>>2YPT:HELIX   23  23 THR B  159  GLY B  192  1                                  34    
TLGFFMKDAIKKFVVTQCILLPVSSLLLYIIKIG
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 23 23 THR B 159 GLY B 192 1 34 ATOM 4241 N THR B 159 127.649 174.825 192.442 1.00138.68 N ANISOU 4241 N THR B 159 13761 18271 20661 -2262 -1445 -1214 N ATOM 4242 CA THR B 159 127.142 176.025 191.783 1.00138.63 C ANISOU 4242 CA THR B 159 13417 18571 20686 -2098 -1476 -1103 C ATOM 4243 C THR B 159 128.099 177.159 192.176 1.00137.79 C ANISOU 4243 C THR B 159 13542 18508 20303 -1793 -1246 -1055 C ATOM 4244 O THR B 159 128.841 177.008 193.152 1.00135.40 O ANISOU 4244 O THR B 159 13580 18002 19865 -1758 -1031 -1064 O ATOM 4245 CB THR B 159 125.653 176.286 192.116 1.00153.47 C ANISOU 4245 CB THR B 159 14816 20512 22984 -2226 -1309 -871 C ATOM 4246 OG1 THR B 159 125.266 177.557 191.585 1.00155.86 O ANISOU 4246 OG1 THR B 159 14818 21087 23315 -2011 -1301 -731 O ATOM 4247 CG2 THR B 159 125.342 176.226 193.612 1.00152.37 C ANISOU 4247 CG2 THR B 159 14749 20144 22999 -2286 -828 -698 C ATOM 4248 N LEU B 160 128.105 178.275 191.421 1.00133.06 N ANISOU 4248 N LEU B 160 12774 18163 19621 -1582 -1310 -999 N ATOM 4249 CA LEU B 160 128.991 179.407 191.709 1.00129.75 C ANISOU 4249 CA LEU B 160 12551 17774 18973 -1310 -1106 -955 C ATOM 4250 C LEU B 160 128.707 180.003 193.093 1.00133.10 C ANISOU 4250 C LEU B 160 13014 18053 19503 -1268 -654 -784 C ATOM 4251 O LEU B 160 129.636 180.460 193.761 1.00130.73 O ANISOU 4251 O LEU B 160 13035 17646 18990 -1140 -477 -808 O ATOM 4252 CB LEU B 160 128.890 180.488 190.629 1.00129.90 C ANISOU 4252 CB LEU B 160 12352 18074 18930 -1108 -1239 -888 C ATOM 4253 CG LEU B 160 130.138 181.351 190.464 1.00131.93 C ANISOU 4253 CG LEU B 160 12876 18362 18889 -862 -1177 -930 C ATOM 4254 CD1 LEU B 160 130.523 181.474 189.009 1.00132.33 C ANISOU 4254 CD1 LEU B 160 12903 18635 18741 -766 -1503 -1017 C ATOM 4255 CD2 LEU B 160 129.958 182.725 191.110 1.00134.33 C ANISOU 4255 CD2 LEU B 160 13104 18669 19268 -675 -829 -735 C ATOM 4256 N GLY B 161 127.441 179.962 193.505 1.00131.87 N ANISOU 4256 N GLY B 161 12539 17890 19674 -1385 -475 -620 N ATOM 4257 CA GLY B 161 126.985 180.448 194.799 1.00132.39 C ANISOU 4257 CA GLY B 161 12627 17814 19860 -1359 -1 -455 C ATOM 4258 C GLY B 161 127.533 179.631 195.948 1.00136.01 C ANISOU 4258 C GLY B 161 13500 18000 20178 -1487 166 -512 C ATOM 4259 O GLY B 161 128.031 180.199 196.923 1.00134.05 O ANISOU 4259 O GLY B 161 13550 17631 19751 -1376 461 -480 O ATOM 4260 N PHE B 162 127.463 178.286 195.826 1.00134.84 N ANISOU 4260 N PHE B 162 13394 17740 20098 -1724 -42 -600 N ATOM 4261 CA PHE B 162 127.964 177.346 196.832 1.00135.20 C ANISOU 4261 CA PHE B 162 13831 17510 20028 -1857 67 -634 C ATOM 4262 C PHE B 162 129.463 177.496 196.984 1.00136.63 C ANISOU 4262 C PHE B 162 14454 17628 19831 -1699 -41 -771 C ATOM 4263 O PHE B 162 129.949 177.506 198.112 1.00135.64 O ANISOU 4263 O PHE B 162 14675 17327 19537 -1680 179 -727 O ATOM 4264 CB PHE B 162 127.604 175.890 196.478 1.00139.52 C ANISOU 4264 CB PHE B 162 14313 17940 20759 -2134 -176 -710 C ATOM 4265 CG PHE B 162 128.041 174.870 197.505 1.00141.97 C ANISOU 4265 CG PHE B 162 15015 17943 20986 -2272 -59 -706 C ATOM 4266 CD1 PHE B 162 127.240 174.575 198.602 1.00147.37 C ANISOU 4266 CD1 PHE B 162 15692 18459 21843 -2424 314 -514 C ATOM 4267 CD2 PHE B 162 129.257 174.209 197.379 1.00143.64 C ANISOU 4267 CD2 PHE B 162 15600 18025 20951 -2237 -304 -874 C ATOM 4268 CE1 PHE B 162 127.651 173.638 199.558 1.00151.14 C ANISOU 4268 CE1 PHE B 162 16563 18647 22217 -2544 420 -479 C ATOM 4269 CE2 PHE B 162 129.670 173.276 198.336 1.00145.49 C ANISOU 4269 CE2 PHE B 162 16197 17967 21114 -2344 -215 -838 C ATOM 4270 CZ PHE B 162 128.863 172.994 199.417 1.00147.28 C ANISOU 4270 CZ PHE B 162 16443 18033 21483 -2501 136 -636 C ATOM 4271 N PHE B 163 130.188 177.613 195.852 1.00132.32 N ANISOU 4271 N PHE B 163 13894 17229 19153 -1588 -377 -928 N ATOM 4272 CA PHE B 163 131.640 177.791 195.818 1.00129.63 C ANISOU 4272 CA PHE B 163 13893 16854 18508 -1428 -499 -1056 C ATOM 4273 C PHE B 163 132.034 179.068 196.563 1.00131.72 C ANISOU 4273 C PHE B 163 14294 17132 18624 -1245 -230 -968 C ATOM 4274 O PHE B 163 132.927 179.023 197.411 1.00130.08 O ANISOU 4274 O PHE B 163 14440 16767 18217 -1211 -172 -991 O ATOM 4275 CB PHE B 163 132.153 177.829 194.364 1.00130.58 C ANISOU 4275 CB PHE B 163 13908 17160 18545 -1332 -839 -1212 C ATOM 4276 CG PHE B 163 133.654 177.933 194.226 1.00129.61 C ANISOU 4276 CG PHE B 163 14079 17001 18165 -1171 -954 -1339 C ATOM 4277 CD1 PHE B 163 134.455 176.799 194.289 1.00132.70 C ANISOU 4277 CD1 PHE B 163 14722 17211 18488 -1229 -1120 -1472 C ATOM 4278 CD2 PHE B 163 134.267 179.162 194.028 1.00129.77 C ANISOU 4278 CD2 PHE B 163 14103 17153 18049 -961 -889 -1313 C ATOM 4279 CE1 PHE B 163 135.843 176.897 194.174 1.00131.60 C ANISOU 4279 CE1 PHE B 163 14802 17038 18163 -1069 -1215 -1568 C ATOM 4280 CE2 PHE B 163 135.657 179.259 193.925 1.00130.60 C ANISOU 4280 CE2 PHE B 163 14436 17220 17967 -829 -985 -1413 C ATOM 4281 CZ PHE B 163 136.433 178.126 193.993 1.00128.65 C ANISOU 4281 CZ PHE B 163 14403 16809 17669 -879 -1149 -1537 C ATOM 4282 N MET B 164 131.343 180.189 196.262 1.00128.36 N ANISOU 4282 N MET B 164 13588 16876 18307 -1134 -79 -863 N ATOM 4283 CA MET B 164 131.581 181.491 196.874 1.00127.04 C ANISOU 4283 CA MET B 164 13525 16707 18037 -961 195 -790 C ATOM 4284 C MET B 164 131.250 181.488 198.364 1.00129.99 C ANISOU 4284 C MET B 164 14129 16877 18382 -1031 562 -695 C ATOM 4285 O MET B 164 132.095 181.903 199.157 1.00128.17 O ANISOU 4285 O MET B 164 14257 16530 17913 -964 654 -732 O ATOM 4286 CB MET B 164 130.792 182.597 196.155 1.00130.57 C ANISOU 4286 CB MET B 164 13594 17357 18658 -822 278 -680 C ATOM 4287 CG MET B 164 131.499 183.164 194.930 1.00133.01 C ANISOU 4287 CG MET B 164 13831 17851 18856 -662 12 -751 C ATOM 4288 SD MET B 164 133.255 183.595 195.157 1.00134.86 S ANISOU 4288 SD MET B 164 14474 17995 18772 -536 -52 -884 S ATOM 4289 CE MET B 164 133.163 184.911 196.434 1.00131.75 C ANISOU 4289 CE MET B 164 14249 17458 18350 -434 376 -784 C ATOM 4290 N LYS B 165 130.047 181.003 198.745 1.00128.10 N ANISOU 4290 N LYS B 165 13698 16594 18381 -1176 765 -573 N ATOM 4291 CA LYS B 165 129.600 180.932 200.141 1.00129.36 C ANISOU 4291 CA LYS B 165 14074 16561 18514 -1251 1170 -461 C ATOM 4292 C LYS B 165 130.541 180.074 200.981 1.00131.02 C ANISOU 4292 C LYS B 165 14770 16565 18448 -1347 1086 -527 C ATOM 4293 O LYS B 165 130.825 180.432 202.124 1.00130.85 O ANISOU 4293 O LYS B 165 15110 16405 18203 -1318 1338 -492 O ATOM 4294 CB LYS B 165 128.168 180.388 200.239 1.00135.62 C ANISOU 4294 CB LYS B 165 14518 17347 19665 -1414 1375 -310 C ATOM 4295 CG LYS B 165 127.098 181.468 200.238 1.00155.82 C ANISOU 4295 CG LYS B 165 16718 20010 22476 -1292 1717 -160 C ATOM 4296 CD LYS B 165 125.744 180.893 200.645 1.00172.17 C ANISOU 4296 CD LYS B 165 18484 22026 24908 -1466 2004 16 C ATOM 4297 CE LYS B 165 124.760 181.958 201.063 1.00186.04 C ANISOU 4297 CE LYS B 165 19986 23810 26891 -1321 2486 185 C ATOM 4298 N ASP B 166 131.045 178.968 200.402 1.00126.00 N ANISOU 4298 N ASP B 166 14157 15902 17815 -1449 722 -625 N ATOM 4299 CA ASP B 166 131.970 178.053 201.065 1.00125.24 C ANISOU 4299 CA ASP B 166 14480 15604 17503 -1522 588 -671 C ATOM 4300 C ASP B 166 133.357 178.684 201.247 1.00124.85 C ANISOU 4300 C ASP B 166 14737 15552 17147 -1354 438 -772 C ATOM 4301 O ASP B 166 133.978 178.472 202.292 1.00125.29 O ANISOU 4301 O ASP B 166 15194 15440 16971 -1373 477 -746 O ATOM 4302 CB ASP B 166 132.089 176.743 200.278 1.00127.79 C ANISOU 4302 CB ASP B 166 14709 15883 17964 -1653 254 -758 C ATOM 4303 CG ASP B 166 132.016 175.511 201.147 1.00144.63 C ANISOU 4303 CG ASP B 166 17103 17753 20096 -1837 309 -681 C ATOM 4304 OD1 ASP B 166 130.899 175.168 201.597 1.00147.89 O ANISOU 4304 OD1 ASP B 166 17391 18095 20706 -2000 571 -540 O ATOM 4305 OD2 ASP B 166 133.077 174.883 201.373 1.00152.91 O ANISOU 4305 OD2 ASP B 166 18470 18660 20970 -1814 96 -743 O ATOM 4306 N ALA B 167 133.840 179.450 200.238 1.00116.75 N ANISOU 4306 N ALA B 167 13523 14710 16127 -1200 259 -873 N ATOM 4307 CA ALA B 167 135.144 180.123 200.272 1.00113.03 C ANISOU 4307 CA ALA B 167 13264 14249 15433 -1051 115 -964 C ATOM 4308 C ALA B 167 135.224 181.118 201.423 1.00114.09 C ANISOU 4308 C ALA B 167 13666 14302 15381 -1001 392 -910 C ATOM 4309 O ALA B 167 136.238 181.148 202.120 1.00112.76 O ANISOU 4309 O ALA B 167 13841 14020 14981 -985 287 -951 O ATOM 4310 CB ALA B 167 135.408 180.832 198.956 1.00111.98 C ANISOU 4310 CB ALA B 167 12842 14331 15376 -908 -43 -1042 C ATOM 4311 N ILE B 168 134.145 181.902 201.638 1.00110.33 N ANISOU 4311 N ILE B 168 13037 13871 15013 -978 741 -819 N ATOM 4312 CA ILE B 168 134.041 182.887 202.715 1.00110.65 C ANISOU 4312 CA ILE B 168 13340 13815 14886 -926 1073 -784 C ATOM 4313 C ILE B 168 133.931 182.136 204.046 1.00116.55 C ANISOU 4313 C ILE B 168 14483 14362 15440 -1065 1232 -717 C ATOM 4314 O ILE B 168 134.680 182.451 204.971 1.00116.78 O ANISOU 4314 O ILE B 168 14935 14272 15165 -1055 1235 -757 O ATOM 4315 CB ILE B 168 132.866 183.889 202.496 1.00114.74 C ANISOU 4315 CB ILE B 168 13551 14422 15622 -834 1432 -697 C ATOM 4316 CG1 ILE B 168 132.925 184.533 201.094 1.00113.04 C ANISOU 4316 CG1 ILE B 168 12940 14414 15594 -697 1241 -725 C ATOM 4317 CG2 ILE B 168 132.862 184.974 203.583 1.00116.92 C ANISOU 4317 CG2 ILE B 168 14149 14568 15707 -759 1792 -699 C ATOM 4318 CD1 ILE B 168 131.591 184.943 200.521 1.00121.41 C ANISOU 4318 CD1 ILE B 168 13551 15603 16977 -644 1448 -597 C ATOM 4319 N LYS B 169 133.027 181.127 204.122 1.00114.49 N ANISOU 4319 N LYS B 169 14090 14060 15351 -1206 1341 -609 N ATOM 4320 CA LYS B 169 132.821 180.285 205.306 1.00116.64 C ANISOU 4320 CA LYS B 169 14716 14136 15468 -1352 1514 -505 C ATOM 4321 C LYS B 169 134.152 179.738 205.814 1.00118.45 C ANISOU 4321 C LYS B 169 15376 14243 15388 -1369 1184 -564 C ATOM 4322 O LYS B 169 134.499 179.958 206.977 1.00119.39 O ANISOU 4322 O LYS B 169 15947 14233 15183 -1380 1306 -534 O ATOM 4323 CB LYS B 169 131.872 179.116 204.992 1.00121.26 C ANISOU 4323 CB LYS B 169 15029 14694 16352 -1520 1554 -398 C ATOM 4324 CG LYS B 169 130.403 179.360 205.325 1.00139.12 C ANISOU 4324 CG LYS B 169 17052 16959 18848 -1576 2037 -246 C ATOM 4325 CD LYS B 169 129.618 178.038 205.449 1.00151.24 C ANISOU 4325 CD LYS B 169 18469 18382 20614 -1800 2105 -114 C ATOM 4326 CE LYS B 169 129.318 177.362 204.126 1.00159.58 C ANISOU 4326 CE LYS B 169 19057 19549 22026 -1885 1765 -171 C ATOM 4327 NZ LYS B 169 128.798 175.986 204.319 1.00171.03 N ANISOU 4327 NZ LYS B 169 20486 20833 23666 -2128 1770 -73 N ATOM 4328 N LYS B 170 134.916 179.081 204.915 1.00112.11 N ANISOU 4328 N LYS B 170 14430 13484 14682 -1357 762 -650 N ATOM 4329 CA LYS B 170 136.217 178.492 205.213 1.00111.11 C ANISOU 4329 CA LYS B 170 14615 13250 14351 -1348 408 -695 C ATOM 4330 C LYS B 170 137.225 179.561 205.661 1.00113.48 C ANISOU 4330 C LYS B 170 15165 13567 14385 -1234 315 -778 C ATOM 4331 O LYS B 170 137.841 179.390 206.713 1.00113.89 O ANISOU 4331 O LYS B 170 15643 13481 14149 -1268 243 -739 O ATOM 4332 CB LYS B 170 136.745 177.706 204.005 1.00112.09 C ANISOU 4332 CB LYS B 170 14474 13429 14686 -1324 39 -790 C ATOM 4333 N PHE B 171 137.346 180.676 204.902 1.00108.52 N ANISOU 4333 N PHE B 171 14285 13098 13850 -1112 318 -878 N ATOM 4334 CA PHE B 171 138.252 181.782 205.222 1.00107.81 C ANISOU 4334 CA PHE B 171 14384 13013 13566 -1024 239 -968 C ATOM 4335 C PHE B 171 137.977 182.336 206.627 1.00114.00 C ANISOU 4335 C PHE B 171 15606 13663 14047 -1074 522 -930 C ATOM 4336 O PHE B 171 138.928 182.540 207.381 1.00114.45 O ANISOU 4336 O PHE B 171 16027 13630 13830 -1087 333 -975 O ATOM 4337 CB PHE B 171 138.164 182.910 204.173 1.00107.97 C ANISOU 4337 CB PHE B 171 14046 13202 13773 -896 288 -1045 C ATOM 4338 CG PHE B 171 139.093 184.081 204.421 1.00109.51 C ANISOU 4338 CG PHE B 171 14405 13381 13823 -823 212 -1139 C ATOM 4339 CD1 PHE B 171 140.453 183.988 204.137 1.00112.11 C ANISOU 4339 CD1 PHE B 171 14758 13716 14124 -793 -168 -1214 C ATOM 4340 CD2 PHE B 171 138.610 185.278 204.933 1.00113.34 C ANISOU 4340 CD2 PHE B 171 15009 13827 14230 -788 532 -1156 C ATOM 4341 CE1 PHE B 171 141.315 185.070 204.374 1.00113.16 C ANISOU 4341 CE1 PHE B 171 15016 13819 14161 -757 -253 -1298 C ATOM 4342 CE2 PHE B 171 139.474 186.359 205.170 1.00116.40 C ANISOU 4342 CE2 PHE B 171 15564 14165 14497 -747 451 -1260 C ATOM 4343 CZ PHE B 171 140.819 186.249 204.885 1.00113.28 C ANISOU 4343 CZ PHE B 171 15174 13782 14087 -746 47 -1328 C ATOM 4344 N VAL B 172 136.687 182.545 206.979 1.00111.81 N ANISOU 4344 N VAL B 172 15296 13370 13819 -1103 969 -848 N ATOM 4345 CA VAL B 172 136.245 183.077 208.274 1.00114.07 C ANISOU 4345 CA VAL B 172 16001 13525 13817 -1137 1339 -815 C ATOM 4346 C VAL B 172 136.678 182.123 209.400 1.00120.63 C ANISOU 4346 C VAL B 172 17322 14194 14316 -1257 1226 -735 C ATOM 4347 O VAL B 172 137.359 182.560 210.328 1.00121.45 O ANISOU 4347 O VAL B 172 17888 14204 14053 -1269 1152 -789 O ATOM 4348 CB VAL B 172 134.716 183.365 208.284 1.00119.12 C ANISOU 4348 CB VAL B 172 16413 14184 14662 -1126 1871 -717 C ATOM 4349 CG1 VAL B 172 134.177 183.542 209.701 1.00122.64 C ANISOU 4349 CG1 VAL B 172 17333 14467 14799 -1179 2309 -654 C ATOM 4350 CG2 VAL B 172 134.390 184.590 207.437 1.00117.32 C ANISOU 4350 CG2 VAL B 172 15818 14082 14676 -976 1999 -786 C ATOM 4351 N VAL B 173 136.333 180.828 209.280 1.00118.58 N ANISOU 4351 N VAL B 173 16968 13897 14189 -1349 1175 -607 N ATOM 4352 CA VAL B 173 136.656 179.775 210.248 1.00121.45 C ANISOU 4352 CA VAL B 173 17760 14094 14289 -1458 1071 -483 C ATOM 4353 C VAL B 173 138.196 179.651 210.421 1.00126.34 C ANISOU 4353 C VAL B 173 18628 14680 14694 -1423 540 -552 C ATOM 4354 O VAL B 173 138.659 179.492 211.554 1.00128.20 O ANISOU 4354 O VAL B 173 19374 14791 14545 -1474 466 -492 O ATOM 4355 CB VAL B 173 135.976 178.435 209.834 1.00125.90 C ANISOU 4355 CB VAL B 173 18080 14613 15143 -1561 1102 -344 C ATOM 4356 CG1 VAL B 173 136.544 177.228 210.583 1.00127.57 C ANISOU 4356 CG1 VAL B 173 18680 14641 15149 -1649 882 -209 C ATOM 4357 CG2 VAL B 173 134.463 178.515 210.026 1.00127.94 C ANISOU 4357 CG2 VAL B 173 18180 14867 15566 -1630 1651 -231 C ATOM 4358 N THR B 174 138.974 179.782 209.319 1.00121.60 N ANISOU 4358 N THR B 174 17670 14197 14335 -1333 186 -671 N ATOM 4359 CA THR B 174 140.445 179.710 209.330 1.00121.52 C ANISOU 4359 CA THR B 174 17779 14171 14222 -1284 -308 -733 C ATOM 4360 C THR B 174 141.031 180.775 210.256 1.00128.20 C ANISOU 4360 C THR B 174 19017 14982 14712 -1287 -348 -810 C ATOM 4361 O THR B 174 141.837 180.434 211.120 1.00129.97 O ANISOU 4361 O THR B 174 19627 15104 14651 -1329 -632 -761 O ATOM 4362 CB THR B 174 141.024 179.850 207.906 1.00129.17 C ANISOU 4362 CB THR B 174 18256 15285 15537 -1175 -559 -852 C ATOM 4363 OG1 THR B 174 140.425 178.878 207.047 1.00131.36 O ANISOU 4363 OG1 THR B 174 18214 15587 16112 -1188 -524 -810 O ATOM 4364 CG2 THR B 174 142.552 179.706 207.866 1.00125.86 C ANISOU 4364 CG2 THR B 174 17890 14845 15085 -1116 -1043 -896 C ATOM 4365 N GLN B 175 140.614 182.048 210.077 1.00125.23 N ANISOU 4365 N GLN B 175 18550 14678 14355 -1244 -79 -928 N ATOM 4366 CA GLN B 175 141.065 183.198 210.867 1.00127.38 C ANISOU 4366 CA GLN B 175 19183 14897 14317 -1257 -73 -1043 C ATOM 4367 C GLN B 175 140.734 183.024 212.363 1.00137.61 C ANISOU 4367 C GLN B 175 21102 16040 15142 -1358 114 -970 C ATOM 4368 O GLN B 175 141.585 183.293 213.217 1.00139.62 O ANISOU 4368 O GLN B 175 21788 16217 15045 -1411 -156 -1020 O ATOM 4369 CB GLN B 175 140.433 184.507 210.347 1.00127.59 C ANISOU 4369 CB GLN B 175 18980 14992 14506 -1180 278 -1160 C ATOM 4370 CG GLN B 175 140.605 184.788 208.854 1.00138.28 C ANISOU 4370 CG GLN B 175 19747 16506 16287 -1072 161 -1211 C ATOM 4371 CD GLN B 175 142.025 185.067 208.438 1.00156.73 C ANISOU 4371 CD GLN B 175 21998 18876 18677 -1046 -300 -1305 C ATOM 4372 OE1 GLN B 175 142.615 186.095 208.786 1.00152.72 O ANISOU 4372 OE1 GLN B 175 21664 18318 18045 -1058 -370 -1420 O ATOM 4373 NE2 GLN B 175 142.584 184.172 207.639 1.00148.17 N ANISOU 4373 NE2 GLN B 175 20622 17866 17809 -1010 -605 -1262 N ATOM 4374 N CYS B 176 139.512 182.532 212.665 1.00136.63 N ANISOU 4374 N CYS B 176 21022 15876 15016 -1393 562 -840 N ATOM 4375 CA CYS B 176 138.995 182.307 214.019 1.00141.05 C ANISOU 4375 CA CYS B 176 22156 16294 15143 -1481 858 -738 C ATOM 4376 C CYS B 176 139.781 181.223 214.783 1.00147.15 C ANISOU 4376 C CYS B 176 23326 16966 15617 -1561 466 -598 C ATOM 4377 O CYS B 176 139.675 181.146 216.009 1.00150.86 O ANISOU 4377 O CYS B 176 24384 17320 15618 -1635 595 -526 O ATOM 4378 CB CYS B 176 137.508 181.977 213.967 1.00142.60 C ANISOU 4378 CB CYS B 176 22176 16482 15524 -1495 1437 -608 C ATOM 4379 SG CYS B 176 136.467 183.362 213.438 1.00145.82 S ANISOU 4379 SG CYS B 176 22246 16968 16193 -1384 1972 -731 S ATOM 4380 N ILE B 177 140.559 180.397 214.069 1.00141.26 N ANISOU 4380 N ILE B 177 22281 16258 15133 -1534 4 -551 N ATOM 4381 CA ILE B 177 141.405 179.363 214.665 1.00142.80 C ANISOU 4381 CA ILE B 177 22782 16351 15126 -1575 -421 -403 C ATOM 4382 C ILE B 177 142.852 179.893 214.696 1.00145.43 C ANISOU 4382 C ILE B 177 23177 16719 15360 -1541 -982 -527 C ATOM 4383 O ILE B 177 143.529 179.774 215.717 1.00147.88 O ANISOU 4383 O ILE B 177 23976 16946 15266 -1595 -1271 -467 O ATOM 4384 CB ILE B 177 141.273 178.006 213.903 1.00144.51 C ANISOU 4384 CB ILE B 177 22637 16542 15729 -1561 -527 -258 C ATOM 4385 CG1 ILE B 177 139.834 177.447 213.999 1.00146.15 C ANISOU 4385 CG1 ILE B 177 22805 16691 16035 -1638 10 -119 C ATOM 4386 CG2 ILE B 177 142.302 176.969 214.408 1.00147.27 C ANISOU 4386 CG2 ILE B 177 23250 16770 15935 -1563 -1018 -101 C ATOM 4387 CD1 ILE B 177 139.460 176.409 212.916 1.00151.79 C ANISOU 4387 CD1 ILE B 177 23023 17405 17244 -1639 -19 -61 C ATOM 4388 N LEU B 178 143.292 180.506 213.579 1.00137.89 N ANISOU 4388 N LEU B 178 21724 15891 14776 -1457 -1125 -688 N ATOM 4389 CA LEU B 178 144.632 181.045 213.372 1.00136.55 C ANISOU 4389 CA LEU B 178 21467 15766 14648 -1425 -1619 -806 C ATOM 4390 C LEU B 178 144.996 182.111 214.402 1.00143.58 C ANISOU 4390 C LEU B 178 22843 16607 15106 -1509 -1684 -926 C ATOM 4391 O LEU B 178 145.924 181.884 215.171 1.00146.27 O ANISOU 4391 O LEU B 178 23515 16886 15176 -1563 -2125 -879 O ATOM 4392 CB LEU B 178 144.763 181.611 211.946 1.00132.24 C ANISOU 4392 CB LEU B 178 20305 15364 14575 -1324 -1600 -945 C ATOM 4393 CG LEU B 178 146.168 181.927 211.431 1.00135.36 C ANISOU 4393 CG LEU B 178 20452 15814 15165 -1274 -2089 -1029 C ATOM 4394 CD1 LEU B 178 146.973 180.658 211.162 1.00135.50 C ANISOU 4394 CD1 LEU B 178 20315 15803 15367 -1213 -2486 -893 C ATOM 4395 CD2 LEU B 178 146.088 182.722 210.167 1.00134.09 C ANISOU 4395 CD2 LEU B 178 19788 15786 15375 -1189 -1940 -1163 C ATOM 4396 N LEU B 179 144.259 183.239 214.440 1.00139.75 N ANISOU 4396 N LEU B 179 22414 16132 14551 -1520 -1259 -1076 N ATOM 4397 CA LEU B 179 144.503 184.391 215.322 1.00142.08 C ANISOU 4397 CA LEU B 179 23172 16355 14458 -1600 -1253 -1243 C ATOM 4398 C LEU B 179 144.664 184.033 216.828 1.00149.95 C ANISOU 4398 C LEU B 179 24909 17227 14839 -1715 -1379 -1166 C ATOM 4399 O LEU B 179 145.679 184.458 217.393 1.00151.72 O ANISOU 4399 O LEU B 179 25419 17414 14814 -1795 -1833 -1257 O ATOM 4400 CB LEU B 179 143.413 185.460 215.145 1.00141.61 C ANISOU 4400 CB LEU B 179 23072 16288 14444 -1564 -649 -1377 C ATOM 4401 CG LEU B 179 143.743 186.608 214.189 1.00143.49 C ANISOU 4401 CG LEU B 179 22896 16590 15035 -1503 -671 -1559 C ATOM 4402 CD1 LEU B 179 143.890 186.124 212.743 1.00139.30 C ANISOU 4402 CD1 LEU B 179 21667 16212 15051 -1393 -793 -1487 C ATOM 4403 CD2 LEU B 179 142.684 187.682 214.269 1.00146.75 C ANISOU 4403 CD2 LEU B 179 23387 16948 15423 -1460 -80 -1673 C ATOM 4404 N PRO B 180 143.764 183.264 217.504 1.00147.70 N ANISOU 4404 N PRO B 180 24953 16875 14294 -1738 -1031 -992 N ATOM 4405 CA PRO B 180 143.993 182.970 218.931 1.00152.21 C ANISOU 4405 CA PRO B 180 26273 17332 14230 -1844 -1171 -907 C ATOM 4406 C PRO B 180 145.190 182.041 219.170 1.00155.79 C ANISOU 4406 C PRO B 180 26793 17778 14622 -1864 -1871 -746 C ATOM 4407 O PRO B 180 145.926 182.262 220.129 1.00159.06 O ANISOU 4407 O PRO B 180 27720 18139 14576 -1954 -2255 -770 O ATOM 4408 CB PRO B 180 142.680 182.317 219.381 1.00155.82 C ANISOU 4408 CB PRO B 180 26945 17725 14537 -1847 -565 -725 C ATOM 4409 CG PRO B 180 141.688 182.636 218.303 1.00156.64 C ANISOU 4409 CG PRO B 180 26451 17904 15159 -1758 -66 -783 C ATOM 4410 CD PRO B 180 142.491 182.667 217.051 1.00147.67 C ANISOU 4410 CD PRO B 180 24679 16887 14542 -1685 -492 -857 C ATOM 4411 N VAL B 181 145.399 181.031 218.293 1.00148.45 N ANISOU 4411 N VAL B 181 25350 16893 14159 -1777 -2048 -590 N ATOM 4412 CA VAL B 181 146.515 180.076 218.378 1.00148.80 C ANISOU 4412 CA VAL B 181 25363 16915 14257 -1753 -2679 -418 C ATOM 4413 C VAL B 181 147.847 180.820 218.145 1.00151.22 C ANISOU 4413 C VAL B 181 25487 17287 14682 -1759 -3254 -580 C ATOM 4414 O VAL B 181 148.782 180.632 218.928 1.00154.49 O ANISOU 4414 O VAL B 181 26229 17659 14810 -1813 -3788 -503 O ATOM 4415 CB VAL B 181 146.329 178.876 217.399 1.00149.74 C ANISOU 4415 CB VAL B 181 24963 17039 14893 -1645 -2647 -252 C ATOM 4416 CG1 VAL B 181 147.621 178.081 217.205 1.00149.82 C ANISOU 4416 CG1 VAL B 181 24788 17029 15106 -1572 -3299 -124 C ATOM 4417 CG2 VAL B 181 145.210 177.956 217.873 1.00151.45 C ANISOU 4417 CG2 VAL B 181 25445 17149 14951 -1680 -2208 -38 C ATOM 4418 N SER B 182 147.908 181.678 217.094 1.00142.66 N ANISOU 4418 N SER B 182 23886 16300 14016 -1712 -3141 -787 N ATOM 4419 CA SER B 182 149.086 182.467 216.708 1.00141.21 C ANISOU 4419 CA SER B 182 23436 16175 14043 -1725 -3596 -945 C ATOM 4420 C SER B 182 149.542 183.400 217.820 1.00148.46 C ANISOU 4420 C SER B 182 24914 17030 14464 -1883 -3836 -1087 C ATOM 4421 O SER B 182 150.716 183.354 218.193 1.00150.68 O ANISOU 4421 O SER B 182 25256 17305 14691 -1938 -4455 -1062 O ATOM 4422 CB SER B 182 148.808 183.281 215.452 1.00140.08 C ANISOU 4422 CB SER B 182 22727 16129 14370 -1654 -3292 -1122 C ATOM 4423 OG SER B 182 148.365 182.446 214.397 1.00146.53 O ANISOU 4423 OG SER B 182 23055 17009 15609 -1522 -3088 -1015 O ATOM 4424 N SER B 183 148.616 184.229 218.357 1.00145.19 N ANISOU 4424 N SER B 183 24911 16560 13696 -1953 -3351 -1238 N ATOM 4425 CA SER B 183 148.877 185.181 219.443 1.00148.75 C ANISOU 4425 CA SER B 183 25982 16922 13616 -2111 -3484 -1420 C ATOM 4426 C SER B 183 149.444 184.472 220.686 1.00156.40 C ANISOU 4426 C SER B 183 27554 17831 14038 -2205 -3961 -1259 C ATOM 4427 O SER B 183 150.448 184.932 221.233 1.00159.47 O ANISOU 4427 O SER B 183 28174 18198 14219 -2328 -4523 -1354 O ATOM 4428 CB SER B 183 147.609 185.951 219.803 1.00152.78 C ANISOU 4428 CB SER B 183 26845 17358 13845 -2126 -2768 -1569 C ATOM 4429 OG SER B 183 146.522 185.080 220.070 1.00161.59 O ANISOU 4429 OG SER B 183 28127 18458 14811 -2064 -2294 -1370 O ATOM 4430 N LEU B 184 148.835 183.331 221.091 1.00152.21 N ANISOU 4430 N LEU B 184 27253 17273 13307 -2150 -3769 -998 N ATOM 4431 CA LEU B 184 149.269 182.531 222.239 1.00156.05 C ANISOU 4431 CA LEU B 184 28322 17699 13271 -2213 -4177 -783 C ATOM 4432 C LEU B 184 150.631 181.887 221.988 1.00159.56 C ANISOU 4432 C LEU B 184 28427 18187 14009 -2176 -4965 -629 C ATOM 4433 O LEU B 184 151.441 181.840 222.912 1.00163.91 O ANISOU 4433 O LEU B 184 29413 18711 14156 -2273 -5536 -572 O ATOM 4434 CB LEU B 184 148.236 181.452 222.592 1.00156.52 C ANISOU 4434 CB LEU B 184 28632 17700 13140 -2155 -3715 -515 C ATOM 4435 CG LEU B 184 146.979 181.909 223.324 1.00163.08 C ANISOU 4435 CG LEU B 184 30022 18456 13483 -2212 -3003 -590 C ATOM 4436 CD1 LEU B 184 145.892 180.869 223.220 1.00162.33 C ANISOU 4436 CD1 LEU B 184 29869 18321 13487 -2140 -2464 -331 C ATOM 4437 CD2 LEU B 184 147.262 182.198 224.782 1.00172.08 C ANISOU 4437 CD2 LEU B 184 32067 19517 13797 -2351 -3223 -612 C ATOM 4438 N LEU B 185 150.889 181.408 220.746 1.00151.17 N ANISOU 4438 N LEU B 185 26599 17194 13646 -2032 -4997 -566 N ATOM 4439 CA LEU B 185 152.166 180.795 220.355 1.00151.12 C ANISOU 4439 CA LEU B 185 26170 17222 14026 -1958 -5666 -423 C ATOM 4440 C LEU B 185 153.296 181.828 220.440 1.00157.66 C ANISOU 4440 C LEU B 185 26907 18094 14903 -2072 -6201 -622 C ATOM 4441 O LEU B 185 154.373 181.508 220.949 1.00161.06 O ANISOU 4441 O LEU B 185 27412 18519 15265 -2104 -6883 -496 O ATOM 4442 CB LEU B 185 152.085 180.186 218.938 1.00145.73 C ANISOU 4442 CB LEU B 185 24716 16594 14062 -1776 -5468 -367 C ATOM 4443 CG LEU B 185 153.374 179.588 218.344 1.00150.01 C ANISOU 4443 CG LEU B 185 24728 17164 15105 -1658 -6052 -242 C ATOM 4444 CD1 LEU B 185 153.719 178.248 218.977 1.00153.64 C ANISOU 4444 CD1 LEU B 185 25422 17525 15429 -1583 -6404 91 C ATOM 4445 CD2 LEU B 185 153.260 179.438 216.843 1.00146.83 C ANISOU 4445 CD2 LEU B 185 23592 16831 15366 -1506 -5767 -308 C ATOM 4446 N LEU B 186 153.035 183.065 219.963 1.00152.54 N ANISOU 4446 N LEU B 186 26097 17477 14386 -2137 -5899 -920 N ATOM 4447 CA LEU B 186 153.980 184.188 220.006 1.00154.18 C ANISOU 4447 CA LEU B 186 26223 17696 14665 -2279 -6317 -1143 C ATOM 4448 C LEU B 186 154.230 184.631 221.451 1.00165.63 C ANISOU 4448 C LEU B 186 28473 19065 15394 -2486 -6669 -1220 C ATOM 4449 O LEU B 186 155.357 184.996 221.797 1.00168.43 O ANISOU 4449 O LEU B 186 28829 19422 15745 -2613 -7334 -1270 O ATOM 4450 CB LEU B 186 153.453 185.377 219.183 1.00150.26 C ANISOU 4450 CB LEU B 186 25433 17213 14447 -2291 -5809 -1422 C ATOM 4451 CG LEU B 186 153.498 185.235 217.673 1.00148.93 C ANISOU 4451 CG LEU B 186 24441 17142 15005 -2121 -5598 -1398 C ATOM 4452 CD1 LEU B 186 152.378 186.015 217.031 1.00145.51 C ANISOU 4452 CD1 LEU B 186 23896 16714 14677 -2080 -4888 -1570 C ATOM 4453 CD2 LEU B 186 154.835 185.672 217.123 1.00150.64 C ANISOU 4453 CD2 LEU B 186 24151 17402 15683 -2156 -6117 -1450 C ATOM 4454 N TYR B 187 153.170 184.591 222.284 1.00164.94 N ANISOU 4454 N TYR B 187 29063 18906 14700 -2522 -6217 -1228 N ATOM 4455 CA TYR B 187 153.197 184.956 223.696 1.00171.31 C ANISOU 4455 CA TYR B 187 30749 19629 14712 -2705 -6426 -1306 C ATOM 4456 C TYR B 187 154.176 184.059 224.460 1.00180.02 C ANISOU 4456 C TYR B 187 32085 20746 15568 -2735 -7210 -1038 C ATOM 4457 O TYR B 187 154.999 184.575 225.209 1.00184.55 O ANISOU 4457 O TYR B 187 33009 21301 15812 -2915 -7811 -1143 O ATOM 4458 CB TYR B 187 151.777 184.865 224.290 1.00173.66 C ANISOU 4458 CB TYR B 187 31640 19853 14489 -2682 -5670 -1302 C ATOM 4459 CG TYR B 187 151.675 185.238 225.753 1.00182.78 C ANISOU 4459 CG TYR B 187 33782 20914 14753 -2855 -5770 -1394 C ATOM 4460 CD1 TYR B 187 151.536 186.566 226.145 1.00187.06 C ANISOU 4460 CD1 TYR B 187 34719 21369 14986 -3007 -5614 -1763 C ATOM 4461 CD2 TYR B 187 151.670 184.260 226.744 1.00188.27 C ANISOU 4461 CD2 TYR B 187 35054 21589 14890 -2861 -5981 -1111 C ATOM 4462 CE1 TYR B 187 151.428 186.915 227.491 1.00193.52 C ANISOU 4462 CE1 TYR B 187 36197 22248 15085 -3087 -5575 -1896 C ATOM 4463 CE2 TYR B 187 151.569 184.596 228.093 1.00193.40 C ANISOU 4463 CE2 TYR B 187 36092 22461 14931 -2869 -5843 -1230 C ATOM 4464 CZ TYR B 187 151.447 185.926 228.462 1.00199.44 C ANISOU 4464 CZ TYR B 187 36302 23638 15838 -2776 -5365 -1683 C ATOM 4465 OH TYR B 187 151.340 186.265 229.791 1.00202.16 O ANISOU 4465 OH TYR B 187 36469 24493 15850 -2632 -5071 -1852 O ATOM 4466 N ILE B 188 154.111 182.732 224.238 1.00175.50 N ANISOU 4466 N ILE B 188 31297 20197 15188 -2562 -7230 -692 N ATOM 4467 CA ILE B 188 154.960 181.729 224.892 1.00179.78 C ANISOU 4467 CA ILE B 188 32015 20736 15557 -2539 -7926 -372 C ATOM 4468 C ILE B 188 156.447 181.931 224.520 1.00184.54 C ANISOU 4468 C ILE B 188 32075 21404 16638 -2565 -8734 -380 C ATOM 4469 O ILE B 188 157.302 181.831 225.403 1.00189.37 O ANISOU 4469 O ILE B 188 33029 22013 16911 -2671 -9454 -278 O ATOM 4470 CB ILE B 188 154.445 180.299 224.557 1.00180.81 C ANISOU 4470 CB ILE B 188 31960 20838 15903 -2328 -7646 -20 C ATOM 4471 CG1 ILE B 188 153.142 180.018 225.335 1.00182.88 C ANISOU 4471 CG1 ILE B 188 32932 21018 15538 -2355 -7011 56 C ATOM 4472 CG2 ILE B 188 155.496 179.210 224.845 1.00185.07 C ANISOU 4472 CG2 ILE B 188 32405 21365 16548 -2236 -8389 334 C ATOM 4473 CD1 ILE B 188 152.210 179.047 224.694 1.00185.64 C ANISOU 4473 CD1 ILE B 188 32988 21328 16220 -2193 -6417 252 C ATOM 4474 N ILE B 189 156.746 182.231 223.239 1.00176.42 N ANISOU 4474 N ILE B 189 30217 20436 16379 -2475 -8614 -492 N ATOM 4475 CA ILE B 189 158.117 182.446 222.764 1.00176.98 C ANISOU 4475 CA ILE B 189 29681 20566 16997 -2489 -9278 -494 C ATOM 4476 C ILE B 189 158.708 183.741 223.360 1.00185.27 C ANISOU 4476 C ILE B 189 31011 21605 17779 -2766 -9690 -784 C ATOM 4477 O ILE B 189 159.837 183.719 223.860 1.00189.34 O ANISOU 4477 O ILE B 189 31514 22139 18290 -2867 -10487 -703 O ATOM 4478 CB ILE B 189 158.181 182.450 221.214 1.00173.51 C ANISOU 4478 CB ILE B 189 28333 20189 17405 -2317 -8936 -541 C ATOM 4479 N LYS B 190 157.932 184.848 223.335 1.00180.78 N ANISOU 4479 N LYS B 190 30705 20991 16992 -2890 -9157 -1116 N ATOM 4480 CA LYS B 190 158.346 186.161 223.840 1.00184.14 C ANISOU 4480 CA LYS B 190 31433 21362 17172 -3163 -9434 -1444 C ATOM 4481 C LYS B 190 158.465 186.195 225.374 1.00193.23 C ANISOU 4481 C LYS B 190 33100 22731 17588 -3238 -9554 -1510 C ATOM 4482 O LYS B 190 159.456 186.721 225.881 1.00194.08 O ANISOU 4482 O LYS B 190 32792 23179 17770 -3299 -9838 -1688 O ATOM 4483 CB LYS B 190 157.382 187.264 223.361 1.00182.85 C ANISOU 4483 CB LYS B 190 31307 21133 17034 -3199 -8662 -1774 C ATOM 4484 CG LYS B 190 157.608 187.706 221.919 1.00187.48 C ANISOU 4484 CG LYS B 190 30999 21770 18464 -3103 -8424 -1851 C ATOM 4485 N ILE B 191 157.470 185.645 226.104 1.00192.13 N ANISOU 4485 N ILE B 191 33613 22561 16828 -3171 -9148 -1400 N ATOM 4486 CA ILE B 191 157.448 185.649 227.572 1.00194.84 C ANISOU 4486 CA ILE B 191 33939 23453 16639 -3060 -8824 -1512 C ATOM 4487 C ILE B 191 158.397 184.571 228.134 1.00199.77 C ANISOU 4487 C ILE B 191 33713 24726 17465 -2769 -8957 -1251 C ATOM 4488 O ILE B 191 159.289 184.908 228.917 1.00201.41 O ANISOU 4488 O ILE B 191 33526 25412 17587 -2755 -9156 -1404 O ATOM 4489 CB ILE B 191 155.991 185.514 228.131 1.00197.14 C ANISOU 4489 CB ILE B 191 34668 23790 16446 -2936 -7945 -1534 C ATOM 4490 CG1 ILE B 191 155.089 186.725 227.739 1.00196.68 C ANISOU 4490 CG1 ILE B 191 35023 23409 16296 -3087 -7452 -1882 C ATOM 4491 CG2 ILE B 191 155.942 185.219 229.644 1.00200.22 C ANISOU 4491 CG2 ILE B 191 34926 24792 16357 -2744 -7644 -1540 C ATOM 4492 CD1 ILE B 191 155.489 188.165 228.275 1.00204.48 C ANISOU 4492 CD1 ILE B 191 35189 24992 17511 -3015 -7060 -2430 C ATOM 4493 N GLY B 192 158.187 183.312 227.744 1.00197.36 N ATOM 4494 CA GLY B 192 158.981 182.175 228.204 1.00198.76 C ATOM 4495 C GLY B 192 160.441 182.204 227.794 1.00202.07 C ATOM 4496 O GLY B 192 160.814 182.886 226.835 1.00200.69 O