>>2YPT:HELIX   51  51 PHE D  396  LEU D  425  1                                  30    
FSPYNEVLSFCLTVLSRRFEFQADAFAKKL
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 51 51 PHE D 396 LEU D 425 1 30 ATOM 8779 N PHE D 396 171.238 181.885 112.101 1.00162.13 N ANISOU 8779 N PHE D 396 18459 17653 25489 -1970 9812 -1245 N ATOM 8780 CA PHE D 396 170.887 183.292 111.896 1.00161.62 C ANISOU 8780 CA PHE D 396 18744 17519 25144 -2202 9795 -1156 C ATOM 8781 C PHE D 396 170.446 183.991 113.186 1.00162.65 C ANISOU 8781 C PHE D 396 18469 17950 25381 -2219 8902 -1153 C ATOM 8782 O PHE D 396 170.241 185.208 113.152 1.00162.36 O ANISOU 8782 O PHE D 396 18621 17839 25230 -2407 8855 -1100 O ATOM 8783 CB PHE D 396 169.777 183.433 110.836 1.00161.79 C ANISOU 8783 CB PHE D 396 19878 17464 24130 -2209 9898 -1043 C ATOM 8784 CG PHE D 396 170.156 183.179 109.395 1.00168.58 C ANISOU 8784 CG PHE D 396 21383 17958 24710 -2251 10850 -1031 C ATOM 8785 CD1 PHE D 396 171.489 183.156 108.999 1.00178.47 C ANISOU 8785 CD1 PHE D 396 22231 18912 26669 -2342 11729 -1092 C ATOM 8786 CD2 PHE D 396 169.178 183.011 108.424 1.00170.00 C ANISOU 8786 CD2 PHE D 396 22595 18076 23920 -2199 10873 -963 C ATOM 8787 CE1 PHE D 396 171.836 182.932 107.667 1.00183.57 C ANISOU 8787 CE1 PHE D 396 23478 19380 26889 -2322 12410 -1028 C ATOM 8788 CE2 PHE D 396 169.524 182.786 107.092 1.00178.68 C ANISOU 8788 CE2 PHE D 396 24390 18828 24675 -2221 11748 -963 C ATOM 8789 CZ PHE D 396 170.851 182.756 106.722 1.00182.64 C ANISOU 8789 CZ PHE D 396 24485 19113 25796 -2282 12559 -994 C ATOM 8790 N SER D 397 170.311 183.242 114.316 1.00157.13 N ANISOU 8790 N SER D 397 17255 17561 24885 -2015 8224 -1207 N ATOM 8791 CA SER D 397 169.886 183.769 115.626 1.00153.59 C ANISOU 8791 CA SER D 397 16459 17413 24484 -1984 7369 -1219 C ATOM 8792 C SER D 397 170.588 185.100 115.997 1.00159.17 C ANISOU 8792 C SER D 397 16751 17995 25732 -2227 7387 -1287 C ATOM 8793 O SER D 397 169.859 186.041 116.316 1.00156.37 O ANISOU 8793 O SER D 397 16676 17725 25012 -2305 6992 -1250 O ATOM 8794 CB SER D 397 170.091 182.744 116.738 1.00156.70 C ANISOU 8794 CB SER D 397 16256 18067 25218 -1738 6833 -1271 C ATOM 8795 OG SER D 397 169.288 181.595 116.531 1.00164.44 O ANISOU 8795 OG SER D 397 17637 19163 25682 -1531 6720 -1200 O ATOM 8796 N PRO D 398 171.941 185.263 115.903 1.00159.87 N ANISOU 8796 N PRO D 398 16203 17847 26694 -2363 7863 -1390 N ATOM 8797 CA PRO D 398 172.527 186.573 116.238 1.00162.26 C ANISOU 8797 CA PRO D 398 16135 17996 27520 -2631 7849 -1468 C ATOM 8798 C PRO D 398 172.016 187.706 115.341 1.00165.46 C ANISOU 8798 C PRO D 398 17271 18160 27438 -2861 8253 -1350 C ATOM 8799 O PRO D 398 171.667 188.764 115.866 1.00163.84 O ANISOU 8799 O PRO D 398 17103 17982 27168 -2982 7839 -1368 O ATOM 8800 CB PRO D 398 174.034 186.348 116.081 1.00170.81 C ANISOU 8800 CB PRO D 398 16427 18825 29647 -2728 8409 -1584 C ATOM 8801 CG PRO D 398 174.166 185.140 115.227 1.00176.28 C ANISOU 8801 CG PRO D 398 17341 19435 30202 -2554 9003 -1529 C ATOM 8802 CD PRO D 398 172.998 184.285 115.562 1.00165.41 C ANISOU 8802 CD PRO D 398 16430 18395 28023 -2277 8401 -1455 C ATOM 8803 N TYR D 399 171.919 187.466 114.010 1.00162.91 N ANISOU 8803 N TYR D 399 17588 17594 26717 -2893 9024 -1228 N ATOM 8804 CA TYR D 399 171.433 188.437 113.022 1.00163.19 C ANISOU 8804 CA TYR D 399 18433 17366 26205 -3071 9454 -1077 C ATOM 8805 C TYR D 399 169.963 188.772 113.277 1.00160.35 C ANISOU 8805 C TYR D 399 18704 17252 24970 -2954 8742 -979 C ATOM 8806 O TYR D 399 169.599 189.949 113.302 1.00159.83 O ANISOU 8806 O TYR D 399 18902 17078 24747 -3098 8616 -918 O ATOM 8807 CB TYR D 399 171.630 187.904 111.585 1.00167.61 C ANISOU 8807 CB TYR D 399 19604 17643 26439 -3068 10381 -978 C ATOM 8808 CG TYR D 399 170.796 188.604 110.530 1.00168.83 C ANISOU 8808 CG TYR D 399 20829 17602 25717 -3139 10651 -785 C ATOM 8809 CD1 TYR D 399 171.177 189.841 110.019 1.00174.88 C ANISOU 8809 CD1 TYR D 399 21813 18004 26630 -3407 11173 -683 C ATOM 8810 CD2 TYR D 399 169.637 188.019 110.027 1.00165.91 C ANISOU 8810 CD2 TYR D 399 21259 17384 24394 -2936 10373 -701 C ATOM 8811 CE1 TYR D 399 170.411 190.492 109.052 1.00175.78 C ANISOU 8811 CE1 TYR D 399 22957 17920 25912 -3441 11388 -477 C ATOM 8812 CE2 TYR D 399 168.864 188.660 109.060 1.00167.41 C ANISOU 8812 CE2 TYR D 399 22442 17392 23775 -2974 10536 -522 C ATOM 8813 CZ TYR D 399 169.258 189.895 108.570 1.00177.69 C ANISOU 8813 CZ TYR D 399 23989 18338 25188 -3211 11045 -399 C ATOM 8814 OH TYR D 399 168.504 190.528 107.611 1.00178.39 O ANISOU 8814 OH TYR D 399 25100 18226 24454 -3219 11183 -195 O ATOM 8815 N ASN D 400 169.132 187.733 113.467 1.00152.06 N ANISOU 8815 N ASN D 400 17863 16504 23409 -2692 8298 -966 N ATOM 8816 CA ASN D 400 167.698 187.845 113.720 1.00146.55 C ANISOU 8816 CA ASN D 400 17681 16054 21945 -2550 7629 -880 C ATOM 8817 C ASN D 400 167.415 188.685 114.975 1.00147.53 C ANISOU 8817 C ASN D 400 17418 16376 22262 -2567 6926 -943 C ATOM 8818 O ASN D 400 166.451 189.446 114.977 1.00144.38 O ANISOU 8818 O ASN D 400 17480 16008 21372 -2561 6609 -858 O ATOM 8819 CB ASN D 400 167.060 186.449 113.847 1.00144.52 C ANISOU 8819 CB ASN D 400 17516 16065 21332 -2291 7311 -885 C ATOM 8820 CG ASN D 400 167.044 185.612 112.576 1.00165.23 C ANISOU 8820 CG ASN D 400 20705 18501 23574 -2245 7891 -844 C ATOM 8821 OD1 ASN D 400 167.034 186.121 111.444 1.00162.70 O ANISOU 8821 OD1 ASN D 400 21023 17893 22903 -2363 8425 -757 O ATOM 8822 ND2 ASN D 400 166.979 184.296 112.741 1.00151.98 N ANISOU 8822 ND2 ASN D 400 18877 16970 21898 -2059 7775 -902 N ATOM 8823 N GLU D 401 168.270 188.574 116.015 1.00145.42 N ANISOU 8823 N GLU D 401 16328 16216 22709 -2576 6685 -1100 N ATOM 8824 CA GLU D 401 168.138 189.320 117.268 1.00143.88 C ANISOU 8824 CA GLU D 401 15758 16193 22717 -2585 6016 -1206 C ATOM 8825 C GLU D 401 168.495 190.789 117.088 1.00151.08 C ANISOU 8825 C GLU D 401 16713 16800 23892 -2863 6230 -1232 C ATOM 8826 O GLU D 401 167.818 191.642 117.665 1.00148.80 O ANISOU 8826 O GLU D 401 16589 16583 23366 -2862 5759 -1249 O ATOM 8827 CB GLU D 401 169.005 188.699 118.380 1.00146.43 C ANISOU 8827 CB GLU D 401 15235 16699 23702 -2496 5661 -1374 C ATOM 8828 CG GLU D 401 168.306 187.606 119.178 1.00155.03 C ANISOU 8828 CG GLU D 401 16289 18173 24443 -2185 5078 -1348 C ATOM 8829 CD GLU D 401 167.041 188.001 119.920 1.00174.58 C ANISOU 8829 CD GLU D 401 19105 20907 26319 -2057 4440 -1307 C ATOM 8830 OE1 GLU D 401 167.006 189.111 120.501 1.00169.78 O ANISOU 8830 OE1 GLU D 401 18432 20275 25801 -2159 4154 -1397 O ATOM 8831 OE2 GLU D 401 166.088 187.189 119.933 1.00167.08 O ANISOU 8831 OE2 GLU D 401 18470 20165 24847 -1853 4242 -1194 O ATOM 8832 N VAL D 402 169.555 191.083 116.298 1.00152.87 N ANISOU 8832 N VAL D 402 16790 16659 24635 -3100 6975 -1236 N ATOM 8833 CA VAL D 402 170.019 192.449 116.016 1.00156.68 C ANISOU 8833 CA VAL D 402 17300 16771 25462 -3407 7310 -1242 C ATOM 8834 C VAL D 402 168.968 193.154 115.140 1.00159.29 C ANISOU 8834 C VAL D 402 18586 16947 24989 -3416 7473 -1025 C ATOM 8835 O VAL D 402 168.526 194.246 115.499 1.00158.06 O ANISOU 8835 O VAL D 402 18599 16717 24740 -3494 7166 -1028 O ATOM 8836 CB VAL D 402 171.445 192.481 115.391 1.00167.32 C ANISOU 8836 CB VAL D 402 18195 17747 27632 -3656 8142 -1284 C ATOM 8837 CG1 VAL D 402 171.807 193.872 114.872 1.00171.73 C ANISOU 8837 CG1 VAL D 402 18938 17853 28458 -3992 8631 -1230 C ATOM 8838 CG2 VAL D 402 172.496 192.004 116.392 1.00169.25 C ANISOU 8838 CG2 VAL D 402 17400 18118 28788 -3653 7841 -1520 C ATOM 8839 N LEU D 403 168.534 192.505 114.037 1.00156.15 N ANISOU 8839 N LEU D 403 18826 16505 23997 -3311 7891 -852 N ATOM 8840 CA LEU D 403 167.521 193.019 113.109 1.00155.75 C ANISOU 8840 CA LEU D 403 19733 16315 23130 -3275 8000 -633 C ATOM 8841 C LEU D 403 166.203 193.349 113.834 1.00156.50 C ANISOU 8841 C LEU D 403 20052 16697 22713 -3086 7150 -618 C ATOM 8842 O LEU D 403 165.603 194.390 113.552 1.00156.78 O ANISOU 8842 O LEU D 403 20585 16553 22430 -3130 7088 -499 O ATOM 8843 CB LEU D 403 167.263 192.006 111.987 1.00156.02 C ANISOU 8843 CB LEU D 403 20346 16331 22605 -3143 8418 -514 C ATOM 8844 CG LEU D 403 166.360 192.470 110.850 1.00161.31 C ANISOU 8844 CG LEU D 403 22061 16805 22426 -3107 8586 -287 C ATOM 8845 CD1 LEU D 403 167.174 192.979 109.685 1.00168.19 C ANISOU 8845 CD1 LEU D 403 23343 17195 23368 -3322 9554 -156 C ATOM 8846 CD2 LEU D 403 165.445 191.353 110.404 1.00160.81 C ANISOU 8846 CD2 LEU D 403 22476 16972 21654 -2855 8324 -250 C ATOM 8847 N SER D 404 165.771 192.473 114.774 1.00149.71 N ANISOU 8847 N SER D 404 18822 16255 21805 -2867 6533 -727 N ATOM 8848 CA SER D 404 164.553 192.657 115.569 1.00145.17 C ANISOU 8848 CA SER D 404 18370 15973 20815 -2669 5776 -725 C ATOM 8849 C SER D 404 164.671 193.872 116.474 1.00149.69 C ANISOU 8849 C SER D 404 18667 16485 21725 -2775 5458 -839 C ATOM 8850 O SER D 404 163.692 194.604 116.624 1.00147.75 O ANISOU 8850 O SER D 404 18794 16251 21092 -2690 5117 -775 O ATOM 8851 CB SER D 404 164.251 191.417 116.400 1.00145.83 C ANISOU 8851 CB SER D 404 18077 16470 20863 -2440 5310 -807 C ATOM 8852 OG SER D 404 163.829 190.350 115.567 1.00156.79 O ANISOU 8852 OG SER D 404 19841 17908 21824 -2319 5495 -704 O ATOM 8853 N PHE D 405 165.870 194.098 117.058 1.00148.98 N ANISOU 8853 N PHE D 405 17918 16304 22383 -2956 5559 -1021 N ATOM 8854 CA PHE D 405 166.133 195.249 117.917 1.00150.20 C ANISOU 8854 CA PHE D 405 17782 16354 22932 -3093 5260 -1182 C ATOM 8855 C PHE D 405 166.105 196.535 117.091 1.00157.55 C ANISOU 8855 C PHE D 405 19200 16836 23825 -3309 5682 -1060 C ATOM 8856 O PHE D 405 165.545 197.531 117.543 1.00156.34 O ANISOU 8856 O PHE D 405 19231 16615 23557 -3305 5343 -1093 O ATOM 8857 CB PHE D 405 167.473 195.102 118.665 1.00155.13 C ANISOU 8857 CB PHE D 405 17560 16967 24414 -3246 5233 -1423 C ATOM 8858 CG PHE D 405 167.854 196.321 119.469 1.00159.18 C ANISOU 8858 CG PHE D 405 17783 17309 25388 -3433 4939 -1628 C ATOM 8859 CD1 PHE D 405 167.185 196.633 120.642 1.00159.33 C ANISOU 8859 CD1 PHE D 405 17778 17580 25182 -3266 4202 -1772 C ATOM 8860 CD2 PHE D 405 168.862 197.172 119.036 1.00167.00 C ANISOU 8860 CD2 PHE D 405 18558 17858 27038 -3781 5430 -1683 C ATOM 8861 CE1 PHE D 405 167.526 197.767 121.376 1.00163.04 C ANISOU 8861 CE1 PHE D 405 18035 17864 26047 -3436 3916 -1997 C ATOM 8862 CE2 PHE D 405 169.198 198.310 119.768 1.00172.56 C ANISOU 8862 CE2 PHE D 405 19005 18365 28193 -3975 5134 -1899 C ATOM 8863 CZ PHE D 405 168.530 198.599 120.933 1.00167.72 C ANISOU 8863 CZ PHE D 405 18399 18009 27318 -3798 4358 -2068 C ATOM 8864 N CYS D 406 166.693 196.499 115.879 1.00158.49 N ANISOU 8864 N CYS D 406 19569 16631 24020 -3479 6448 -909 N ATOM 8865 CA CYS D 406 166.739 197.633 114.954 1.00162.66 C ANISOU 8865 CA CYS D 406 20638 16684 24482 -3684 6967 -737 C ATOM 8866 C CYS D 406 165.330 197.984 114.474 1.00163.84 C ANISOU 8866 C CYS D 406 21626 16857 23768 -3471 6710 -520 C ATOM 8867 O CYS D 406 165.000 199.166 114.381 1.00165.07 O ANISOU 8867 O CYS D 406 22126 16734 23858 -3546 6688 -445 O ATOM 8868 CB CYS D 406 167.672 197.343 113.781 1.00168.07 C ANISOU 8868 CB CYS D 406 21435 17045 25378 -3874 7892 -612 C ATOM 8869 SG CYS D 406 169.425 197.231 114.232 1.00177.21 S ANISOU 8869 SG CYS D 406 21549 18040 27744 -4177 8299 -852 S ATOM 8870 N LEU D 407 164.493 196.966 114.207 1.00156.75 N ANISOU 8870 N LEU D 407 21022 16276 22261 -3203 6479 -432 N ATOM 8871 CA LEU D 407 163.117 197.170 113.758 1.00154.48 C ANISOU 8871 CA LEU D 407 21454 16038 21202 -2979 6157 -242 C ATOM 8872 C LEU D 407 162.210 197.684 114.897 1.00155.36 C ANISOU 8872 C LEU D 407 21397 16380 21253 -2808 5407 -345 C ATOM 8873 O LEU D 407 161.225 198.372 114.615 1.00155.40 O ANISOU 8873 O LEU D 407 21927 16286 20831 -2681 5187 -200 O ATOM 8874 CB LEU D 407 162.550 195.888 113.140 1.00152.22 C ANISOU 8874 CB LEU D 407 21472 15995 20371 -2775 6123 -154 C ATOM 8875 CG LEU D 407 162.961 195.635 111.689 1.00161.19 C ANISOU 8875 CG LEU D 407 23199 16826 21219 -2867 6840 21 C ATOM 8876 CD1 LEU D 407 162.973 194.157 111.373 1.00159.74 C ANISOU 8876 CD1 LEU D 407 22984 16881 20828 -2742 6905 -26 C ATOM 8877 CD2 LEU D 407 162.059 196.385 110.720 1.00165.84 C ANISOU 8877 CD2 LEU D 407 24714 17165 21133 -2786 6833 275 C ATOM 8878 N THR D 408 162.559 197.381 116.172 1.00148.93 N ANISOU 8878 N THR D 408 19876 15846 20864 -2791 5030 -592 N ATOM 8879 CA THR D 408 161.836 197.854 117.361 1.00145.38 C ANISOU 8879 CA THR D 408 19247 15605 20385 -2634 4384 -727 C ATOM 8880 C THR D 408 162.151 199.347 117.553 1.00151.42 C ANISOU 8880 C THR D 408 20068 15990 21475 -2823 4453 -793 C ATOM 8881 O THR D 408 161.249 200.120 117.882 1.00149.84 O ANISOU 8881 O THR D 408 20141 15760 21033 -2682 4112 -777 O ATOM 8882 CB THR D 408 162.196 196.997 118.583 1.00151.51 C ANISOU 8882 CB THR D 408 19347 16771 21447 -2550 4006 -953 C ATOM 8883 OG1 THR D 408 161.825 195.645 118.312 1.00150.26 O ANISOU 8883 OG1 THR D 408 19212 16906 20975 -2376 3978 -861 O ATOM 8884 CG2 THR D 408 161.504 197.461 119.860 1.00147.45 C ANISOU 8884 CG2 THR D 408 18693 16467 20863 -2378 3392 -1107 C ATOM 8885 N VAL D 409 163.427 199.742 117.315 1.00151.75 N ANISOU 8885 N VAL D 409 19841 15712 22106 -3144 4925 -866 N ATOM 8886 CA VAL D 409 163.915 201.128 117.387 1.00155.45 C ANISOU 8886 CA VAL D 409 20328 15736 23001 -3396 5093 -933 C ATOM 8887 C VAL D 409 163.184 201.944 116.304 1.00159.74 C ANISOU 8887 C VAL D 409 21698 15925 23073 -3364 5369 -630 C ATOM 8888 O VAL D 409 162.686 203.036 116.592 1.00160.06 O ANISOU 8888 O VAL D 409 21974 15755 23085 -3340 5150 -640 O ATOM 8889 CB VAL D 409 165.471 201.208 117.257 1.00164.34 C ANISOU 8889 CB VAL D 409 20926 16586 24930 -3765 5605 -1057 C ATOM 8890 CG1 VAL D 409 165.956 202.643 117.054 1.00169.45 C ANISOU 8890 CG1 VAL D 409 21689 16678 26017 -4070 5916 -1068 C ATOM 8891 CG2 VAL D 409 166.163 200.584 118.466 1.00163.29 C ANISOU 8891 CG2 VAL D 409 19962 16773 25306 -3770 5184 -1379 C ATOM 8892 N LEU D 410 163.081 201.376 115.082 1.00156.25 N ANISOU 8892 N LEU D 410 21726 15419 22222 -3332 5808 -367 N ATOM 8893 CA LEU D 410 162.405 201.976 113.932 1.00158.06 C ANISOU 8893 CA LEU D 410 22819 15329 21907 -3266 6055 -46 C ATOM 8894 C LEU D 410 160.911 202.155 114.210 1.00159.12 C ANISOU 8894 C LEU D 410 23304 15673 21480 -2917 5397 25 C ATOM 8895 O LEU D 410 160.370 203.219 113.903 1.00161.41 O ANISOU 8895 O LEU D 410 24086 15646 21598 -2870 5359 175 O ATOM 8896 CB LEU D 410 162.620 201.114 112.674 1.00159.39 C ANISOU 8896 CB LEU D 410 23403 15459 21698 -3270 6587 166 C ATOM 8897 CG LEU D 410 162.066 201.672 111.366 1.00167.21 C ANISOU 8897 CG LEU D 410 25372 16086 22075 -3210 6890 514 C ATOM 8898 CD1 LEU D 410 163.145 202.397 110.572 1.00174.07 C ANISOU 8898 CD1 LEU D 410 26474 16399 23267 -3540 7753 654 C ATOM 8899 CD2 LEU D 410 161.423 200.572 110.549 1.00167.72 C ANISOU 8899 CD2 LEU D 410 25904 16388 21436 -2982 6828 652 C ATOM 8900 N SER D 411 160.258 201.132 114.811 1.00150.64 N ANISOU 8900 N SER D 411 21954 15107 20178 -2672 4899 -79 N ATOM 8901 CA SER D 411 158.834 201.142 115.161 1.00147.27 C ANISOU 8901 CA SER D 411 21728 14922 19308 -2336 4289 -33 C ATOM 8902 C SER D 411 158.487 202.320 116.085 1.00152.53 C ANISOU 8902 C SER D 411 22283 15465 20206 -2288 3959 -164 C ATOM 8903 O SER D 411 157.445 202.954 115.892 1.00152.32 O ANISOU 8903 O SER D 411 22679 15332 19863 -2074 3703 -24 O ATOM 8904 CB SER D 411 158.437 199.824 115.820 1.00146.29 C ANISOU 8904 CB SER D 411 21182 15330 19071 -2151 3909 -157 C ATOM 8905 OG SER D 411 157.080 199.830 116.234 1.00153.60 O ANISOU 8905 OG SER D 411 22215 16482 19666 -1843 3364 -124 O ATOM 8906 N ARG D 412 159.367 202.618 117.069 1.00150.27 N ANISOU 8906 N ARG D 412 21440 15172 20483 -2478 3951 -443 N ATOM 8907 CA ARG D 412 159.200 203.724 118.016 1.00151.05 C ANISOU 8907 CA ARG D 412 21424 15128 20843 -2467 3660 -635 C ATOM 8908 C ARG D 412 159.289 205.064 117.291 1.00160.60 C ANISOU 8908 C ARG D 412 23136 15751 22134 -2608 3980 -475 C ATOM 8909 O ARG D 412 158.478 205.952 117.559 1.00160.59 O ANISOU 8909 O ARG D 412 23404 15597 22014 -2434 3710 -462 O ATOM 8910 CB ARG D 412 160.243 203.657 119.142 1.00150.86 C ANISOU 8910 CB ARG D 412 20717 15207 21396 -2665 3559 -989 C ATOM 8911 CG ARG D 412 160.007 202.529 120.137 1.00153.93 C ANISOU 8911 CG ARG D 412 20653 16155 21677 -2463 3127 -1159 C ATOM 8912 CD ARG D 412 160.790 202.727 121.420 1.00164.66 C ANISOU 8912 CD ARG D 412 21460 17591 23512 -2579 2851 -1525 C ATOM 8913 NE ARG D 412 162.235 202.594 121.225 1.00175.59 N ANISOU 8913 NE ARG D 412 22428 18803 25484 -2923 3181 -1630 N ATOM 8914 CZ ARG D 412 162.922 201.467 121.384 1.00185.58 C ANISOU 8914 CZ ARG D 412 23236 20346 26929 -2954 3204 -1687 C ATOM 8915 NH1 ARG D 412 162.302 200.346 121.742 1.00166.26 N ANISOU 8915 NH1 ARG D 412 20726 18360 24087 -2674 2922 -1639 N ATOM 8916 NH2 ARG D 412 164.233 201.448 121.191 1.00174.94 N ANISOU 8916 NH2 ARG D 412 21471 18796 26203 -3263 3522 -1786 N ATOM 8917 N ARG D 413 160.254 205.196 116.357 1.00162.18 N ANISOU 8917 N ARG D 413 23481 15601 22540 -2909 4591 -338 N ATOM 8918 CA ARG D 413 160.462 206.401 115.552 1.00168.10 C ANISOU 8918 CA ARG D 413 24753 15741 23375 -3079 5014 -135 C ATOM 8919 C ARG D 413 159.293 206.609 114.583 1.00173.41 C ANISOU 8919 C ARG D 413 26225 16304 23358 -2789 4940 226 C ATOM 8920 O ARG D 413 158.891 207.750 114.350 1.00176.22 O ANISOU 8920 O ARG D 413 27029 16249 23677 -2745 4943 362 O ATOM 8921 CB ARG D 413 161.797 206.333 114.797 1.00173.84 C ANISOU 8921 CB ARG D 413 25407 16149 24493 -3467 5760 -63 C ATOM 8922 CG ARG D 413 163.011 206.500 115.710 1.00189.20 C ANISOU 8922 CG ARG D 413 26570 18042 27277 -3795 5825 -417 C ATOM 8923 CD ARG D 413 164.304 206.620 114.927 1.00209.41 C ANISOU 8923 CD ARG D 413 29038 20193 30337 -4194 6629 -330 C ATOM 8924 NE ARG D 413 165.470 206.699 115.809 1.00221.36 N ANISOU 8924 NE ARG D 413 29622 21979 32505 -4369 6123 -535 N ATOM 8925 CZ ARG D 413 166.085 207.829 116.150 1.00234.43 C ANISOU 8925 CZ ARG D 413 30929 24117 34028 -4268 4718 -190 C ATOM 8926 NH1 ARG D 413 165.656 208.996 115.683 1.00227.09 N ANISOU 8926 NH1 ARG D 413 30585 22428 33273 -4433 5336 -179 N ATOM 8927 NH2 ARG D 413 167.138 207.800 116.957 1.00227.53 N ANISOU 8927 NH2 ARG D 413 29466 22965 34020 -4660 5095 -629 N ATOM 8928 N PHE D 414 158.731 205.502 114.055 1.00167.74 N ANISOU 8928 N PHE D 414 25673 15944 22118 -2581 4823 365 N ATOM 8929 CA PHE D 414 157.581 205.494 113.147 1.00168.12 C ANISOU 8929 CA PHE D 414 26427 15959 21493 -2282 4631 677 C ATOM 8930 C PHE D 414 156.302 205.913 113.869 1.00170.35 C ANISOU 8930 C PHE D 414 26686 16398 21642 -1937 3966 624 C ATOM 8931 O PHE D 414 155.417 206.502 113.247 1.00171.72 O ANISOU 8931 O PHE D 414 27440 16349 21457 -1712 3796 873 O ATOM 8932 CB PHE D 414 157.394 204.098 112.530 1.00167.65 C ANISOU 8932 CB PHE D 414 26444 16261 20996 -2183 4629 757 C ATOM 8933 CG PHE D 414 158.115 203.805 111.231 1.00173.27 C ANISOU 8933 CG PHE D 414 27651 16708 21476 -2367 5280 975 C ATOM 8934 CD1 PHE D 414 159.166 204.610 110.798 1.00181.56 C ANISOU 8934 CD1 PHE D 414 28864 17263 22859 -2682 5952 1059 C ATOM 8935 CD2 PHE D 414 157.777 202.695 110.467 1.00174.54 C ANISOU 8935 CD2 PHE D 414 28105 17099 21113 -2236 5260 1079 C ATOM 8936 CE1 PHE D 414 159.828 204.337 109.598 1.00186.72 C ANISOU 8936 CE1 PHE D 414 30008 17655 23281 -2839 6639 1271 C ATOM 8937 CE2 PHE D 414 158.442 202.421 109.269 1.00181.62 C ANISOU 8937 CE2 PHE D 414 29525 17738 21743 -2386 5902 1262 C ATOM 8938 CZ PHE D 414 159.463 203.244 108.843 1.00184.90 C ANISOU 8938 CZ PHE D 414 30125 17666 22461 -2678 6615 1367 C ATOM 8939 N GLU D 415 156.202 205.599 115.177 1.00163.95 N ANISOU 8939 N GLU D 415 25218 15961 21115 -1874 3600 309 N ATOM 8940 CA GLU D 415 155.051 205.952 116.012 1.00161.89 C ANISOU 8940 CA GLU D 415 24856 15866 20788 -1549 3045 216 C ATOM 8941 C GLU D 415 155.065 207.445 116.353 1.00169.08 C ANISOU 8941 C GLU D 415 25939 16315 21989 -1576 3065 165 C ATOM 8942 O GLU D 415 154.010 208.081 116.331 1.00169.08 O ANISOU 8942 O GLU D 415 26238 16194 21812 -1281 2768 275 O ATOM 8943 CB GLU D 415 155.009 205.094 117.284 1.00158.84 C ANISOU 8943 CB GLU D 415 23788 16005 20558 -1478 2728 -90 C ATOM 8944 CG GLU D 415 154.360 203.735 117.068 1.00165.77 C ANISOU 8944 CG GLU D 415 24570 17341 21074 -1291 2513 -5 C ATOM 8945 CD GLU D 415 152.874 203.783 116.754 1.00185.00 C ANISOU 8945 CD GLU D 415 27305 19845 23141 -927 2116 179 C ATOM 8946 OE1 GLU D 415 152.101 204.252 117.619 1.00184.35 O ANISOU 8946 OE1 GLU D 415 27053 19838 23154 -700 1796 68 O ATOM 8947 OE2 GLU D 415 152.482 203.368 115.639 1.00176.35 O ANISOU 8947 OE2 GLU D 415 26621 18710 21675 -862 2120 424 O ATOM 8948 N PHE D 416 156.260 208.005 116.630 1.00168.54 N ANISOU 8948 N PHE D 416 25673 15958 22406 -1932 3415 -2 N ATOM 8949 CA PHE D 416 156.452 209.426 116.920 1.00172.68 C ANISOU 8949 CA PHE D 416 26355 15973 23281 -2032 3493 -79 C ATOM 8950 C PHE D 416 156.112 210.282 115.703 1.00180.61 C ANISOU 8950 C PHE D 416 28130 16448 24047 -1984 3747 314 C ATOM 8951 O PHE D 416 155.560 211.373 115.861 1.00182.69 O ANISOU 8951 O PHE D 416 28678 16362 24373 -1836 3601 346 O ATOM 8952 CB PHE D 416 157.897 209.706 117.358 1.00177.41 C ANISOU 8952 CB PHE D 416 26536 16366 24505 -2476 3827 -339 C ATOM 8953 CG PHE D 416 158.170 209.602 118.839 1.00177.48 C ANISOU 8953 CG PHE D 416 25910 16660 24862 -2500 3454 -791 C ATOM 8954 CD1 PHE D 416 157.521 210.439 119.743 1.00181.34 C ANISOU 8954 CD1 PHE D 416 26432 17061 25409 -2305 3082 -999 C ATOM 8955 CD2 PHE D 416 159.130 208.724 119.323 1.00178.55 C ANISOU 8955 CD2 PHE D 416 25453 17106 25280 -2715 3488 -1015 C ATOM 8956 CE1 PHE D 416 157.790 210.357 121.110 1.00181.29 C ANISOU 8956 CE1 PHE D 416 25931 17300 25649 -2316 2738 -1427 C ATOM 8957 CE2 PHE D 416 159.417 208.661 120.688 1.00180.53 C ANISOU 8957 CE2 PHE D 416 25186 17596 25812 -2725 3100 -1426 C ATOM 8958 CZ PHE D 416 158.736 209.469 121.573 1.00179.04 C ANISOU 8958 CZ PHE D 416 25096 17337 25595 -2526 2726 -1632 C ATOM 8959 N GLN D 417 156.451 209.781 114.494 1.00178.33 N ANISOU 8959 N GLN D 417 28212 16081 23465 -2094 4135 612 N ATOM 8960 CA GLN D 417 156.191 210.438 113.211 1.00182.71 C ANISOU 8960 CA GLN D 417 29598 16149 23675 -2042 4408 1032 C ATOM 8961 C GLN D 417 154.687 210.493 112.932 1.00185.18 C ANISOU 8961 C GLN D 417 30319 16572 23470 -1562 3856 1238 C ATOM 8962 O GLN D 417 154.192 211.516 112.452 1.00188.83 O ANISOU 8962 O GLN D 417 31350 16578 23819 -1410 3828 1480 O ATOM 8963 CB GLN D 417 156.930 209.716 112.072 1.00185.74 C ANISOU 8963 CB GLN D 417 30270 16493 23808 -2255 4959 1255 C ATOM 8964 CG GLN D 417 158.408 210.087 111.968 1.00204.78 C ANISOU 8964 CG GLN D 417 32500 18529 26778 -2737 5671 1188 C ATOM 8965 CD GLN D 417 159.156 209.303 110.912 1.00222.37 C ANISOU 8965 CD GLN D 417 34334 21251 28907 -2796 5594 1458 C ATOM 8966 OE1 GLN D 417 158.642 208.996 109.828 1.00218.61 O ANISOU 8966 OE1 GLN D 417 34580 20685 27798 -2639 5762 1758 O ATOM 8967 NE2 GLN D 417 160.414 209.002 111.191 1.00218.39 N ANISOU 8967 NE2 GLN D 417 33461 20618 28901 -3188 6193 1250 N ATOM 8968 N ALA D 418 153.963 209.404 113.261 1.00176.40 N ANISOU 8968 N ALA D 418 28882 16041 22099 -1322 3408 1141 N ATOM 8969 CA ALA D 418 152.514 209.302 113.095 1.00175.09 C ANISOU 8969 CA ALA D 418 28937 16044 21544 -873 2836 1290 C ATOM 8970 C ALA D 418 151.779 210.179 114.114 1.00179.16 C ANISOU 8970 C ALA D 418 29222 16493 22360 -631 2467 1120 C ATOM 8971 O ALA D 418 150.680 210.651 113.818 1.00180.32 O ANISOU 8971 O ALA D 418 29697 16508 22309 -273 2108 1310 O ATOM 8972 CB ALA D 418 152.077 207.860 113.229 1.00170.97 C ANISOU 8972 CB ALA D 418 28051 16132 20778 -755 2537 1201 C ATOM 8973 N ASP D 419 152.387 210.400 115.306 1.00174.84 N ANISOU 8973 N ASP D 419 28124 16018 22289 -811 2542 753 N ATOM 8974 CA ASP D 419 151.843 211.270 116.358 1.00175.21 C ANISOU 8974 CA ASP D 419 27977 15966 22631 -614 2270 531 C ATOM 8975 C ASP D 419 152.025 212.730 115.960 1.00183.73 C ANISOU 8975 C ASP D 419 29569 16343 23896 -669 2491 672 C ATOM 8976 O ASP D 419 151.142 213.549 116.216 1.00184.70 O ANISOU 8976 O ASP D 419 29864 16252 24063 -353 2224 696 O ATOM 8977 CB ASP D 419 152.507 210.993 117.721 1.00174.84 C ANISOU 8977 CB ASP D 419 27262 16209 22960 -800 2259 79 C ATOM 8978 CG ASP D 419 152.090 209.690 118.380 1.00183.74 C ANISOU 8978 CG ASP D 419 27881 18007 23926 -651 1969 -73 C ATOM 8979 OD1 ASP D 419 150.884 209.353 118.328 1.00182.97 O ANISOU 8979 OD1 ASP D 419 27813 18139 23569 -286 1632 46 O ATOM 8980 OD2 ASP D 419 152.967 209.010 118.958 1.00189.57 O ANISOU 8980 OD2 ASP D 419 28176 19020 24831 -896 2074 -307 O ATOM 8981 N ALA D 420 153.169 213.042 115.314 1.00183.37 N ANISOU 8981 N ALA D 420 29766 15917 23990 -1066 3014 778 N ATOM 8982 CA ALA D 420 153.517 214.367 114.799 1.00189.26 C ANISOU 8982 CA ALA D 420 31043 15935 24933 -1197 3343 960 C ATOM 8983 C ALA D 420 152.594 214.749 113.634 1.00196.20 C ANISOU 8983 C ALA D 420 32693 16523 25329 -865 3227 1437 C ATOM 8984 O ALA D 420 152.278 215.930 113.462 1.00200.42 O ANISOU 8984 O ALA D 420 33665 16512 25974 -740 3235 1586 O ATOM 8985 CB ALA D 420 154.969 214.383 114.349 1.00192.76 C ANISOU 8985 CB ALA D 420 31490 16103 25648 -1717 3984 976 C ATOM 8986 N PHE D 421 152.161 213.739 112.845 1.00190.35 N ANISOU 8986 N PHE D 421 32133 16133 24057 -715 3084 1665 N ATOM 8987 CA PHE D 421 151.237 213.897 111.720 1.00192.88 C ANISOU 8987 CA PHE D 421 33174 16267 23844 -372 2850 2099 C ATOM 8988 C PHE D 421 149.834 214.223 112.242 1.00194.81 C ANISOU 8988 C PHE D 421 33295 16623 24100 129 2197 2066 C ATOM 8989 O PHE D 421 149.120 215.003 111.610 1.00198.79 O ANISOU 8989 O PHE D 421 34378 16728 24427 429 2000 2378 O ATOM 8990 CB PHE D 421 151.217 212.627 110.851 1.00192.91 C ANISOU 8990 CB PHE D 421 33335 16653 23307 -378 2833 2261 C ATOM 8991 CG PHE D 421 150.405 212.739 109.581 1.00198.60 C ANISOU 8991 CG PHE D 421 34885 17161 23414 -64 2585 2704 C ATOM 8992 CD1 PHE D 421 150.976 213.227 108.413 1.00207.67 C ANISOU 8992 CD1 PHE D 421 36869 17792 24245 -211 3059 3071 C ATOM 8993 CD2 PHE D 421 149.072 212.345 109.550 1.00199.42 C ANISOU 8993 CD2 PHE D 421 34941 17569 23262 379 1871 2757 C ATOM 8994 CE1 PHE D 421 150.225 213.327 107.239 1.00210.50 C ANISOU 8994 CE1 PHE D 421 37478 18260 24242 70 2596 3478 C ATOM 8995 CE2 PHE D 421 148.326 212.434 108.372 1.00206.54 C ANISOU 8995 CE2 PHE D 421 36606 18273 23599 679 1548 3150 C ATOM 8996 CZ PHE D 421 148.905 212.933 107.228 1.00209.63 C ANISOU 8996 CZ PHE D 421 37680 18262 23708 535 1931 3509 C ATOM 8997 N ALA D 422 149.444 213.621 113.390 1.00185.29 N ANISOU 8997 N ALA D 422 31346 15943 23114 234 1885 1702 N ATOM 8998 CA ALA D 422 148.154 213.854 114.047 1.00183.82 C ANISOU 8998 CA ALA D 422 30914 15901 23029 693 1351 1616 C ATOM 8999 C ALA D 422 148.081 215.285 114.586 1.00191.02 C ANISOU 8999 C ALA D 422 31959 16281 24340 786 1417 1532 C ATOM 9000 O ALA D 422 147.013 215.901 114.544 1.00193.05 O ANISOU 9000 O ALA D 422 32392 16345 24612 1212 1068 1663 O ATOM 9001 CB ALA D 422 147.948 212.854 115.169 1.00178.62 C ANISOU 9001 CB ALA D 422 29467 15893 22508 716 1154 1249 C ATOM 9002 N LYS D 423 149.231 215.817 115.062 1.00188.18 N ANISOU 9002 N LYS D 423 31511 15652 24336 384 1859 1309 N ATOM 9003 CA LYS D 423 149.381 217.190 115.554 1.00191.86 C ANISOU 9003 CA LYS D 423 32135 15542 25220 375 1991 1189 C ATOM 9004 C LYS D 423 149.332 218.161 114.382 1.00201.66 C ANISOU 9004 C LYS D 423 34197 16096 26331 433 2164 1644 C ATOM 9005 O LYS D 423 148.802 219.264 114.526 1.00205.20 O ANISOU 9005 O LYS D 423 34915 16070 26982 685 2055 1695 O ATOM 9006 CB LYS D 423 150.693 217.354 116.332 1.00193.95 C ANISOU 9006 CB LYS D 423 32041 15732 25919 -121 2372 805 C ATOM 9007 N LYS D 424 149.866 217.732 113.214 1.00199.22 N ANISOU 9007 N LYS D 424 34321 15718 25656 222 2447 1984 N ATOM 9008 CA LYS D 424 149.878 218.490 111.961 1.00205.06 C ANISOU 9008 CA LYS D 424 35946 15834 26135 266 2657 2480 C ATOM 9009 C LYS D 424 148.456 218.610 111.387 1.00210.16 C ANISOU 9009 C LYS D 424 36987 16466 26399 855 2065 2806 C ATOM 9010 O LYS D 424 148.185 219.547 110.632 1.00213.49 O ANISOU 9010 O LYS D 424 37551 16593 26974 971 1912 3169 O ATOM 9011 CB LYS D 424 150.822 217.837 110.939 1.00208.22 C ANISOU 9011 CB LYS D 424 36679 16245 26191 -102 3144 2715 C ATOM 9012 N LEU D 425 147.552 217.673 111.756 1.00201.31 N ATOM 9013 CA LEU D 425 146.144 217.674 111.346 1.00202.38 C ATOM 9014 C LEU D 425 145.307 218.568 112.269 1.00207.63 C ATOM 9015 O LEU D 425 144.183 218.933 111.915 1.00210.36 O ATOM 9016 CB LEU D 425 145.570 216.249 111.332 1.00197.26 C ATOM 9017 CG LEU D 425 146.013 215.335 110.189 1.00201.79 C ATOM 9018 CD1 LEU D 425 145.800 213.886 110.557 1.00195.81 C ATOM 9019 CD2 LEU D 425 145.271 215.655 108.895 1.00209.75 C