>>2YPT:HELIX   59  59 THR E  159  GLY E  192  1                                  34    
TLGFFMKDAIKKFVVTQCILLPVSSLLLYIIKIG
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 59 59 THR E 159 GLY E 192 1 34 ATOM 10461 N THR E 159 174.360 165.254 138.353 1.00148.49 N ANISOU10461 N THR E 159 15733 21531 19156 3767 -523 2088 N ATOM 10462 CA THR E 159 174.860 166.327 137.499 1.00147.32 C ANISOU10462 CA THR E 159 15249 21471 19253 3402 -660 1972 C ATOM 10463 C THR E 159 173.890 166.413 136.315 1.00145.29 C ANISOU10463 C THR E 159 15269 20774 19162 3157 -388 1857 C ATOM 10464 O THR E 159 173.139 165.460 136.083 1.00142.98 O ANISOU10464 O THR E 159 15344 20177 18807 3321 -86 1906 O ATOM 10465 CB THR E 159 176.340 166.115 137.110 1.00161.17 C ANISOU10465 CB THR E 159 16530 23608 21101 3588 -676 2193 C ATOM 10466 OG1 THR E 159 176.716 167.099 136.143 1.00163.23 O ANISOU10466 OG1 THR E 159 16499 23902 21620 3207 -739 2113 O ATOM 10467 CG2 THR E 159 176.635 164.714 136.575 1.00160.26 C ANISOU10467 CG2 THR E 159 16534 23399 20959 4043 -282 2450 C ATOM 10468 N LEU E 160 173.881 167.544 135.583 1.00139.93 N ANISOU10468 N LEU E 160 14422 20057 18687 2758 -499 1712 N ATOM 10469 CA LEU E 160 172.975 167.727 134.440 1.00136.32 C ANISOU10469 CA LEU E 160 14194 19236 18364 2524 -275 1613 C ATOM 10470 C LEU E 160 173.233 166.684 133.348 1.00140.03 C ANISOU10470 C LEU E 160 14727 19602 18876 2745 98 1776 C ATOM 10471 O LEU E 160 172.290 166.253 132.679 1.00137.46 O ANISOU10471 O LEU E 160 14735 18947 18549 2698 341 1711 O ATOM 10472 CB LEU E 160 173.075 169.141 133.860 1.00135.67 C ANISOU10472 CB LEU E 160 13894 19162 18492 2097 -463 1484 C ATOM 10473 CG LEU E 160 171.813 169.640 133.163 1.00136.72 C ANISOU10473 CG LEU E 160 14316 18933 18697 1829 -357 1324 C ATOM 10474 CD1 LEU E 160 171.460 171.032 133.627 1.00136.79 C ANISOU10474 CD1 LEU E 160 14293 18900 18781 1502 -663 1123 C ATOM 10475 CD2 LEU E 160 171.943 169.570 131.643 1.00137.60 C ANISOU10475 CD2 LEU E 160 14373 18953 18954 1742 -106 1413 C ATOM 10476 N GLY E 161 174.495 166.286 133.207 1.00139.37 N ANISOU10476 N GLY E 161 14322 19816 18817 2991 133 1976 N ATOM 10477 CA GLY E 161 174.931 165.284 132.246 1.00140.41 C ANISOU10477 CA GLY E 161 14488 19894 18967 3276 488 2135 C ATOM 10478 C GLY E 161 174.379 163.911 132.556 1.00144.76 C ANISOU10478 C GLY E 161 15468 20172 19361 3626 746 2191 C ATOM 10479 O GLY E 161 173.859 163.243 131.659 1.00143.01 O ANISOU10479 O GLY E 161 15549 19637 19150 3665 1051 2155 O ATOM 10480 N PHE E 162 174.471 163.495 133.841 1.00143.73 N ANISOU10480 N PHE E 162 15382 20153 19074 3868 617 2278 N ATOM 10481 CA PHE E 162 173.971 162.204 134.322 1.00144.60 C ANISOU10481 CA PHE E 162 15904 19999 19037 4204 848 2377 C ATOM 10482 C PHE E 162 172.463 162.128 134.149 1.00145.62 C ANISOU10482 C PHE E 162 16481 19691 19157 3934 966 2189 C ATOM 10483 O PHE E 162 171.962 161.095 133.711 1.00145.08 O ANISOU10483 O PHE E 162 16776 19272 19076 4063 1275 2215 O ATOM 10484 CB PHE E 162 174.356 161.958 135.792 1.00149.15 C ANISOU10484 CB PHE E 162 16404 20841 19424 4488 648 2526 C ATOM 10485 CG PHE E 162 173.925 160.615 136.332 1.00152.34 C ANISOU10485 CG PHE E 162 17225 20975 19682 4859 901 2690 C ATOM 10486 CD1 PHE E 162 174.721 159.491 136.161 1.00158.34 C ANISOU10486 CD1 PHE E 162 18009 21733 20420 5345 1144 2941 C ATOM 10487 CD2 PHE E 162 172.719 160.473 137.008 1.00154.16 C ANISOU10487 CD2 PHE E 162 17827 20945 19802 4731 916 2612 C ATOM 10488 CE1 PHE E 162 174.319 158.247 136.656 1.00163.10 C ANISOU10488 CE1 PHE E 162 19035 22027 20910 5683 1393 3112 C ATOM 10489 CE2 PHE E 162 172.313 159.227 137.496 1.00156.98 C ANISOU10489 CE2 PHE E 162 18574 21026 20045 5041 1170 2795 C ATOM 10490 CZ PHE E 162 173.118 158.123 137.321 1.00159.51 C ANISOU10490 CZ PHE E 162 18947 21300 20361 5508 1403 3045 C ATOM 10491 N PHE E 163 171.750 163.220 134.490 1.00140.32 N ANISOU10491 N PHE E 163 15779 19041 18497 3561 722 1997 N ATOM 10492 CA PHE E 163 170.297 163.328 134.363 1.00137.27 C ANISOU10492 CA PHE E 163 15734 18317 18103 3284 797 1822 C ATOM 10493 C PHE E 163 169.879 163.137 132.899 1.00139.88 C ANISOU10493 C PHE E 163 16205 18381 18563 3113 1039 1733 C ATOM 10494 O PHE E 163 168.978 162.341 132.621 1.00138.96 O ANISOU10494 O PHE E 163 16449 17934 18417 3095 1267 1694 O ATOM 10495 CB PHE E 163 169.805 164.689 134.902 1.00137.20 C ANISOU10495 CB PHE E 163 15602 18431 18097 2960 480 1636 C ATOM 10496 CG PHE E 163 168.306 164.873 134.883 1.00135.68 C ANISOU10496 CG PHE E 163 15708 17960 17884 2715 542 1476 C ATOM 10497 CD1 PHE E 163 167.516 164.375 135.912 1.00139.10 C ANISOU10497 CD1 PHE E 163 16391 18311 18147 2818 581 1504 C ATOM 10498 CD2 PHE E 163 167.685 165.540 133.836 1.00134.83 C ANISOU10498 CD2 PHE E 163 15609 17704 17915 2395 569 1326 C ATOM 10499 CE1 PHE E 163 166.130 164.529 135.886 1.00137.78 C ANISOU10499 CE1 PHE E 163 16452 17932 17966 2596 654 1380 C ATOM 10500 CE2 PHE E 163 166.297 165.687 133.808 1.00135.48 C ANISOU10500 CE2 PHE E 163 15926 17576 17974 2191 625 1199 C ATOM 10501 CZ PHE E 163 165.531 165.188 134.836 1.00134.06 C ANISOU10501 CZ PHE E 163 15963 17333 17641 2286 667 1224 C ATOM 10502 N MET E 164 170.559 163.844 131.974 1.00136.13 N ANISOU10502 N MET E 164 15439 18067 18218 2984 990 1709 N ATOM 10503 CA MET E 164 170.297 163.786 130.539 1.00134.70 C ANISOU10503 CA MET E 164 15344 17714 18122 2837 1196 1632 C ATOM 10504 C MET E 164 170.616 162.411 129.957 1.00138.83 C ANISOU10504 C MET E 164 16089 18061 18598 3158 1533 1723 C ATOM 10505 O MET E 164 169.764 161.840 129.276 1.00136.68 O ANISOU10505 O MET E 164 16153 17472 18305 3063 1736 1608 O ATOM 10506 CB MET E 164 171.081 164.877 129.790 1.00137.53 C ANISOU10506 CB MET E 164 15309 18330 18615 2658 1073 1642 C ATOM 10507 CG MET E 164 170.378 166.227 129.750 1.00139.14 C ANISOU10507 CG MET E 164 15444 18521 18903 2249 842 1489 C ATOM 10508 SD MET E 164 168.631 166.180 129.258 1.00140.60 S ANISOU10508 SD MET E 164 16031 18346 19046 1997 950 1298 S ATOM 10509 CE MET E 164 168.740 165.530 127.555 1.00137.70 C ANISOU10509 CE MET E 164 15769 17874 18679 2024 1268 1305 C ATOM 10510 N LYS E 165 171.823 161.872 130.242 1.00138.52 N ANISOU10510 N LYS E 165 15868 18226 18538 3543 1588 1920 N ATOM 10511 CA LYS E 165 172.264 160.561 129.758 1.00141.10 C ANISOU10511 CA LYS E 165 16408 18384 18820 3929 1920 2022 C ATOM 10512 C LYS E 165 171.331 159.455 130.238 1.00145.42 C ANISOU10512 C LYS E 165 17456 18509 19286 4022 2093 1999 C ATOM 10513 O LYS E 165 171.046 158.537 129.471 1.00146.36 O ANISOU10513 O LYS E 165 17917 18296 19396 4107 2380 1937 O ATOM 10514 CB LYS E 165 173.706 160.259 130.192 1.00147.31 C ANISOU10514 CB LYS E 165 16864 19517 19592 4366 1913 2272 C ATOM 10515 N ASP E 166 170.834 159.564 131.485 1.00141.07 N ANISOU10515 N ASP E 166 16959 17968 18671 3984 1922 2041 N ATOM 10516 CA ASP E 166 169.917 158.595 132.082 1.00141.19 C ANISOU10516 CA ASP E 166 17416 17614 18616 4036 2077 2064 C ATOM 10517 C ASP E 166 168.525 158.671 131.448 1.00139.81 C ANISOU10517 C ASP E 166 17527 17114 18482 3611 2149 1833 C ATOM 10518 O ASP E 166 167.900 157.628 131.251 1.00140.49 O ANISOU10518 O ASP E 166 18014 16804 18561 3627 2391 1813 O ATOM 10519 CB ASP E 166 169.817 158.802 133.598 1.00144.09 C ANISOU10519 CB ASP E 166 17715 18163 18871 4121 1868 2193 C ATOM 10520 CG ASP E 166 169.909 157.511 134.385 1.00161.61 C ANISOU10520 CG ASP E 166 20229 20183 20992 4516 2066 2426 C ATOM 10521 OD1 ASP E 166 171.034 156.963 134.504 1.00165.67 O ANISOU10521 OD1 ASP E 166 20632 20836 21478 4953 2138 2632 O ATOM 10522 OD2 ASP E 166 168.858 157.047 134.887 1.00168.26 O ANISOU10522 OD2 ASP E 166 21404 20740 21788 4398 2160 2428 O ATOM 10523 N ALA E 167 168.044 159.894 131.131 1.00131.30 N ANISOU10523 N ALA E 167 16240 16198 17449 3233 1937 1667 N ATOM 10524 CA ALA E 167 166.734 160.124 130.510 1.00127.81 C ANISOU10524 CA ALA E 167 15988 15537 17036 2834 1964 1461 C ATOM 10525 C ALA E 167 166.644 159.432 129.148 1.00130.02 C ANISOU10525 C ALA E 167 16492 15568 17342 2798 2212 1347 C ATOM 10526 O ALA E 167 165.637 158.786 128.865 1.00129.22 O ANISOU10526 O ALA E 167 16720 15148 17231 2618 2350 1235 O ATOM 10527 CB ALA E 167 166.469 161.619 130.364 1.00125.81 C ANISOU10527 CB ALA E 167 15437 15535 16831 2523 1695 1343 C ATOM 10528 N ILE E 168 167.714 159.539 128.330 1.00126.39 N ANISOU10528 N ILE E 168 15849 15269 16904 2974 2272 1375 N ATOM 10529 CA ILE E 168 167.807 158.915 127.005 1.00126.81 C ANISOU10529 CA ILE E 168 16103 15141 16940 3006 2515 1260 C ATOM 10530 C ILE E 168 167.931 157.394 127.185 1.00132.56 C ANISOU10530 C ILE E 168 17234 15501 17633 3320 2797 1314 C ATOM 10531 O ILE E 168 167.187 156.650 126.546 1.00132.41 O ANISOU10531 O ILE E 168 17594 15122 17592 3181 2972 1145 O ATOM 10532 CB ILE E 168 168.972 159.508 126.154 1.00130.53 C ANISOU10532 CB ILE E 168 16228 15939 17427 3138 2519 1313 C ATOM 10533 CG1 ILE E 168 168.902 161.054 126.102 1.00128.36 C ANISOU10533 CG1 ILE E 168 15564 15987 17219 2822 2234 1298 C ATOM 10534 CG2 ILE E 168 168.974 158.913 124.737 1.00132.53 C ANISOU10534 CG2 ILE E 168 16713 16029 17613 3170 2777 1166 C ATOM 10535 CD1 ILE E 168 170.226 161.758 125.938 1.00139.72 C ANISOU10535 CD1 ILE E 168 16554 17815 18719 2964 2158 1457 C ATOM 10536 N LYS E 169 168.847 156.948 128.077 1.00130.84 N ANISOU10536 N LYS E 169 16937 15369 17408 3734 2829 1550 N ATOM 10537 CA LYS E 169 169.099 155.547 128.422 1.00133.95 C ANISOU10537 CA LYS E 169 17696 15420 17779 4112 3093 1670 C ATOM 10538 C LYS E 169 167.797 154.829 128.777 1.00138.12 C ANISOU10538 C LYS E 169 18672 15492 18316 3865 3183 1587 C ATOM 10539 O LYS E 169 167.521 153.769 128.219 1.00140.19 O ANISOU10539 O LYS E 169 19361 15317 18587 3909 3441 1491 O ATOM 10540 CB LYS E 169 170.074 155.462 129.604 1.00138.15 C ANISOU10540 CB LYS E 169 17997 16210 18285 4533 3014 1974 C ATOM 10541 CG LYS E 169 171.350 154.684 129.319 1.00160.70 C ANISOU10541 CG LYS E 169 20835 19100 21124 5089 3236 2142 C ATOM 10542 CD LYS E 169 172.050 154.253 130.613 1.00176.53 C ANISOU10542 CD LYS E 169 22744 21250 23078 5532 3197 2464 C ATOM 10543 CE LYS E 169 172.868 155.351 131.255 1.00189.41 C ANISOU10543 CE LYS E 169 23781 23498 24688 5563 2868 2599 C ATOM 10544 NZ LYS E 169 173.080 155.096 132.702 1.00202.21 N ANISOU10544 NZ LYS E 169 25359 25257 26214 5831 2743 2854 N ATOM 10545 N LYS E 170 166.985 155.435 129.674 1.00132.52 N ANISOU10545 N LYS E 170 17862 14887 17604 3589 2974 1612 N ATOM 10546 CA LYS E 170 165.693 154.915 130.123 1.00132.20 C ANISOU10546 CA LYS E 170 18152 14503 17575 3311 3037 1571 C ATOM 10547 C LYS E 170 164.680 154.900 128.977 1.00134.74 C ANISOU10547 C LYS E 170 18660 14602 17931 2872 3088 1276 C ATOM 10548 O LYS E 170 164.070 153.859 128.744 1.00136.12 O ANISOU10548 O LYS E 170 19249 14334 18137 2772 3294 1204 O ATOM 10549 CB LYS E 170 165.158 155.724 131.315 1.00132.53 C ANISOU10549 CB LYS E 170 17972 14809 17576 3162 2798 1667 C ATOM 10550 N PHE E 171 164.536 156.024 128.239 1.00128.81 N ANISOU10550 N PHE E 171 17616 14154 17175 2615 2901 1112 N ATOM 10551 CA PHE E 171 163.612 156.154 127.105 1.00127.87 C ANISOU10551 CA PHE E 171 17610 13924 17052 2213 2905 843 C ATOM 10552 C PHE E 171 163.882 155.087 126.035 1.00133.62 C ANISOU10552 C PHE E 171 18700 14316 17755 2317 3164 692 C ATOM 10553 O PHE E 171 162.925 154.498 125.535 1.00133.87 O ANISOU10553 O PHE E 171 19040 14038 17785 2015 3246 500 O ATOM 10554 CB PHE E 171 163.691 157.565 126.490 1.00127.05 C ANISOU10554 CB PHE E 171 17111 14230 16933 2035 2678 759 C ATOM 10555 CG PHE E 171 162.785 157.817 125.307 1.00128.24 C ANISOU10555 CG PHE E 171 17328 14352 17046 1657 2652 513 C ATOM 10556 CD1 PHE E 171 161.424 158.045 125.487 1.00130.62 C ANISOU10556 CD1 PHE E 171 17660 14612 17359 1271 2548 422 C ATOM 10557 CD2 PHE E 171 163.298 157.864 124.015 1.00131.23 C ANISOU10557 CD2 PHE E 171 17709 14796 17357 1702 2728 388 C ATOM 10558 CE1 PHE E 171 160.589 158.291 124.392 1.00131.14 C ANISOU10558 CE1 PHE E 171 17752 14705 17371 934 2498 208 C ATOM 10559 CE2 PHE E 171 162.463 158.108 122.922 1.00133.66 C ANISOU10559 CE2 PHE E 171 18074 15122 17590 1368 2685 167 C ATOM 10560 CZ PHE E 171 161.115 158.317 123.116 1.00130.67 C ANISOU10560 CZ PHE E 171 17717 14707 17225 984 2558 78 C ATOM 10561 N VAL E 172 165.175 154.828 125.709 1.00131.40 N ANISOU10561 N VAL E 172 18377 14102 17446 2747 3292 774 N ATOM 10562 CA VAL E 172 165.604 153.829 124.715 1.00134.03 C ANISOU10562 CA VAL E 172 19060 14136 17731 2948 3565 632 C ATOM 10563 C VAL E 172 165.163 152.421 125.169 1.00142.01 C ANISOU10563 C VAL E 172 20594 14571 18793 3007 3790 637 C ATOM 10564 O VAL E 172 164.487 151.721 124.411 1.00143.33 O ANISOU10564 O VAL E 172 21150 14364 18944 2774 3916 383 O ATOM 10565 CB VAL E 172 167.131 153.915 124.437 1.00138.37 C ANISOU10565 CB VAL E 172 19385 14946 18242 3453 3663 776 C ATOM 10566 CG1 VAL E 172 167.642 152.675 123.708 1.00142.48 C ANISOU10566 CG1 VAL E 172 20331 15097 18710 3793 3997 676 C ATOM 10567 CG2 VAL E 172 167.470 155.173 123.644 1.00135.38 C ANISOU10567 CG2 VAL E 172 18574 15047 17817 3317 3498 726 C ATOM 10568 N VAL E 173 165.499 152.047 126.420 1.00140.36 N ANISOU10568 N VAL E 173 20392 14297 18640 3287 3825 927 N ATOM 10569 CA VAL E 173 165.163 150.757 127.034 1.00144.23 C ANISOU10569 CA VAL E 173 21359 14246 19197 3385 4047 1022 C ATOM 10570 C VAL E 173 163.618 150.583 127.109 1.00148.66 C ANISOU10570 C VAL E 173 22137 14531 19815 2799 4001 869 C ATOM 10571 O VAL E 173 163.128 149.479 126.860 1.00151.36 O ANISOU10571 O VAL E 173 22964 14330 20216 2685 4209 761 O ATOM 10572 CB VAL E 173 165.867 150.610 128.413 1.00149.06 C ANISOU10572 CB VAL E 173 21842 14975 19818 3818 4048 1413 C ATOM 10573 CG1 VAL E 173 165.299 149.456 129.237 1.00152.14 C ANISOU10573 CG1 VAL E 173 22686 14843 20279 3839 4245 1574 C ATOM 10574 CG2 VAL E 173 167.374 150.439 128.236 1.00151.10 C ANISOU10574 CG2 VAL E 173 21966 15413 20032 4424 4157 1561 C ATOM 10575 N THR E 174 162.867 151.677 127.381 1.00142.61 N ANISOU10575 N THR E 174 21012 14137 19037 2427 3735 847 N ATOM 10576 CA THR E 174 161.397 151.679 127.456 1.00142.42 C ANISOU10576 CA THR E 174 21077 13976 19059 1877 3667 727 C ATOM 10577 C THR E 174 160.789 151.212 126.128 1.00148.33 C ANISOU10577 C THR E 174 22112 14449 19799 1532 3736 370 C ATOM 10578 O THR E 174 159.951 150.316 126.145 1.00150.54 O ANISOU10578 O THR E 174 22751 14294 20154 1244 3859 288 O ATOM 10579 CB THR E 174 160.865 153.076 127.853 1.00151.22 C ANISOU10579 CB THR E 174 21712 15604 20140 1635 3370 756 C ATOM 10580 OG1 THR E 174 161.465 153.470 129.086 1.00155.12 O ANISOU10580 OG1 THR E 174 21979 16346 20615 1957 3295 1048 O ATOM 10581 CG2 THR E 174 159.340 153.122 127.992 1.00148.67 C ANISOU10581 CG2 THR E 174 21418 15212 19859 1109 3306 668 C ATOM 10582 N GLN E 175 161.225 151.797 124.992 1.00144.37 N ANISOU10582 N GLN E 175 21456 14203 19197 1556 3660 165 N ATOM 10583 CA GLN E 175 160.721 151.463 123.653 1.00146.30 C ANISOU10583 CA GLN E 175 21943 14275 19370 1258 3695 -196 C ATOM 10584 C GLN E 175 161.069 150.013 123.262 1.00157.17 C ANISOU10584 C GLN E 175 23897 15056 20765 1443 3995 -324 C ATOM 10585 O GLN E 175 160.233 149.326 122.667 1.00159.69 O ANISOU10585 O GLN E 175 24568 15016 21089 1068 4045 -596 O ATOM 10586 CB GLN E 175 161.252 152.450 122.590 1.00145.17 C ANISOU10586 CB GLN E 175 21492 14582 19083 1324 3569 -326 C ATOM 10587 CG GLN E 175 161.111 153.941 122.929 1.00149.38 C ANISOU10587 CG GLN E 175 21477 15668 19613 1213 3290 -187 C ATOM 10588 CD GLN E 175 159.696 154.464 122.900 1.00162.83 C ANISOU10588 CD GLN E 175 23055 17489 21325 691 3092 -293 C ATOM 10589 OE1 GLN E 175 159.238 155.020 121.901 1.00155.12 O ANISOU10589 OE1 GLN E 175 21967 16726 20246 441 2966 -485 O ATOM 10590 NE2 GLN E 175 158.996 154.361 124.021 1.00156.33 N ANISOU10590 NE2 GLN E 175 22209 16582 20608 547 3057 -140 N ATOM 10591 N CYS E 176 162.281 149.542 123.638 1.00156.28 N ANISOU10591 N CYS E 176 23882 14832 20667 2019 4187 -125 N ATOM 10592 CA CYS E 176 162.773 148.183 123.368 1.00161.71 C ANISOU10592 CA CYS E 176 25126 14938 21378 2322 4503 -199 C ATOM 10593 C CYS E 176 161.941 147.112 124.103 1.00169.84 C ANISOU10593 C CYS E 176 26594 15368 22571 2089 4638 -138 C ATOM 10594 O CYS E 176 162.019 145.935 123.747 1.00174.68 O ANISOU10594 O CYS E 176 27758 15384 23227 2178 4887 -279 O ATOM 10595 CB CYS E 176 164.252 148.068 123.720 1.00163.02 C ANISOU10595 CB CYS E 176 25193 15223 21523 3029 4655 66 C ATOM 10596 SG CYS E 176 165.343 149.033 122.647 1.00165.02 S ANISOU10596 SG CYS E 176 25030 16072 21600 3319 4594 -21 S ATOM 10597 N ILE E 177 161.162 147.515 125.122 1.00164.40 N ANISOU10597 N ILE E 177 25673 14823 21970 1802 4492 77 N ATOM 10598 CA ILE E 177 160.283 146.623 125.882 1.00167.28 C ANISOU10598 CA ILE E 177 26376 14692 22492 1524 4613 188 C ATOM 10599 C ILE E 177 158.849 146.822 125.367 1.00170.45 C ANISOU10599 C ILE E 177 26750 15096 22916 790 4452 -89 C ATOM 10600 O ILE E 177 158.151 145.843 125.115 1.00174.35 O ANISOU10600 O ILE E 177 27684 15050 23513 445 4581 -254 O ATOM 10601 CB ILE E 177 160.418 146.857 127.422 1.00169.01 C ANISOU10601 CB ILE E 177 26360 15093 22762 1752 4595 650 C ATOM 10602 CG1 ILE E 177 161.840 146.503 127.915 1.00171.16 C ANISOU10602 CG1 ILE E 177 26687 15341 23005 2490 4758 930 C ATOM 10603 CG2 ILE E 177 159.348 146.082 128.222 1.00172.63 C ANISOU10603 CG2 ILE E 177 27099 15122 23372 1388 4712 799 C ATOM 10604 CD1 ILE E 177 162.251 147.120 129.263 1.00176.10 C ANISOU10604 CD1 ILE E 177 26922 16398 23588 2791 4641 1340 C ATOM 10605 N LEU E 178 158.438 148.093 125.184 1.00161.90 N ANISOU10605 N LEU E 178 25150 14623 21742 558 4166 -141 N ATOM 10606 CA LEU E 178 157.109 148.503 124.734 1.00160.43 C ANISOU10606 CA LEU E 178 24809 14596 21552 -82 3970 -357 C ATOM 10607 C LEU E 178 156.758 147.928 123.355 1.00167.04 C ANISOU10607 C LEU E 178 25984 15156 22325 -393 3990 -800 C ATOM 10608 O LEU E 178 155.792 147.172 123.265 1.00169.98 O ANISOU10608 O LEU E 178 26636 15150 22798 -867 4031 -943 O ATOM 10609 CB LEU E 178 157.011 150.043 124.719 1.00154.89 C ANISOU10609 CB LEU E 178 23501 14607 20742 -112 3681 -310 C ATOM 10610 CG LEU E 178 155.663 150.671 124.350 1.00158.09 C ANISOU10610 CG LEU E 178 23643 15296 21127 -692 3455 -469 C ATOM 10611 CD1 LEU E 178 154.697 150.648 125.526 1.00158.25 C ANISOU10611 CD1 LEU E 178 23534 15321 21272 -949 3448 -226 C ATOM 10612 CD2 LEU E 178 155.852 152.092 123.880 1.00155.91 C ANISOU10612 CD2 LEU E 178 22892 15629 20718 -622 3210 -503 C ATOM 10613 N LEU E 179 157.541 148.279 122.303 1.00162.55 N ANISOU10613 N LEU E 179 25390 14789 21584 -139 3963 -1011 N ATOM 10614 CA LEU E 179 157.326 147.875 120.907 1.00165.17 C ANISOU10614 CA LEU E 179 26016 14963 21779 -367 3961 -1455 C ATOM 10615 C LEU E 179 157.099 146.345 120.723 1.00175.25 C ANISOU10615 C LEU E 179 27973 15457 23157 -511 4199 -1667 C ATOM 10616 O LEU E 179 156.075 146.008 120.127 1.00177.31 O ANISOU10616 O LEU E 179 28398 15562 23409 -1077 4100 -1975 O ATOM 10617 CB LEU E 179 158.465 148.357 119.997 1.00164.06 C ANISOU10617 CB LEU E 179 25784 15121 21431 85 3983 -1559 C ATOM 10618 N PRO E 180 157.946 145.401 121.224 1.00174.61 N ANISOU10618 N PRO E 180 28297 14866 23181 -52 4497 -1513 N ATOM 10619 CA PRO E 180 157.656 143.974 120.992 1.00180.89 C ANISOU10619 CA PRO E 180 29781 14860 24088 -227 4721 -1737 C ATOM 10620 C PRO E 180 156.430 143.470 121.760 1.00186.17 C ANISOU10620 C PRO E 180 30550 15196 24988 -811 4705 -1631 C ATOM 10621 O PRO E 180 155.629 142.741 121.181 1.00190.06 O ANISOU10621 O PRO E 180 31413 15270 25531 -1327 4705 -1965 O ATOM 10622 CB PRO E 180 158.937 143.263 121.454 1.00185.23 C ANISOU10622 CB PRO E 180 30655 15031 24693 504 5042 -1508 C ATOM 10623 CG PRO E 180 159.975 144.334 121.551 1.00184.81 C ANISOU10623 CG PRO E 180 30075 15649 24496 1035 4960 -1282 C ATOM 10624 CD PRO E 180 159.222 145.558 121.948 1.00174.61 C ANISOU10624 CD PRO E 180 28167 14981 23194 652 4642 -1148 C ATOM 10625 N VAL E 181 156.269 143.877 123.039 1.00179.66 N ANISOU10625 N VAL E 181 29385 14587 24289 -750 4684 -1178 N ATOM 10626 CA VAL E 181 155.155 143.474 123.911 1.00181.19 C ANISOU10626 CA VAL E 181 29605 14545 24695 -1248 4701 -987 C ATOM 10627 C VAL E 181 153.815 143.989 123.344 1.00184.21 C ANISOU10627 C VAL E 181 29689 15258 25045 -1990 4419 -1249 C ATOM 10628 O VAL E 181 152.853 143.218 123.284 1.00188.26 O ANISOU10628 O VAL E 181 30465 15357 25709 -2561 4453 -1380 O ATOM 10629 CB VAL E 181 155.386 143.928 125.385 1.00181.74 C ANISOU10629 CB VAL E 181 29334 14886 24833 -927 4736 -441 C ATOM 10630 CG1 VAL E 181 154.114 143.836 126.227 1.00182.21 C ANISOU10630 CG1 VAL E 181 29255 14924 25052 -1474 4708 -235 C ATOM 10631 CG2 VAL E 181 156.506 143.119 126.033 1.00184.31 C ANISOU10631 CG2 VAL E 181 30038 14768 25224 -282 5037 -156 C ATOM 10632 N SER E 182 153.767 145.267 122.910 1.00175.33 N ANISOU10632 N SER E 182 28020 14865 23732 -1981 4145 -1316 N ATOM 10633 CA SER E 182 152.564 145.899 122.356 1.00173.71 C ANISOU10633 CA SER E 182 27461 15078 23463 -2593 3859 -1526 C ATOM 10634 C SER E 182 152.147 145.266 121.023 1.00181.01 C ANISOU10634 C SER E 182 28746 15728 24300 -3008 3798 -2046 C ATOM 10635 O SER E 182 150.967 144.953 120.858 1.00183.51 O ANISOU10635 O SER E 182 29060 15967 24699 -3661 3687 -2200 O ATOM 10636 CB SER E 182 152.770 147.400 122.176 1.00171.20 C ANISOU10636 CB SER E 182 26539 15550 22960 -2385 3611 -1454 C ATOM 10637 OG SER E 182 153.174 148.017 123.388 1.00176.56 O ANISOU10637 OG SER E 182 26901 16486 23698 -2013 3641 -1023 O ATOM 10638 N SER E 183 153.110 145.057 120.095 1.00177.42 N ANISOU10638 N SER E 183 28599 15143 23671 -2633 3875 -2315 N ATOM 10639 CA SER E 183 152.880 144.460 118.774 1.00181.25 C ANISOU10639 CA SER E 183 29481 15377 24009 -2931 3829 -2849 C ATOM 10640 C SER E 183 152.279 143.051 118.871 1.00190.16 C ANISOU10640 C SER E 183 31203 15699 25351 -3378 3987 -3031 C ATOM 10641 O SER E 183 151.356 142.739 118.116 1.00193.33 O ANISOU10641 O SER E 183 31719 16028 25708 -3997 3819 -3414 O ATOM 10642 CB SER E 183 154.177 144.410 117.974 1.00185.37 C ANISOU10642 CB SER E 183 30258 15862 24313 -2321 3966 -3026 C ATOM 10643 OG SER E 183 155.195 143.724 118.683 1.00196.31 O ANISOU10643 OG SER E 183 31982 16767 25839 -1756 4291 -2781 O ATOM 10644 N LEU E 184 152.790 142.216 119.802 1.00187.38 N ANISOU10644 N LEU E 184 31220 14748 25229 -3078 4298 -2748 N ATOM 10645 CA LEU E 184 152.308 140.850 120.013 1.00193.65 C ANISOU10645 CA LEU E 184 32619 14688 26269 -3457 4495 -2852 C ATOM 10646 C LEU E 184 150.909 140.840 120.629 1.00198.08 C ANISOU10646 C LEU E 184 32907 15312 27042 -4203 4364 -2703 C ATOM 10647 O LEU E 184 150.085 140.022 120.222 1.00203.59 O ANISOU10647 O LEU E 184 33940 15558 27858 -4840 4341 -3003 O ATOM 10648 CB LEU E 184 153.268 140.045 120.902 1.00195.58 C ANISOU10648 CB LEU E 184 33294 14323 26695 -2863 4873 -2509 C ATOM 10649 CG LEU E 184 154.644 139.696 120.341 1.00201.46 C ANISOU10649 CG LEU E 184 34442 14815 27288 -2126 5087 -2654 C ATOM 10650 CD1 LEU E 184 155.592 139.319 121.457 1.00201.51 C ANISOU10650 CD1 LEU E 184 34590 14532 27444 -1451 5390 -2155 C ATOM 10651 CD2 LEU E 184 154.567 138.571 119.324 1.00207.37 C ANISOU10651 CD2 LEU E 184 35255 15323 28211 -2146 4581 -3093 C ATOM 10652 N LEU E 185 150.641 141.743 121.601 1.00189.06 N ANISOU10652 N LEU E 185 31155 14735 25944 -4132 4280 -2251 N ATOM 10653 CA LEU E 185 149.349 141.865 122.290 1.00189.22 C ANISOU10653 CA LEU E 185 30821 14932 26144 -4753 4180 -2038 C ATOM 10654 C LEU E 185 148.220 142.213 121.306 1.00194.53 C ANISOU10654 C LEU E 185 31217 15988 26708 -5458 3846 -2436 C ATOM 10655 O LEU E 185 147.114 141.686 121.442 1.00198.47 O ANISOU10655 O LEU E 185 31725 16293 27392 -6151 3809 -2474 O ATOM 10656 CB LEU E 185 149.431 142.917 123.415 1.00182.82 C ANISOU10656 CB LEU E 185 29406 14739 25320 -4411 4147 -1525 C ATOM 10657 CG LEU E 185 148.207 143.062 124.340 1.00187.80 C ANISOU10657 CG LEU E 185 29652 15579 26125 -4914 4114 -1210 C ATOM 10658 CD1 LEU E 185 148.062 141.869 125.278 1.00193.32 C ANISOU10658 CD1 LEU E 185 30788 15555 27111 -5040 4440 -916 C ATOM 10659 CD2 LEU E 185 148.280 144.345 125.143 1.00183.41 C ANISOU10659 CD2 LEU E 185 28461 15768 25459 -4559 4005 -845 C ATOM 10660 N LEU E 186 148.508 143.081 120.316 1.00187.78 N ANISOU10660 N LEU E 186 30109 15687 25553 -5282 3608 -2711 N ATOM 10661 CA LEU E 186 147.557 143.493 119.277 1.00188.52 C ANISOU10661 CA LEU E 186 29928 16225 25477 -5852 3267 -3090 C ATOM 10662 C LEU E 186 147.262 142.342 118.311 1.00200.22 C ANISOU10662 C LEU E 186 32011 17106 26957 -6333 3263 -3623 C ATOM 10663 O LEU E 186 146.132 142.218 117.833 1.00202.90 O ANISOU10663 O LEU E 186 32209 17584 27301 -7050 3029 -3873 O ATOM 10664 CB LEU E 186 148.094 144.704 118.495 1.00182.95 C ANISOU10664 CB LEU E 186 28851 16228 24434 -5444 3055 -3194 C ATOM 10665 CG LEU E 186 148.172 146.021 119.252 1.00180.06 C ANISOU10665 CG LEU E 186 27828 16546 24042 -5101 2967 -2757 C ATOM 10666 CD1 LEU E 186 149.309 146.861 118.734 1.00175.71 C ANISOU10666 CD1 LEU E 186 27170 16348 23243 -4462 2938 -2773 C ATOM 10667 CD2 LEU E 186 146.867 146.780 119.171 1.00180.62 C ANISOU10667 CD2 LEU E 186 27308 17237 24083 -5619 2669 -2733 C ATOM 10668 N TYR E 187 148.284 141.509 118.026 1.00200.20 N ANISOU10668 N TYR E 187 32676 16449 26941 -5926 3517 -3803 N ATOM 10669 CA TYR E 187 148.189 140.348 117.144 1.00206.58 C ANISOU10669 CA TYR E 187 33969 16697 27827 -6122 3371 -4261 C ATOM 10670 C TYR E 187 147.231 139.303 117.732 1.00212.19 C ANISOU10670 C TYR E 187 34177 17217 29228 -6254 2754 -3940 C ATOM 10671 O TYR E 187 146.374 138.802 117.011 1.00214.52 O ANISOU10671 O TYR E 187 34194 17563 29749 -6565 2189 -4188 O ATOM 10672 CB TYR E 187 149.579 139.738 116.899 1.00207.72 C ANISOU10672 CB TYR E 187 34491 16444 27989 -5261 3457 -4302 C ATOM 10673 N ILE E 188 147.343 139.027 119.046 1.00209.68 N ANISOU10673 N ILE E 188 34056 16504 29109 -6255 3184 -3486 N ATOM 10674 CA ILE E 188 146.521 138.062 119.788 1.00212.12 C ANISOU10674 CA ILE E 188 34102 16500 29993 -6499 2865 -3137 C ATOM 10675 C ILE E 188 145.031 138.483 119.786 1.00215.94 C ANISOU10675 C ILE E 188 33818 17569 30659 -7089 2394 -3016 C ATOM 10676 O ILE E 188 144.165 137.627 119.593 1.00218.43 O ANISOU10676 O ILE E 188 33857 17691 31447 -7372 1894 -3011 O ATOM 10677 CB ILE E 188 147.088 137.892 121.229 1.00213.16 C ANISOU10677 CB ILE E 188 34265 16419 30305 -6059 3169 -2513 C ATOM 10678 CG1 ILE E 188 148.425 137.117 121.195 1.00213.89 C ANISOU10678 CG1 ILE E 188 34738 16045 30484 -5271 3191 -2505 C ATOM 10679 CG2 ILE E 188 146.084 137.215 122.175 1.00215.66 C ANISOU10679 CG2 ILE E 188 34213 16599 31127 -6413 2913 -2037 C ATOM 10680 CD1 ILE E 188 149.368 137.396 122.335 1.00216.61 C ANISOU10680 CD1 ILE E 188 34959 16532 30811 -4578 3381 -1961 C ATOM 10681 N ILE E 189 144.742 139.785 119.984 1.00211.76 N ANISOU10681 N ILE E 189 33239 17564 29656 -7502 2854 -3049 N ATOM 10682 CA ILE E 189 143.374 140.313 120.008 1.00212.28 C ANISOU10682 CA ILE E 189 32711 18186 29759 -8171 2623 -2997 C ATOM 10683 C ILE E 189 142.735 140.260 118.605 1.00217.22 C ANISOU10683 C ILE E 189 32854 19199 30479 -8198 1823 -3364 C ATOM 10684 O ILE E 189 141.593 139.813 118.481 1.00219.13 O ANISOU10684 O ILE E 189 32656 19490 31112 -8586 1385 -3310 O ATOM 10685 CB ILE E 189 143.343 141.748 120.589 1.00211.09 C ANISOU10685 CB ILE E 189 32312 18688 29206 -8265 3025 -2834 C ATOM 10686 N LYS E 190 143.481 140.687 117.561 1.00214.63 N ANISOU10686 N LYS E 190 32905 18983 29661 -8046 1933 -3861 N ATOM 10687 CA LYS E 190 143.017 140.720 116.170 1.00216.30 C ANISOU10687 CA LYS E 190 32896 19515 29773 -8154 1385 -4321 C ATOM 10688 C LYS E 190 142.869 139.313 115.553 1.00223.65 C ANISOU10688 C LYS E 190 33616 19985 31377 -7677 599 -4406 C ATOM 10689 O LYS E 190 141.856 139.054 114.899 1.00225.73 O ANISOU10689 O LYS E 190 33479 20391 31895 -7950 63 -4582 O ATOM 10690 CB LYS E 190 143.957 141.575 115.306 1.00215.85 C ANISOU10690 CB LYS E 190 33054 19828 29132 -7782 1528 -4638 C ATOM 10691 N ILE E 191 143.863 138.417 115.750 1.00222.80 N ANISOU10691 N ILE E 191 34044 19206 31401 -7272 791 -4443 N ATOM 10692 CA ILE E 191 143.849 137.060 115.183 1.00226.62 C ANISOU10692 CA ILE E 191 34526 19158 32421 -6992 234 -4665 C ATOM 10693 C ILE E 191 142.932 136.133 116.006 1.00232.50 C ANISOU10693 C ILE E 191 34692 19615 34032 -7053 -257 -4168 C ATOM 10694 O ILE E 191 142.011 135.543 115.439 1.00235.11 O ANISOU10694 O ILE E 191 34679 19844 34808 -7271 -809 -4345 O ATOM 10695 CB ILE E 191 145.294 136.480 115.025 1.00228.71 C ANISOU10695 CB ILE E 191 35156 19061 32681 -6171 293 -4766 C ATOM 10696 CG1 ILE E 191 146.166 137.305 114.027 1.00227.17 C ANISOU10696 CG1 ILE E 191 35228 19272 31813 -5843 501 -5180 C ATOM 10697 CG2 ILE E 191 145.308 134.974 114.699 1.00233.24 C ANISOU10697 CG2 ILE E 191 35642 19053 33927 -5853 -289 -4924 C ATOM 10698 CD1 ILE E 191 145.703 137.396 112.512 1.00233.93 C ANISOU10698 CD1 ILE E 191 35548 20649 32684 -5580 -298 -5618 C ATOM 10699 N GLY E 192 143.202 136.011 117.307 1.00229.94 N ATOM 10700 CA GLY E 192 142.446 135.159 118.220 1.00232.57 C ATOM 10701 C GLY E 192 140.999 135.564 118.421 1.00236.93 C ATOM 10702 O GLY E 192 140.628 136.717 118.189 1.00234.66 O