>>2YPT:HELIX   15  15 PHE A  396  LEU A  425  1                                  30    
FSPYNEVLSFCLTVLSRRFEFQADAFAKKL
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 15 15 PHE A 396 LEU A 425 1 30 ATOM 2575 N PHE A 396 130.247 205.425 187.446 1.00153.41 N ANISOU 2575 N PHE A 396 19049 22580 16662 7796 920 415 N ATOM 2576 CA PHE A 396 130.575 206.156 186.223 1.00154.21 C ANISOU 2576 CA PHE A 396 19343 22528 16720 7963 860 538 C ATOM 2577 C PHE A 396 131.049 205.235 185.089 1.00155.83 C ANISOU 2577 C PHE A 396 19166 23005 17037 7453 496 482 C ATOM 2578 O PHE A 396 131.236 205.728 183.975 1.00156.55 O ANISOU 2578 O PHE A 396 19332 23074 17077 7579 425 608 O ATOM 2579 CB PHE A 396 131.651 207.223 186.497 1.00155.75 C ANISOU 2579 CB PHE A 396 20394 21902 16884 7963 1004 398 C ATOM 2580 CG PHE A 396 131.238 208.446 187.284 1.00161.83 C ANISOU 2580 CG PHE A 396 21720 22282 17486 8556 1395 476 C ATOM 2581 CD1 PHE A 396 129.895 208.767 187.459 1.00169.75 C ANISOU 2581 CD1 PHE A 396 22444 23693 18362 9228 1639 745 C ATOM 2582 CD2 PHE A 396 132.195 209.307 187.809 1.00164.26 C ANISOU 2582 CD2 PHE A 396 22849 21817 17744 8451 1530 293 C ATOM 2583 CE1 PHE A 396 129.519 209.904 188.179 1.00175.42 C ANISOU 2583 CE1 PHE A 396 23729 24015 18908 9829 2044 817 C ATOM 2584 CE2 PHE A 396 131.819 210.443 188.529 1.00171.92 C ANISOU 2584 CE2 PHE A 396 24421 22369 18532 8990 1912 339 C ATOM 2585 CZ PHE A 396 130.484 210.738 188.702 1.00174.67 C ANISOU 2585 CZ PHE A 396 24517 23092 18756 9705 2183 598 C ATOM 2586 N SER A 397 131.237 203.913 185.358 1.00149.25 N ANISOU 2586 N SER A 397 17960 22409 16338 6897 286 302 N ATOM 2587 CA SER A 397 131.693 202.912 184.376 1.00146.05 C ANISOU 2587 CA SER A 397 17236 22228 16028 6390 -33 212 C ATOM 2588 C SER A 397 130.981 203.046 183.002 1.00151.41 C ANISOU 2588 C SER A 397 17538 23403 16586 6627 -158 455 C ATOM 2589 O SER A 397 131.710 203.150 182.015 1.00150.04 O ANISOU 2589 O SER A 397 17524 23071 16412 6462 -295 422 O ATOM 2590 CB SER A 397 131.546 201.492 184.913 1.00148.05 C ANISOU 2590 CB SER A 397 17075 22776 16401 5911 -177 62 C ATOM 2591 OG SER A 397 132.452 201.249 185.976 1.00155.44 O ANISOU 2591 OG SER A 397 18361 23248 17450 5602 -126 -168 O ATOM 2592 N PRO A 398 129.623 203.136 182.879 1.00150.63 N ANISOU 2592 N PRO A 398 16964 23906 16364 7031 -106 724 N ATOM 2593 CA PRO A 398 129.031 203.315 181.539 1.00152.77 C ANISOU 2593 CA PRO A 398 16893 24661 16490 7240 -253 973 C ATOM 2594 C PRO A 398 129.501 204.592 180.837 1.00156.59 C ANISOU 2594 C PRO A 398 17868 24750 16881 7642 -139 1109 C ATOM 2595 O PRO A 398 129.842 204.520 179.657 1.00155.46 O ANISOU 2595 O PRO A 398 17682 24702 16682 7496 -332 1141 O ATOM 2596 CB PRO A 398 127.523 203.336 181.805 1.00159.38 C ANISOU 2596 CB PRO A 398 17165 26182 17211 7662 -162 1271 C ATOM 2597 CG PRO A 398 127.383 203.648 183.248 1.00164.34 C ANISOU 2597 CG PRO A 398 18029 26520 17891 7889 139 1219 C ATOM 2598 CD PRO A 398 128.567 203.036 183.909 1.00154.62 C ANISOU 2598 CD PRO A 398 17172 24738 16838 7302 75 839 C ATOM 2599 N TYR A 399 129.572 205.732 181.568 1.00154.36 N ANISOU 2599 N TYR A 399 18098 23983 16568 8112 181 1173 N ATOM 2600 CA TYR A 399 130.028 207.026 181.045 1.00155.87 C ANISOU 2600 CA TYR A 399 18856 23696 16672 8498 338 1305 C ATOM 2601 C TYR A 399 131.504 206.948 180.640 1.00156.05 C ANISOU 2601 C TYR A 399 19318 23173 16801 7971 200 1055 C ATOM 2602 O TYR A 399 131.860 207.377 179.541 1.00156.52 O ANISOU 2602 O TYR A 399 19503 23176 16792 8024 125 1171 O ATOM 2603 CB TYR A 399 129.797 208.153 182.076 1.00159.78 C ANISOU 2603 CB TYR A 399 19873 23730 17108 9047 732 1374 C ATOM 2604 CG TYR A 399 130.602 209.415 181.828 1.00162.29 C ANISOU 2604 CG TYR A 399 20975 23312 17375 9256 911 1394 C ATOM 2605 CD1 TYR A 399 130.200 210.347 180.875 1.00168.21 C ANISOU 2605 CD1 TYR A 399 21821 24114 17977 9804 1008 1726 C ATOM 2606 CD2 TYR A 399 131.751 209.689 182.565 1.00160.42 C ANISOU 2606 CD2 TYR A 399 21389 22339 17225 8895 983 1102 C ATOM 2607 CE1 TYR A 399 130.936 211.510 180.643 1.00170.12 C ANISOU 2607 CE1 TYR A 399 22819 23646 18171 9971 1187 1756 C ATOM 2608 CE2 TYR A 399 132.493 210.849 182.343 1.00162.76 C ANISOU 2608 CE2 TYR A 399 22421 21955 17467 9018 1141 1122 C ATOM 2609 CZ TYR A 399 132.079 211.761 181.385 1.00173.66 C ANISOU 2609 CZ TYR A 399 23920 23352 18712 9557 1254 1447 C ATOM 2610 OH TYR A 399 132.804 212.911 181.168 1.00175.60 O ANISOU 2610 OH TYR A 399 24926 22891 18902 9660 1425 1479 O ATOM 2611 N ASN A 400 132.348 206.394 181.529 1.00148.60 N ANISOU 2611 N ASN A 400 18579 21868 16014 7475 171 740 N ATOM 2612 CA ASN A 400 133.783 206.226 181.317 1.00144.59 C ANISOU 2612 CA ASN A 400 18429 20888 15623 6950 50 512 C ATOM 2613 C ASN A 400 134.067 205.404 180.056 1.00146.28 C ANISOU 2613 C ASN A 400 18277 21452 15851 6605 -234 500 C ATOM 2614 O ASN A 400 135.011 205.730 179.343 1.00144.96 O ANISOU 2614 O ASN A 400 18406 20981 15691 6442 -282 478 O ATOM 2615 CB ASN A 400 134.437 205.567 182.539 1.00143.26 C ANISOU 2615 CB ASN A 400 18378 20451 15604 6498 41 222 C ATOM 2616 CG ASN A 400 134.387 206.377 183.819 1.00172.07 C ANISOU 2616 CG ASN A 400 22499 23667 19211 6742 312 177 C ATOM 2617 OD1 ASN A 400 134.380 207.619 183.816 1.00171.98 O ANISOU 2617 OD1 ASN A 400 22984 23272 19087 7137 527 291 O ATOM 2618 ND2 ASN A 400 134.392 205.681 184.952 1.00160.71 N ANISOU 2618 ND2 ASN A 400 20966 22248 17849 6494 315 0 N ATOM 2619 N GLU A 401 133.245 204.365 179.772 1.00142.47 N ANISOU 2619 N GLU A 401 17176 21604 15352 6487 -412 517 N ATOM 2620 CA GLU A 401 133.389 203.498 178.598 1.00140.90 C ANISOU 2620 CA GLU A 401 16641 21769 15125 6147 -680 481 C ATOM 2621 C GLU A 401 133.008 204.216 177.311 1.00146.55 C ANISOU 2621 C GLU A 401 17315 22725 15644 6507 -717 751 C ATOM 2622 O GLU A 401 133.676 204.012 176.294 1.00145.21 O ANISOU 2622 O GLU A 401 17207 22531 15437 6266 -858 708 O ATOM 2623 CB GLU A 401 132.561 202.213 178.737 1.00142.37 C ANISOU 2623 CB GLU A 401 16230 22540 15325 5879 -853 416 C ATOM 2624 CG GLU A 401 133.302 201.074 179.424 1.00152.78 C ANISOU 2624 CG GLU A 401 17562 23651 16836 5308 -930 107 C ATOM 2625 CD GLU A 401 134.569 200.564 178.757 1.00181.78 C ANISOU 2625 CD GLU A 401 21446 27037 20585 4874 -1054 -85 C ATOM 2626 OE1 GLU A 401 134.603 200.466 177.507 1.00185.25 O ANISOU 2626 OE1 GLU A 401 21791 27692 20901 4833 -1191 -31 O ATOM 2627 OE2 GLU A 401 135.528 200.244 179.496 1.00176.98 O ANISOU 2627 OE2 GLU A 401 21086 26015 20143 4583 -1010 -276 O ATOM 2628 N VAL A 402 131.939 205.042 177.348 1.00146.06 N ANISOU 2628 N VAL A 402 17144 22911 15441 7106 -576 1049 N ATOM 2629 CA VAL A 402 131.457 205.813 176.195 1.00149.18 C ANISOU 2629 CA VAL A 402 17484 23570 15627 7543 -589 1371 C ATOM 2630 C VAL A 402 132.492 206.903 175.875 1.00151.87 C ANISOU 2630 C VAL A 402 18498 23235 15972 7669 -434 1400 C ATOM 2631 O VAL A 402 132.932 206.989 174.727 1.00151.25 O ANISOU 2631 O VAL A 402 18469 23198 15800 7579 -555 1467 O ATOM 2632 CB VAL A 402 130.020 206.383 176.415 1.00158.13 C ANISOU 2632 CB VAL A 402 18292 25174 16617 8200 -451 1720 C ATOM 2633 CG1 VAL A 402 129.638 207.402 175.342 1.00162.27 C ANISOU 2633 CG1 VAL A 402 18876 25852 16927 8751 -404 2096 C ATOM 2634 CG2 VAL A 402 128.985 205.262 176.471 1.00158.76 C ANISOU 2634 CG2 VAL A 402 17623 26039 16661 8001 -657 1737 C ATOM 2635 N LEU A 403 132.915 207.684 176.897 1.00148.17 N ANISOU 2635 N LEU A 403 18559 22142 15598 7820 -172 1335 N ATOM 2636 CA LEU A 403 133.909 208.758 176.780 1.00148.42 C ANISOU 2636 CA LEU A 403 19287 21468 15640 7877 -6 1348 C ATOM 2637 C LEU A 403 135.232 208.234 176.200 1.00149.89 C ANISOU 2637 C LEU A 403 19599 21431 15922 7266 -185 1138 C ATOM 2638 O LEU A 403 135.817 208.900 175.344 1.00150.74 O ANISOU 2638 O LEU A 403 20013 21301 15960 7313 -159 1263 O ATOM 2639 CB LEU A 403 134.154 209.417 178.146 1.00148.63 C ANISOU 2639 CB LEU A 403 19833 20894 15746 7982 261 1230 C ATOM 2640 CG LEU A 403 135.029 210.667 178.151 1.00154.65 C ANISOU 2640 CG LEU A 403 21374 20899 16488 8065 465 1262 C ATOM 2641 CD1 LEU A 403 134.189 211.920 178.121 1.00160.51 C ANISOU 2641 CD1 LEU A 403 22421 21500 17064 8824 757 1575 C ATOM 2642 CD2 LEU A 403 135.934 210.686 179.358 1.00155.18 C ANISOU 2642 CD2 LEU A 403 21883 20391 16686 7659 541 962 C ATOM 2643 N SER A 404 135.685 207.041 176.651 1.00143.02 N ANISOU 2643 N SER A 404 18486 20649 15204 6722 -346 848 N ATOM 2644 CA SER A 404 136.915 206.397 176.178 1.00139.32 C ANISOU 2644 CA SER A 404 18078 20022 14835 6167 -496 653 C ATOM 2645 C SER A 404 136.804 206.015 174.711 1.00143.87 C ANISOU 2645 C SER A 404 18370 21024 15270 6132 -676 759 C ATOM 2646 O SER A 404 137.782 206.171 173.980 1.00143.00 O ANISOU 2646 O SER A 404 18490 20690 15155 5931 -697 750 O ATOM 2647 CB SER A 404 137.242 205.163 177.008 1.00139.42 C ANISOU 2647 CB SER A 404 17862 20086 15024 5689 -605 362 C ATOM 2648 OG SER A 404 137.655 205.531 178.314 1.00148.32 O ANISOU 2648 OG SER A 404 19331 20756 16269 5628 -455 243 O ATOM 2649 N PHE A 405 135.615 205.536 174.278 1.00141.94 N ANISOU 2649 N PHE A 405 17626 21415 14890 6315 -805 870 N ATOM 2650 CA PHE A 405 135.363 205.173 172.884 1.00143.00 C ANISOU 2650 CA PHE A 405 17478 22023 14832 6285 -999 975 C ATOM 2651 C PHE A 405 135.364 206.428 172.010 1.00149.81 C ANISOU 2651 C PHE A 405 18625 22775 15519 6727 -892 1289 C ATOM 2652 O PHE A 405 135.929 206.402 170.917 1.00149.33 O ANISOU 2652 O PHE A 405 18640 22747 15351 6591 -978 1324 O ATOM 2653 CB PHE A 405 134.047 204.390 172.723 1.00146.69 C ANISOU 2653 CB PHE A 405 17332 23227 15176 6329 -1181 1031 C ATOM 2654 CG PHE A 405 133.685 204.103 171.280 1.00150.38 C ANISOU 2654 CG PHE A 405 17524 24227 15387 6307 -1398 1157 C ATOM 2655 CD1 PHE A 405 134.389 203.156 170.542 1.00151.20 C ANISOU 2655 CD1 PHE A 405 17606 24379 15463 5809 -1569 929 C ATOM 2656 CD2 PHE A 405 132.664 204.801 170.652 1.00157.24 C ANISOU 2656 CD2 PHE A 405 18177 25547 16020 6804 -1419 1515 C ATOM 2657 CE1 PHE A 405 134.068 202.905 169.205 1.00154.47 C ANISOU 2657 CE1 PHE A 405 17817 25276 15598 5772 -1768 1026 C ATOM 2658 CE2 PHE A 405 132.345 204.550 169.314 1.00162.57 C ANISOU 2658 CE2 PHE A 405 18604 26744 16422 6763 -1640 1639 C ATOM 2659 CZ PHE A 405 133.048 203.602 168.600 1.00158.28 C ANISOU 2659 CZ PHE A 405 18073 26231 15835 6229 -1819 1378 C ATOM 2660 N CYS A 406 134.751 207.520 172.503 1.00149.28 N ANISOU 2660 N CYS A 406 18749 22554 15417 7268 -683 1523 N ATOM 2661 CA CYS A 406 134.682 208.803 171.809 1.00153.02 C ANISOU 2661 CA CYS A 406 19554 22855 15732 7759 -533 1854 C ATOM 2662 C CYS A 406 136.078 209.413 171.674 1.00154.93 C ANISOU 2662 C CYS A 406 20402 22400 16063 7523 -411 1780 C ATOM 2663 O CYS A 406 136.398 209.956 170.620 1.00156.85 O ANISOU 2663 O CYS A 406 20821 22606 16167 7635 -406 1976 O ATOM 2664 CB CYS A 406 133.725 209.757 172.517 1.00157.43 C ANISOU 2664 CB CYS A 406 20220 23348 16248 8402 -292 2097 C ATOM 2665 SG CYS A 406 131.986 209.253 172.446 1.00164.92 S ANISOU 2665 SG CYS A 406 20389 25234 17037 8788 -417 2325 S ATOM 2666 N LEU A 407 136.914 209.294 172.718 1.00147.91 N ANISOU 2666 N LEU A 407 19803 21004 15392 7170 -328 1513 N ATOM 2667 CA LEU A 407 138.277 209.817 172.699 1.00146.72 C ANISOU 2667 CA LEU A 407 20179 20232 15335 6867 -232 1441 C ATOM 2668 C LEU A 407 139.207 208.974 171.795 1.00148.72 C ANISOU 2668 C LEU A 407 20259 20644 15604 6377 -416 1317 C ATOM 2669 O LEU A 407 140.185 209.515 171.272 1.00149.08 O ANISOU 2669 O LEU A 407 20654 20346 15645 6231 -347 1385 O ATOM 2670 CB LEU A 407 138.843 209.920 174.118 1.00144.87 C ANISOU 2670 CB LEU A 407 20266 19483 15296 6620 -114 1210 C ATOM 2671 CG LEU A 407 138.400 211.155 174.903 1.00153.21 C ANISOU 2671 CG LEU A 407 21808 20094 16310 7066 156 1338 C ATOM 2672 CD1 LEU A 407 138.407 210.884 176.388 1.00151.79 C ANISOU 2672 CD1 LEU A 407 21712 19697 16264 6901 217 1088 C ATOM 2673 CD2 LEU A 407 139.261 212.372 174.572 1.00158.15 C ANISOU 2673 CD2 LEU A 407 23100 20092 16898 7068 327 1471 C ATOM 2674 N THR A 408 138.886 207.674 171.588 1.00142.67 N ANISOU 2674 N THR A 408 18978 20390 14840 6136 -629 1148 N ATOM 2675 CA THR A 408 139.629 206.770 170.700 1.00140.02 C ANISOU 2675 CA THR A 408 18474 20244 14483 5728 -783 1018 C ATOM 2676 C THR A 408 139.309 207.158 169.247 1.00146.73 C ANISOU 2676 C THR A 408 19277 21410 15064 5985 -836 1274 C ATOM 2677 O THR A 408 140.213 207.172 168.409 1.00146.45 O ANISOU 2677 O THR A 408 19397 21271 14977 5790 -833 1292 O ATOM 2678 CB THR A 408 139.297 205.302 171.022 1.00145.06 C ANISOU 2678 CB THR A 408 18659 21265 15192 5411 -964 753 C ATOM 2679 OG1 THR A 408 139.664 205.040 172.377 1.00141.87 O ANISOU 2679 OG1 THR A 408 18340 20539 15027 5199 -897 553 O ATOM 2680 CG2 THR A 408 140.010 204.310 170.102 1.00142.49 C ANISOU 2680 CG2 THR A 408 18203 21115 14821 5026 -1093 603 C ATOM 2681 N VAL A 409 138.025 207.494 168.966 1.00145.77 N ANISOU 2681 N VAL A 409 18930 21699 14758 6437 -877 1499 N ATOM 2682 CA VAL A 409 137.536 207.945 167.657 1.00148.86 C ANISOU 2682 CA VAL A 409 19246 22457 14857 6756 -938 1796 C ATOM 2683 C VAL A 409 138.232 209.277 167.322 1.00154.67 C ANISOU 2683 C VAL A 409 20535 22663 15568 6983 -716 2039 C ATOM 2684 O VAL A 409 138.730 209.437 166.207 1.00155.01 O ANISOU 2684 O VAL A 409 20680 22761 15454 6935 -741 2160 O ATOM 2685 CB VAL A 409 135.981 208.056 167.630 1.00156.17 C ANISOU 2685 CB VAL A 409 19770 23956 15610 7218 -1018 2021 C ATOM 2686 CG1 VAL A 409 135.474 208.786 166.387 1.00160.75 C ANISOU 2686 CG1 VAL A 409 20331 24867 15880 7647 -1047 2407 C ATOM 2687 CG2 VAL A 409 135.329 206.683 167.735 1.00154.50 C ANISOU 2687 CG2 VAL A 409 18997 24325 15380 6902 -1270 1799 C ATOM 2688 N LEU A 410 138.308 210.195 168.313 1.00152.51 N ANISOU 2688 N LEU A 410 20652 21853 15444 7188 -492 2091 N ATOM 2689 CA LEU A 410 138.951 211.506 168.201 1.00155.07 C ANISOU 2689 CA LEU A 410 21582 21572 15766 7360 -256 2299 C ATOM 2690 C LEU A 410 140.451 211.358 167.938 1.00158.62 C ANISOU 2690 C LEU A 410 22288 21656 16325 6821 -243 2154 C ATOM 2691 O LEU A 410 140.978 212.062 167.077 1.00160.89 O ANISOU 2691 O LEU A 410 22868 21763 16500 6876 -156 2373 O ATOM 2692 CB LEU A 410 138.713 212.340 169.466 1.00156.16 C ANISOU 2692 CB LEU A 410 22102 21196 16034 7607 -28 2303 C ATOM 2693 N SER A 411 141.123 210.423 168.651 1.00151.98 N ANISOU 2693 N SER A 411 21308 20746 15694 6316 -324 1815 N ATOM 2694 CA SER A 411 142.556 210.139 168.512 1.00149.94 C ANISOU 2694 CA SER A 411 21197 20216 15557 5798 -316 1680 C ATOM 2695 C SER A 411 142.915 209.741 167.071 1.00155.58 C ANISOU 2695 C SER A 411 21748 21276 16090 5712 -403 1771 C ATOM 2696 O SER A 411 143.945 210.188 166.561 1.00155.92 O ANISOU 2696 O SER A 411 22064 21048 16130 5526 -302 1873 O ATOM 2697 CB SER A 411 142.978 209.039 169.482 1.00149.61 C ANISOU 2697 CB SER A 411 20923 20184 15739 5366 -410 1334 C ATOM 2698 OG SER A 411 144.345 208.691 169.326 1.00156.77 O ANISOU 2698 OG SER A 411 21902 20906 16758 4902 -401 1236 O ATOM 2699 N ARG A 412 142.057 208.923 166.419 1.00152.88 N ANISOU 2699 N ARG A 412 20973 21540 15575 5831 -586 1740 N ATOM 2700 CA ARG A 412 142.238 208.473 165.036 1.00153.73 C ANISOU 2700 CA ARG A 412 20927 22034 15450 5768 -685 1800 C ATOM 2701 C ARG A 412 142.117 209.649 164.071 1.00163.22 C ANISOU 2701 C ARG A 412 22404 23189 16425 6140 -581 2185 C ATOM 2702 O ARG A 412 142.926 209.759 163.148 1.00163.41 O ANISOU 2702 O ARG A 412 22570 23179 16340 6002 -531 2278 O ATOM 2703 CB ARG A 412 141.228 207.379 164.666 1.00152.57 C ANISOU 2703 CB ARG A 412 20290 22538 15141 5781 -922 1669 C ATOM 2704 CG ARG A 412 141.499 206.035 165.327 1.00153.59 C ANISOU 2704 CG ARG A 412 20169 22734 15456 5351 -1024 1288 C ATOM 2705 CD ARG A 412 140.751 204.906 164.647 1.00160.74 C ANISOU 2705 CD ARG A 412 20678 24247 16148 5250 -1254 1151 C ATOM 2706 NE ARG A 412 139.302 205.000 164.835 1.00170.81 N ANISOU 2706 NE ARG A 412 21654 25941 17307 5549 -1386 1264 N ATOM 2707 CZ ARG A 412 138.625 204.402 165.810 1.00182.08 C ANISOU 2707 CZ ARG A 412 22814 27491 18878 5473 -1462 1102 C ATOM 2708 NH1 ARG A 412 139.259 203.655 166.707 1.00163.78 N ANISOU 2708 NH1 ARG A 412 20516 24885 16826 5114 -1425 811 N ATOM 2709 NH2 ARG A 412 137.311 204.539 165.895 1.00171.69 N ANISOU 2709 NH2 ARG A 412 21187 26614 17434 5765 -1570 1256 N ATOM 2710 N ARG A 413 141.126 210.539 164.303 1.00164.18 N ANISOU 2710 N ARG A 413 22611 23296 16472 6634 -522 2428 N ATOM 2711 CA ARG A 413 140.890 211.740 163.497 1.00169.31 C ANISOU 2711 CA ARG A 413 23554 23864 16910 7072 -398 2837 C ATOM 2712 C ARG A 413 142.038 212.738 163.674 1.00175.41 C ANISOU 2712 C ARG A 413 24908 23922 17817 6930 -152 2942 C ATOM 2713 O ARG A 413 142.422 213.399 162.708 1.00178.02 O ANISOU 2713 O ARG A 413 25485 24174 17981 7032 -61 3215 O ATOM 2714 CB ARG A 413 139.547 212.392 163.861 1.00172.93 C ANISOU 2714 CB ARG A 413 23957 24462 17286 7670 -363 3070 C ATOM 2715 N PHE A 414 142.598 212.818 164.903 1.00170.39 N ANISOU 2715 N PHE A 414 24486 22788 17465 6655 -57 2728 N ATOM 2716 CA PHE A 414 143.724 213.685 165.262 1.00171.03 C ANISOU 2716 CA PHE A 414 25105 22187 17691 6400 146 2780 C ATOM 2717 C PHE A 414 145.020 213.203 164.604 1.00174.12 C ANISOU 2717 C PHE A 414 25448 22600 18108 5902 124 2717 C ATOM 2718 O PHE A 414 145.887 214.021 164.293 1.00175.76 O ANISOU 2718 O PHE A 414 26052 22411 18318 5756 283 2902 O ATOM 2719 CB PHE A 414 143.896 213.743 166.787 1.00170.81 C ANISOU 2719 CB PHE A 414 25251 21728 17921 6201 204 2537 C ATOM 2720 N GLU A 415 145.151 211.877 164.396 1.00167.92 N ANISOU 2720 N GLU A 415 24194 22272 17337 5644 -54 2466 N ATOM 2721 CA GLU A 415 146.318 211.271 163.756 1.00166.33 C ANISOU 2721 CA GLU A 415 23896 22159 17144 5231 -55 2398 C ATOM 2722 C GLU A 415 146.296 211.530 162.247 1.00173.57 C ANISOU 2722 C GLU A 415 24836 23357 17755 5429 -34 2666 C ATOM 2723 O GLU A 415 147.340 211.839 161.673 1.00173.74 O ANISOU 2723 O GLU A 415 25044 23213 17757 5212 93 2800 O ATOM 2724 CB GLU A 415 146.398 209.768 164.063 1.00163.75 C ANISOU 2724 CB GLU A 415 23122 22179 16915 4948 -218 2042 C ATOM 2725 CG GLU A 415 147.048 209.460 165.404 1.00170.78 C ANISOU 2725 CG GLU A 415 24026 22742 18122 4587 -200 1808 C ATOM 2726 CD GLU A 415 148.526 209.796 165.487 1.00191.32 C ANISOU 2726 CD GLU A 415 26840 24990 20862 4188 -64 1871 C ATOM 2727 OE1 GLU A 415 149.314 209.184 164.731 1.00186.85 O ANISOU 2727 OE1 GLU A 415 26111 24633 20249 3987 -47 1866 O ATOM 2728 OE2 GLU A 415 148.899 210.677 166.295 1.00186.26 O ANISOU 2728 OE2 GLU A 415 26535 23877 20357 4069 31 1934 O ATOM 2729 N PHE A 416 145.102 211.440 161.621 1.00172.93 N ANISOU 2729 N PHE A 416 24559 23723 17422 5838 -157 2768 N ATOM 2730 CA PHE A 416 144.899 211.708 160.196 1.00176.78 C ANISOU 2730 CA PHE A 416 25058 24542 17567 6079 -166 3043 C ATOM 2731 C PHE A 416 145.206 213.165 159.866 1.00184.83 C ANISOU 2731 C PHE A 416 26573 25123 18531 6296 55 3437 C ATOM 2732 O PHE A 416 145.758 213.441 158.799 1.00186.63 O ANISOU 2732 O PHE A 416 26930 25414 18568 6272 133 3650 O ATOM 2733 CB PHE A 416 143.460 211.379 159.768 1.00180.80 C ANISOU 2733 CB PHE A 416 25233 25642 17820 6469 -371 3093 C ATOM 2734 CG PHE A 416 143.206 209.963 159.308 1.00180.95 C ANISOU 2734 CG PHE A 416 24809 26242 17699 6247 -600 2808 C ATOM 2735 CD1 PHE A 416 143.854 209.450 158.186 1.00184.73 C ANISOU 2735 CD1 PHE A 416 25268 26962 17961 6047 -612 2784 C ATOM 2736 CD2 PHE A 416 142.264 209.167 159.947 1.00181.86 C ANISOU 2736 CD2 PHE A 416 24558 26673 17868 6250 -792 2579 C ATOM 2737 CE1 PHE A 416 143.606 208.145 157.751 1.00184.63 C ANISOU 2737 CE1 PHE A 416 24926 27436 17789 5836 -807 2499 C ATOM 2738 CE2 PHE A 416 142.000 207.871 159.498 1.00183.78 C ANISOU 2738 CE2 PHE A 416 24448 27419 17961 6010 -1003 2314 C ATOM 2739 CZ PHE A 416 142.681 207.364 158.410 1.00182.36 C ANISOU 2739 CZ PHE A 416 24305 27418 17564 5800 -1007 2261 C ATOM 2740 N GLN A 417 144.840 214.091 160.784 1.00182.61 N ANISOU 2740 N GLN A 417 26600 24382 18402 6509 171 3533 N ATOM 2741 CA GLN A 417 145.068 215.534 160.667 1.00186.24 C ANISOU 2741 CA GLN A 417 27624 24304 18834 6717 409 3887 C ATOM 2742 C GLN A 417 146.567 215.837 160.726 1.00188.66 C ANISOU 2742 C GLN A 417 28241 24143 19300 6191 564 3882 C ATOM 2743 O GLN A 417 147.046 216.680 159.965 1.00191.67 O ANISOU 2743 O GLN A 417 28965 24307 19555 6227 724 4202 O ATOM 2744 CB GLN A 417 144.312 216.298 161.768 1.00188.94 C ANISOU 2744 CB GLN A 417 28239 24245 19304 7046 507 3916 C ATOM 2745 N ALA A 418 147.304 215.121 161.605 1.00180.23 N ANISOU 2745 N ALA A 418 27020 22963 18495 5699 512 3545 N ATOM 2746 CA ALA A 418 148.753 215.244 161.770 1.00178.73 C ANISOU 2746 CA ALA A 418 27004 22433 18472 5146 625 3524 C ATOM 2747 C ALA A 418 149.495 214.672 160.556 1.00181.61 C ANISOU 2747 C ALA A 418 27135 23185 18683 4967 626 3603 C ATOM 2748 O ALA A 418 150.563 215.181 160.210 1.00182.66 O ANISOU 2748 O ALA A 418 27492 23072 18838 4671 782 3788 O ATOM 2749 CB ALA A 418 149.192 214.538 163.035 1.00175.39 C ANISOU 2749 CB ALA A 418 26404 21896 18340 4742 541 3164 C ATOM 2750 N ASP A 419 148.920 213.629 159.906 1.00176.21 N ANISOU 2750 N ASP A 419 26020 23107 17825 5134 463 3468 N ATOM 2751 CA ASP A 419 149.476 213.003 158.699 1.00175.95 C ANISOU 2751 CA ASP A 419 25786 23482 17586 5029 469 3511 C ATOM 2752 C ASP A 419 149.267 213.920 157.497 1.00182.05 C ANISOU 2752 C ASP A 419 26821 24303 18048 5348 575 3920 C ATOM 2753 O ASP A 419 150.139 214.003 156.634 1.00182.65 O ANISOU 2753 O ASP A 419 26962 24432 18005 5183 704 4088 O ATOM 2754 CB ASP A 419 148.848 211.624 158.442 1.00175.88 C ANISOU 2754 CB ASP A 419 25314 24054 17460 5086 257 3209 C ATOM 2755 CG ASP A 419 149.279 210.538 159.413 1.00186.08 C ANISOU 2755 CG ASP A 419 26333 25339 19031 4729 183 2823 C ATOM 2756 OD1 ASP A 419 150.490 210.466 159.731 1.00185.94 O ANISOU 2756 OD1 ASP A 419 26354 25086 19208 4357 307 2798 O ATOM 2757 OD2 ASP A 419 148.414 209.734 159.823 1.00191.90 O ANISOU 2757 OD2 ASP A 419 26797 26339 19779 4818 0 2569 O ATOM 2758 N ALA A 420 148.113 214.622 157.464 1.00180.12 N ANISOU 2758 N ALA A 420 26721 24048 17670 5828 536 4107 N ATOM 2759 CA ALA A 420 147.744 215.598 156.437 1.00184.38 C ANISOU 2759 CA ALA A 420 27536 24607 17914 6222 635 4541 C ATOM 2760 C ALA A 420 148.643 216.832 156.530 1.00189.72 C ANISOU 2760 C ALA A 420 28751 24631 18703 6060 903 4831 C ATOM 2761 O ALA A 420 148.945 217.446 155.504 1.00193.06 O ANISOU 2761 O ALA A 420 29395 25056 18904 6161 1037 5180 O ATOM 2762 CB ALA A 420 146.284 215.997 156.594 1.00187.23 C ANISOU 2762 CB ALA A 420 27881 25107 18152 6792 537 4665 C ATOM 2763 N PHE A 421 149.074 217.184 157.764 1.00183.59 N ANISOU 2763 N PHE A 421 28199 23302 18255 5777 977 4688 N ATOM 2764 CA PHE A 421 149.976 218.299 158.047 1.00185.42 C ANISOU 2764 CA PHE A 421 28962 22867 18621 5498 1209 4902 C ATOM 2765 C PHE A 421 151.383 217.968 157.546 1.00186.80 C ANISOU 2765 C PHE A 421 29029 23114 18832 4962 1291 4929 C ATOM 2766 O PHE A 421 152.078 218.861 157.060 1.00190.43 O ANISOU 2766 O PHE A 421 29857 23257 19240 4813 1489 5253 O ATOM 2767 CB PHE A 421 149.993 218.621 159.552 1.00185.99 C ANISOU 2767 CB PHE A 421 29271 22400 18996 5303 1223 4683 C ATOM 2768 CG PHE A 421 150.775 219.860 159.927 1.00191.20 C ANISOU 2768 CG PHE A 421 30563 22319 19766 5006 1447 4889 C ATOM 2769 CD1 PHE A 421 150.173 221.113 159.916 1.00199.52 C ANISOU 2769 CD1 PHE A 421 32204 22882 20722 5400 1621 5176 C ATOM 2770 CD2 PHE A 421 152.110 219.773 160.300 1.00192.31 C ANISOU 2770 CD2 PHE A 421 30719 22254 20097 4325 1489 4809 C ATOM 2771 CE1 PHE A 421 150.896 222.257 160.267 1.00204.20 C ANISOU 2771 CE1 PHE A 421 33449 22738 21402 5079 1834 5349 C ATOM 2772 CE2 PHE A 421 152.829 220.915 160.660 1.00198.94 C ANISOU 2772 CE2 PHE A 421 32150 22418 21020 3973 1674 4993 C ATOM 2773 CZ PHE A 421 152.221 222.150 160.632 1.00201.97 C ANISOU 2773 CZ PHE A 421 33171 22269 21300 4333 1847 5249 C ATOM 2774 N ALA A 422 151.797 216.688 157.664 1.00177.18 N ANISOU 2774 N ALA A 422 27310 22310 17700 4688 1159 4609 N ATOM 2775 CA ALA A 422 153.097 216.197 157.196 1.00175.54 C ANISOU 2775 CA ALA A 422 26910 22267 17522 4243 1247 4622 C ATOM 2776 C ALA A 422 153.165 216.246 155.665 1.00180.96 C ANISOU 2776 C ALA A 422 27580 23319 17857 4458 1337 4907 C ATOM 2777 O ALA A 422 154.225 216.542 155.109 1.00182.40 O ANISOU 2777 O ALA A 422 27849 23444 18010 4174 1520 5134 O ATOM 2778 CB ALA A 422 153.333 214.780 157.694 1.00171.43 C ANISOU 2778 CB ALA A 422 25884 22101 17151 4025 1097 4216 C ATOM 2779 N LYS A 423 152.018 215.983 154.995 1.00177.24 N ANISOU 2779 N LYS A 423 26993 23246 17104 4951 1207 4914 N ATOM 2780 CA LYS A 423 151.863 216.044 153.538 1.00179.58 C ANISOU 2780 CA LYS A 423 27292 23936 17003 5220 1254 5181 C ATOM 2781 C LYS A 423 151.880 217.498 153.085 1.00187.04 C ANISOU 2781 C LYS A 423 28747 24484 17834 5401 1449 5662 C ATOM 2782 O LYS A 423 152.402 217.794 152.010 1.00189.50 O ANISOU 2782 O LYS A 423 29167 24923 17912 5394 1599 5960 O ATOM 2783 CB LYS A 423 150.566 215.352 153.092 1.00181.44 C ANISOU 2783 CB LYS A 423 27243 24727 16967 5649 1013 5039 C ATOM 2784 N LYS A 424 151.331 218.404 153.927 1.00183.96 N ANISOU 2784 N LYS A 424 28703 23587 17607 5565 1471 5739 N ATOM 2785 CA LYS A 424 151.287 219.851 153.704 1.00188.66 C ANISOU 2785 CA LYS A 424 29878 23667 18135 5750 1680 6177 C ATOM 2786 C LYS A 424 152.694 220.458 153.810 1.00193.66 C ANISOU 2786 C LYS A 424 30815 23828 18940 5181 1910 6339 C ATOM 2787 O LYS A 424 152.937 221.521 153.237 1.00198.71 O ANISOU 2787 O LYS A 424 31904 24139 19455 5238 2117 6754 O ATOM 2788 CB LYS A 424 150.330 220.528 154.697 1.00191.86 C ANISOU 2788 CB LYS A 424 30580 23639 18680 6078 1661 6153 C ATOM 2789 N LEU A 425 153.615 219.779 154.529 1.00185.35 N ATOM 2790 CA LEU A 425 155.012 220.193 154.677 1.00186.13 C ATOM 2791 C LEU A 425 155.856 219.697 153.494 1.00190.73 C ATOM 2792 O LEU A 425 156.968 220.188 153.288 1.00192.77 O ATOM 2793 CB LEU A 425 155.603 219.678 155.999 1.00182.23 C ATOM 2794 CG LEU A 425 155.150 220.378 157.281 1.00186.98 C ATOM 2795 CD1 LEU A 425 155.385 219.494 158.479 1.00182.48 C ATOM 2796 CD2 LEU A 425 155.863 221.709 157.475 1.00193.76 C