 159.494 172.345 126.875 1.00112.29 C ANISOU 6833 CG GLU D 88 11654 14737 16275 701 1896 537 C ATOM 6834 CD GLU D 88 159.322 170.878 126.515 1.00133.89 C ANISOU 6834 CD GLU D 88 14458 17239 19175 753 2095 650 C ATOM 6835 OE1 GLU D 88 160.193 170.300 125.826 1.00118.00 O ANISOU 6835 OE1 GLU D 88 12336 15016 17483 764 2315 552 O ATOM 6836 OE2 GLU D 88 158.300 170.301 126.946 1.00134.22 O ANISOU 6836 OE2 GLU D 88 14660 17287 19049 784 2057 835 O ATOM 6837 N GLY D 89 163.153 173.994 124.719 1.00101.50 N ANISOU 6837 N GLY D 89 9607 13039 15920 412 2480 -106 N ATOM 6838 CA GLY D 89 163.987 174.146 123.533 1.00103.02 C ANISOU 6838 CA GLY D 89 9732 13000 16409 266 2935 -282 C ATOM 6839 C GLY D 89 165.331 173.477 123.709 1.00110.17 C ANISOU 6839 C GLY D 89 10167 13777 17918 433 3035 -315 C ATOM 6840 O GLY D 89 165.720 172.637 122.893 1.00111.66 O ANISOU 6840 O GLY D 89 10373 13722 18332 455 3443 -358 O ATOM 6841 N THR D 90 166.004 173.798 124.828 1.00107.71 N ANISOU 6841 N THR D 90 9444 13620 17864 577 2625 -299 N ATOM 6842 CA THR D 90 167.305 173.256 125.210 1.00111.42 C ANISOU 6842 CA THR D 90 9374 13996 18964 775 2569 -322 C ATOM 6843 C THR D 90 167.209 171.728 125.351 1.00117.25 C ANISOU 6843 C THR D 90 10156 14613 19783 1026 2609 -153 C ATOM 6844 O THR D 90 168.021 171.034 124.749 1.00119.88 O ANISOU 6844 O THR D 90 10259 14702 20588 1100 2964 -214 O ATOM 6845 CB THR D 90 167.806 173.947 126.489 1.00113.85 C ANISOU 6845 CB THR D 90 9332 14523 19403 884 1970 -335 C ATOM 6846 OG1 THR D 90 167.883 175.349 126.248 1.00108.30 O ANISOU 6846 OG1 THR D 90 8613 13874 18664 622 1991 -512 O ATOM 6847 CG2 THR D 90 169.163 173.451 126.933 1.00116.53 C ANISOU 6847 CG2 THR D 90 9062 14772 20442 1102 1806 -366 C ATOM 6848 N LEU D 91 166.194 171.216 126.083 1.00112.64 N ANISOU 6848 N LEU D 91 9883 14161 18754 1147 2311 57 N ATOM 6849 CA LEU D 91 165.998 169.780 126.313 1.00114.15 C ANISOU 6849 CA LEU D 91 10159 14214 19000 1376 2330 251 C ATOM 6850 C LEU D 91 165.718 169.001 125.026 1.00118.07 C ANISOU 6850 C LEU D 91 10916 14418 19527 1260 2880 180 C ATOM 6851 O LEU D 91 166.293 167.929 124.863 1.00121.01 O ANISOU 6851 O LEU D 91 11144 14556 20277 1443 3060 214 O ATOM 6852 CB LEU D 91 164.880 169.499 127.333 1.00112.42 C ANISOU 6852 CB LEU D 91 10254 14176 18284 1484 1972 501 C ATOM 6853 CG LEU D 91 165.150 169.869 128.797 1.00119.13 C ANISOU 6853 CG LEU D 91 10947 15274 19044 1705 1399 624 C ATOM 6854 CD1 LEU D 91 163.920 169.667 129.624 1.00117.54 C ANISOU 6854 CD1 LEU D 91 11145 15223 18291 1771 1207 863 C ATOM 6855 CD2 LEU D 91 166.289 169.062 129.391 1.00126.35 C ANISOU 6855 CD2 LEU D 91 11483 16085 20440 2032 1177 715 C ATOM 6856 N ILE D 92 164.860 169.523 124.120 1.00111.32 N ANISOU 6856 N ILE D 92 10461 13557 18279 980 3121 74 N ATOM 6857 CA ILE D 92 164.534 168.866 122.847 1.00111.17 C ANISOU 6857 CA ILE D 92 10780 13260 18201 854 3591 -31 C ATOM 6858 C ILE D 92 165.812 168.722 122.010 1.00119.32 C ANISOU 6858 C ILE D 92 11563 14045 19730 874 4059 -218 C ATOM 6859 O ILE D 92 166.062 167.636 121.485 1.00122.01 O ANISOU 6859 O ILE D 92 11966 14105 20285 976 4373 -248 O ATOM 6860 CB ILE D 92 163.402 169.608 122.083 1.00110.95 C ANISOU 6860 CB ILE D 92 11227 13293 17635 565 3656 -113 C ATOM 6861 CG1 ILE D 92 162.039 169.312 122.723 1.00108.56 C ANISOU 6861 CG1 ILE D 92 11171 13127 16949 567 3322 74 C ATOM 6862 CG2 ILE D 92 163.375 169.252 120.582 1.00113.11 C ANISOU 6862 CG2 ILE D 92 11862 13271 17843 412 4154 -302 C ATOM 6863 CD1 ILE D 92 161.007 170.404 122.525 1.00114.28 C ANISOU 6863 CD1 ILE D 92 12167 14035 17217 354 3175 42 C ATOM 6864 N LEU D 93 166.632 169.791 121.927 1.00116.21 N ANISOU 6864 N LEU D 93 10866 13727 19560 785 4125 -345 N ATOM 6865 CA LEU D 93 167.888 169.780 121.174 1.00119.63 C ANISOU 6865 CA LEU D 93 10993 13925 20537 788 4626 -518 C ATOM 6866 C LEU D 93 168.890 168.774 121.761 1.00126.47 C ANISOU 6866 C LEU D 93 11344 14662 22047 1112 4573 -454 C ATOM 6867 O LEU D 93 169.399 167.943 121.007 1.00128.43 O ANISOU 6867 O LEU D 93 11584 14607 22608 1197 5060 -540 O ATOM 6868 CB LEU D 93 168.514 171.181 121.121 1.00120.25 C ANISOU 6868 CB LEU D 93 10797 14109 20783 607 4661 -640 C ATOM 6869 CG LEU D 93 167.758 172.241 120.333 1.00121.99 C ANISOU 6869 CG LEU D 93 11510 14374 20465 299 4832 -718 C ATOM 6870 CD1 LEU D 93 168.173 173.615 120.770 1.00122.31 C ANISOU 6870 CD1 LEU D 93 11257 14576 20640 161 4635 -773 C ATOM 6871 CD2 LEU D 93 167.982 172.094 118.844 1.00126.85 C ANISOU 6871 CD2 LEU D 93 12470 14685 21042 161 5552 -868 C ATOM 6872 N LEU D 94 169.139 168.833 123.099 1.00123.58 N ANISOU 6872 N LEU D 94 10596 14511 21848 1312 3971 -305 N ATOM 6873 CA LEU D 94 170.070 167.955 123.826 1.00127.89 C ANISOU 6873 CA LEU D 94 10643 14963 22987 1661 3769 -208 C ATOM 6874 C LEU D 94 169.633 166.494 123.788 1.00135.72 C ANISOU 6874 C LEU D 94 11904 15744 23920 1867 3867 -57 C ATOM 6875 O LEU D 94 170.478 165.613 123.604 1.00140.64 O ANISOU 6875 O LEU D 94 12229 16102 25104 2097 4099 -71 O ATOM 6876 CB LEU D 94 170.241 168.380 125.294 1.00127.80 C ANISOU 6876 CB LEU D 94 10324 15244 22989 1829 3015 -68 C ATOM 6877 CG LEU D 94 170.851 169.741 125.600 1.00132.75 C ANISOU 6877 CG LEU D 94 10575 16057 23809 1679 2776 -224 C ATOM 6878 CD1 LEU D 94 170.749 170.030 127.077 1.00132.90 C ANISOU 6878 CD1 LEU D 94 10491 16361 23645 1858 1983 -85 C ATOM 6879 CD2 LEU D 94 172.297 169.836 125.139 1.00140.25 C ANISOU 6879 CD2 LEU D 94 10867 16798 25625 1709 3077 -407 C ATOM 6880 N PHE D 95 168.324 166.235 123.972 1.00129.81 N ANISOU 6880 N PHE D 95 11688 15086 22547 1788 3703 85 N ATOM 6881 CA PHE D 95 167.740 164.892 123.942 1.00130.71 C ANISOU 6881 CA PHE D 95 12109 14979 22574 1926 3788 232 C ATOM 6882 C PHE D 95 167.729 164.332 122.504 1.00137.75 C ANISOU 6882 C PHE D 95 13289 15523 23527 1796 4441 20 C ATOM 6883 O PHE D 95 167.692 163.114 122.324 1.00140.31 O ANISOU 6883 O PHE D 95 13738 15554 24019 1952 4619 69 O ATOM 6884 CB PHE D 95 166.319 164.933 124.521 1.00128.47 C ANISOU 6884 CB PHE D 95 12264 14892 21658 1825 3456 424 C ATOM 6885 CG PHE D 95 165.739 163.626 125.000 1.00131.30 C ANISOU 6885 CG PHE D 95 12836 15077 21976 2008 3372 667 C ATOM 6886 CD1 PHE D 95 165.907 163.213 126.317 1.00136.67 C ANISOU 6886 CD1 PHE D 95 13351 15850 22726 2309 2936 956 C ATOM 6887 CD2 PHE D 95 164.956 162.843 124.157 1.00133.22 C ANISOU 6887 CD2 PHE D 95 13492 15054 22071 1865 3702 613 C ATOM 6888 CE1 PHE D 95 165.338 162.013 126.770 1.00138.99 C ANISOU 6888 CE1 PHE D 95 13883 15951 22977 2468 2901 1217 C ATOM 6889 CE2 PHE D 95 164.392 161.642 124.607 1.00137.25 C ANISOU 6889 CE2 PHE D 95 14193 15365 22592 2002 3641 841 C ATOM 6890 CZ PHE D 95 164.586 161.235 125.910 1.00137.21 C ANISOU 6890 CZ PHE D 95 14016 15437 22680 2301 3271 1157 C ATOM 6891 N GLY D 96 167.793 165.223 121.510 1.00133.78 N ATOM 6892 CA GLY D 96 167.788 164.878 120.092 1.00135.03 C ATOM 6893 C GLY D 96 166.400 164.531 119.600 1.00136.17 C ATOM 6894 O GLY D 96 166.208 163.487 118.975 1.00137.77 O