>>2ZTA:HELIX    1  A1 ARG A    1  VAL A   30  1                                  30    
RMKQLEDKVEELLSKNYHLENEVARLKKLV
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 1 A1 ARG A 1 VAL A 30 1 30 ATOM 4 N ARG A 1 37.494 13.382 15.829 1.00 45.73 N ATOM 5 CA ARG A 1 38.127 14.684 15.695 1.00 60.03 C ATOM 6 C ARG A 1 37.179 15.790 15.306 1.00 36.65 C ATOM 7 O ARG A 1 36.239 15.576 14.555 1.00 33.17 O ATOM 8 CB ARG A 1 39.474 14.700 15.010 1.00 65.99 C ATOM 9 CG ARG A 1 40.613 14.837 16.017 1.00 76.93 C ATOM 10 CD ARG A 1 40.603 16.121 16.852 1.00 65.15 C ATOM 11 NE ARG A 1 40.475 17.405 16.157 1.00 75.43 N ATOM 12 CZ ARG A 1 40.623 17.720 14.874 1.00 55.68 C ATOM 13 NH1 ARG A 1 40.949 16.805 13.947 1.00 71.65 N ATOM 14 NH2 ARG A 1 40.451 18.986 14.516 1.00 26.50 N ATOM 15 N MET A 2 37.447 16.947 15.901 1.00 33.89 N ATOM 16 CA MET A 2 36.661 18.155 15.840 1.00 37.60 C ATOM 17 C MET A 2 36.279 18.671 14.490 1.00 54.23 C ATOM 18 O MET A 2 35.112 19.078 14.259 1.00 38.62 O ATOM 19 CB MET A 2 37.212 19.245 16.741 1.00 29.53 C ATOM 20 CG MET A 2 36.061 19.824 17.539 1.00 63.41 C ATOM 21 SD MET A 2 36.542 20.556 19.116 1.00 88.28 S ATOM 22 CE MET A 2 38.180 21.188 18.664 1.00 59.09 C ATOM 23 N LYS A 3 37.334 18.677 13.666 1.00 40.89 N ATOM 24 CA LYS A 3 37.330 19.059 12.267 1.00 56.06 C ATOM 25 C LYS A 3 36.361 18.171 11.532 1.00 31.63 C ATOM 26 O LYS A 3 35.348 18.645 11.036 1.00 38.98 O ATOM 27 CB LYS A 3 38.693 18.969 11.607 1.00 37.96 C ATOM 28 CG LYS A 3 38.865 19.967 10.478 1.00 43.76 C ATOM 29 CD LYS A 3 40.277 19.857 9.961 1.00 58.21 C ATOM 30 CE LYS A 3 41.133 19.056 10.944 1.00 40.88 C ATOM 31 NZ LYS A 3 42.277 18.355 10.336 1.00 58.54 N ATOM 32 N GLN A 4 36.630 16.866 11.489 1.00 19.06 N ATOM 33 CA GLN A 4 35.671 15.982 10.839 1.00 21.72 C ATOM 34 C GLN A 4 34.203 16.207 11.309 1.00 35.28 C ATOM 35 O GLN A 4 33.250 16.103 10.533 1.00 24.85 O ATOM 36 CB GLN A 4 36.016 14.498 11.074 1.00 25.52 C ATOM 37 CG GLN A 4 36.973 13.932 10.002 1.00 56.68 C ATOM 38 CD GLN A 4 36.351 13.638 8.622 1.00 70.58 C ATOM 39 OE1 GLN A 4 36.059 14.530 7.794 1.00 77.39 O ATOM 40 NE2 GLN A 4 36.207 12.357 8.333 1.00 65.22 N ATOM 41 N LEU A 5 33.995 16.437 12.613 1.00 25.74 N ATOM 42 CA LEU A 5 32.643 16.600 13.126 1.00 24.37 C ATOM 43 C LEU A 5 32.065 17.927 12.677 1.00 13.63 C ATOM 44 O LEU A 5 30.899 17.984 12.322 1.00 17.36 O ATOM 45 CB LEU A 5 32.459 16.419 14.670 1.00 52.13 C ATOM 46 CG LEU A 5 32.495 15.019 15.313 1.00 17.74 C ATOM 47 CD1 LEU A 5 32.860 15.235 16.791 1.00 13.03 C ATOM 48 CD2 LEU A 5 31.102 14.392 15.259 1.00 17.80 C ATOM 49 N GLU A 6 32.876 18.989 12.658 1.00 8.18 N ATOM 50 CA GLU A 6 32.395 20.303 12.225 1.00 14.13 C ATOM 51 C GLU A 6 31.875 20.301 10.802 1.00 14.10 C ATOM 52 O GLU A 6 30.804 20.880 10.473 1.00 17.12 O ATOM 53 CB GLU A 6 33.529 21.306 12.328 1.00 16.68 C ATOM 54 CG GLU A 6 33.764 21.673 13.808 1.00 32.05 C ATOM 55 CD GLU A 6 34.959 22.544 14.106 1.00 25.61 C ATOM 56 OE1 GLU A 6 35.762 22.895 13.268 1.00 25.31 O ATOM 57 OE2 GLU A 6 35.036 22.890 15.368 1.00 31.54 O ATOM 58 N ASP A 7 32.702 19.646 9.977 1.00 23.47 N ATOM 59 CA ASP A 7 32.448 19.407 8.572 1.00 26.38 C ATOM 60 C ASP A 7 31.148 18.623 8.330 1.00 16.64 C ATOM 61 O ASP A 7 30.375 18.963 7.441 1.00 20.83 O ATOM 62 CB ASP A 7 33.610 18.684 7.924 1.00 28.70 C ATOM 63 CG ASP A 7 34.776 19.591 7.745 1.00 25.78 C ATOM 64 OD1 ASP A 7 34.733 20.818 7.831 1.00 32.18 O ATOM 65 OD2 ASP A 7 35.858 18.890 7.598 1.00 35.29 O ATOM 66 N LYS A 8 30.911 17.584 9.136 1.00 15.32 N ATOM 67 CA LYS A 8 29.714 16.773 9.066 1.00 6.79 C ATOM 68 C LYS A 8 28.481 17.604 9.342 1.00 13.70 C ATOM 69 O LYS A 8 27.466 17.458 8.679 1.00 14.67 O ATOM 70 CB LYS A 8 29.793 15.666 10.055 1.00 13.82 C ATOM 71 CG LYS A 8 28.684 14.726 9.758 1.00 12.01 C ATOM 72 CD LYS A 8 29.109 13.708 8.745 1.00 28.04 C ATOM 73 CE LYS A 8 27.965 12.797 8.393 1.00 57.68 C ATOM 74 NZ LYS A 8 27.772 12.684 6.944 1.00 72.06 N ATOM 75 N VAL A 9 28.592 18.513 10.326 1.00 11.44 N ATOM 76 CA VAL A 9 27.517 19.463 10.669 1.00 18.85 C ATOM 77 C VAL A 9 27.179 20.374 9.433 1.00 12.10 C ATOM 78 O VAL A 9 25.991 20.519 9.043 1.00 17.43 O ATOM 79 CB VAL A 9 27.758 20.281 12.002 1.00 18.74 C ATOM 80 CG1 VAL A 9 26.726 21.386 12.216 1.00 13.03 C ATOM 81 CG2 VAL A 9 27.750 19.406 13.261 1.00 11.31 C ATOM 82 N GLU A 10 28.239 20.961 8.817 1.00 9.65 N ATOM 83 CA GLU A 10 28.153 21.876 7.674 1.00 19.22 C ATOM 84 C GLU A 10 27.513 21.208 6.465 1.00 8.11 C ATOM 85 O GLU A 10 26.657 21.739 5.763 1.00 11.47 O ATOM 86 CB GLU A 10 29.542 22.470 7.407 1.00 18.99 C ATOM 87 CG GLU A 10 30.079 23.270 8.632 1.00 19.23 C ATOM 88 CD GLU A 10 31.529 23.665 8.413 1.00 47.00 C ATOM 89 OE1 GLU A 10 32.186 23.223 7.495 1.00 53.27 O ATOM 90 OE2 GLU A 10 32.014 24.539 9.265 1.00 45.58 O ATOM 91 N GLU A 11 27.889 19.970 6.297 1.00 11.85 N ATOM 92 CA GLU A 11 27.355 19.150 5.237 1.00 9.29 C ATOM 93 C GLU A 11 25.921 18.827 5.431 1.00 25.12 C ATOM 94 O GLU A 11 25.231 18.837 4.430 1.00 13.96 O ATOM 95 CB GLU A 11 28.092 17.819 5.028 1.00 9.28 C ATOM 96 CG GLU A 11 27.313 16.745 4.213 1.00 16.24 C ATOM 97 CD GLU A 11 28.113 15.460 4.232 1.00 30.59 C ATOM 98 OE1 GLU A 11 28.883 15.228 5.116 1.00 36.12 O ATOM 99 OE2 GLU A 11 28.041 14.694 3.171 1.00 33.70 O ATOM 100 N LEU A 12 25.516 18.443 6.673 1.00 19.39 N ATOM 101 CA LEU A 12 24.139 18.084 6.963 1.00 12.11 C ATOM 102 C LEU A 12 23.279 19.279 6.875 1.00 12.19 C ATOM 103 O LEU A 12 22.186 19.189 6.384 1.00 12.07 O ATOM 104 CB LEU A 12 23.901 17.347 8.299 1.00 11.79 C ATOM 105 CG LEU A 12 24.408 15.918 8.203 1.00 13.37 C ATOM 106 CD1 LEU A 12 24.580 15.300 9.560 1.00 8.52 C ATOM 107 CD2 LEU A 12 23.332 15.098 7.556 1.00 13.04 C ATOM 108 N LEU A 13 23.765 20.415 7.323 1.00 8.82 N ATOM 109 CA LEU A 13 22.953 21.628 7.228 1.00 16.32 C ATOM 110 C LEU A 13 22.604 22.010 5.740 1.00 15.04 C ATOM 111 O LEU A 13 21.470 22.358 5.332 1.00 13.86 O ATOM 112 CB LEU A 13 23.716 22.736 7.946 1.00 19.58 C ATOM 113 CG LEU A 13 22.928 23.994 7.907 1.00 25.83 C ATOM 114 CD1 LEU A 13 21.708 23.797 8.794 1.00 7.41 C ATOM 115 CD2 LEU A 13 23.809 25.215 8.210 1.00 25.48 C ATOM 116 N SER A 14 23.646 21.917 4.934 1.00 14.93 N ATOM 117 CA SER A 14 23.635 22.121 3.513 1.00 22.23 C ATOM 118 C SER A 14 22.646 21.127 2.832 1.00 9.42 C ATOM 119 O SER A 14 21.785 21.529 2.057 1.00 21.36 O ATOM 120 CB SER A 14 25.053 21.978 3.015 1.00 26.13 C ATOM 121 OG SER A 14 25.028 22.417 1.696 1.00 48.76 O ATOM 122 N LYS A 15 22.683 19.813 3.160 1.00 8.11 N ATOM 123 CA LYS A 15 21.673 18.905 2.595 1.00 8.59 C ATOM 124 C LYS A 15 20.294 19.295 3.079 1.00 35.47 C ATOM 125 O LYS A 15 19.328 19.265 2.308 1.00 12.56 O ATOM 126 CB LYS A 15 21.790 17.483 3.008 1.00 16.11 C ATOM 127 CG LYS A 15 23.038 16.816 2.568 1.00 28.23 C ATOM 128 CD LYS A 15 22.765 15.344 2.585 1.00 46.58 C ATOM 129 CE LYS A 15 23.758 14.586 3.423 1.00 37.62 C ATOM 130 NZ LYS A 15 23.747 13.146 3.130 1.00 55.20 N ATOM 131 N ASN A 16 20.197 19.618 4.379 1.00 14.67 N ATOM 132 CA ASN A 16 18.920 20.029 4.916 1.00 6.32 C ATOM 133 C ASN A 16 18.309 21.239 4.222 1.00 17.97 C ATOM 134 O ASN A 16 17.156 21.194 3.870 1.00 12.96 O ATOM 135 CB ASN A 16 18.758 20.059 6.426 1.00 18.75 C ATOM 136 CG ASN A 16 18.773 18.704 7.105 1.00 33.50 C ATOM 137 OD1 ASN A 16 18.912 17.604 6.512 1.00 18.75 O ATOM 138 ND2 ASN A 16 18.717 18.820 8.413 1.00 27.81 N ATOM 139 N TYR A 17 19.061 22.299 4.002 1.00 16.51 N ATOM 140 CA TYR A 17 18.583 23.458 3.271 1.00 14.91 C ATOM 141 C TYR A 17 18.128 23.043 1.844 1.00 19.73 C ATOM 142 O TYR A 17 17.125 23.509 1.347 1.00 15.25 O ATOM 143 CB TYR A 17 19.767 24.427 3.221 1.00 10.10 C ATOM 144 CG TYR A 17 19.852 25.203 4.516 1.00 12.89 C ATOM 145 CD1 TYR A 17 18.732 25.309 5.312 1.00 15.38 C ATOM 146 CD2 TYR A 17 21.034 25.849 4.940 1.00 16.37 C ATOM 147 CE1 TYR A 17 18.760 26.031 6.522 1.00 28.29 C ATOM 148 CE2 TYR A 17 21.070 26.603 6.098 1.00 22.84 C ATOM 149 CZ TYR A 17 19.922 26.660 6.918 1.00 19.78 C ATOM 150 OH TYR A 17 19.958 27.387 8.081 1.00 29.32 O ATOM 151 N HIS A 18 18.860 22.130 1.184 1.00 12.04 N ATOM 152 CA HIS A 18 18.464 21.654 -0.143 1.00 15.97 C ATOM 153 C HIS A 18 17.085 21.019 -0.057 1.00 26.66 C ATOM 154 O HIS A 18 16.234 21.259 -0.906 1.00 21.63 O ATOM 155 CB HIS A 18 19.420 20.613 -0.782 1.00 19.80 C ATOM 156 CG HIS A 18 18.811 20.081 -2.061 1.00 31.36 C ATOM 157 ND1 HIS A 18 18.302 18.787 -2.186 1.00 33.41 N ATOM 158 CD2 HIS A 18 18.570 20.721 -3.238 1.00 18.37 C ATOM 159 CE1 HIS A 18 17.794 18.680 -3.415 1.00 42.35 C ATOM 160 NE2 HIS A 18 17.929 19.832 -4.065 1.00 31.42 N ATOM 161 N LEU A 19 16.864 20.173 0.967 1.00 12.73 N ATOM 162 CA LEU A 19 15.562 19.515 1.148 1.00 10.65 C ATOM 163 C LEU A 19 14.448 20.469 1.537 1.00 12.26 C ATOM 164 O LEU A 19 13.294 20.298 1.171 1.00 20.26 O ATOM 165 CB LEU A 19 15.569 18.356 2.134 1.00 18.62 C ATOM 166 CG LEU A 19 16.384 17.163 1.675 1.00 21.64 C ATOM 167 CD1 LEU A 19 16.709 16.315 2.883 1.00 12.89 C ATOM 168 CD2 LEU A 19 15.594 16.277 0.731 1.00 13.75 C ATOM 169 N GLU A 20 14.762 21.483 2.300 1.00 13.79 N ATOM 170 CA GLU A 20 13.734 22.442 2.621 1.00 17.12 C ATOM 171 C GLU A 20 13.382 23.262 1.357 1.00 21.67 C ATOM 172 O GLU A 20 12.257 23.689 1.201 1.00 27.46 O ATOM 173 CB GLU A 20 14.172 23.409 3.730 1.00 24.95 C ATOM 174 CG GLU A 20 14.123 22.844 5.175 1.00 29.07 C ATOM 175 CD GLU A 20 14.912 23.638 6.227 1.00 39.49 C ATOM 176 OE1 GLU A 20 14.944 24.867 6.317 1.00 40.67 O ATOM 177 OE2 GLU A 20 15.543 22.856 7.072 1.00 55.44 O ATOM 178 N ASN A 21 14.350 23.531 0.462 1.00 20.65 N ATOM 179 CA ASN A 21 14.082 24.250 -0.792 1.00 20.82 C ATOM 180 C ASN A 21 13.093 23.412 -1.614 1.00 22.26 C ATOM 181 O ASN A 21 12.058 23.904 -2.029 1.00 26.98 O ATOM 182 CB ASN A 21 15.371 24.586 -1.597 1.00 16.22 C ATOM 183 CG ASN A 21 16.196 25.650 -0.906 1.00 17.67 C ATOM 184 OD1 ASN A 21 15.673 26.347 -0.032 1.00 27.56 O ATOM 185 ND2 ASN A 21 17.494 25.722 -1.216 1.00 21.97 N ATOM 186 N GLU A 22 13.371 22.115 -1.777 1.00 13.18 N ATOM 187 CA GLU A 22 12.464 21.235 -2.495 1.00 16.50 C ATOM 188 C GLU A 22 11.028 21.230 -1.953 1.00 39.27 C ATOM 189 O GLU A 22 10.067 21.224 -2.727 1.00 31.15 O ATOM 190 CB GLU A 22 12.980 19.798 -2.449 1.00 16.65 C ATOM 191 CG GLU A 22 14.167 19.591 -3.386 1.00 50.82 C ATOM 192 CD GLU A 22 13.732 19.647 -4.820 1.00 63.07 C ATOM 193 OE1 GLU A 22 13.137 18.715 -5.309 1.00 49.23 O ATOM 194 OE2 GLU A 22 14.023 20.778 -5.467 1.00 48.43 O ATOM 195 N VAL A 23 10.885 21.144 -0.615 1.00 27.31 N ATOM 196 CA VAL A 23 9.567 21.098 0.055 1.00 46.08 C ATOM 197 C VAL A 23 8.693 22.337 -0.258 1.00 39.62 C ATOM 198 O VAL A 23 7.471 22.279 -0.331 1.00 27.84 O ATOM 199 CB VAL A 23 9.673 20.849 1.599 1.00 39.84 C ATOM 200 CG1 VAL A 23 8.345 21.088 2.316 1.00 30.49 C ATOM 201 CG2 VAL A 23 10.167 19.442 1.954 1.00 25.37 C ATOM 202 N ALA A 24 9.339 23.476 -0.392 1.00 23.03 N ATOM 203 CA ALA A 24 8.696 24.740 -0.647 1.00 27.70 C ATOM 204 C ALA A 24 8.274 24.857 -2.089 1.00 46.31 C ATOM 205 O ALA A 24 7.348 25.560 -2.458 1.00 42.29 O ATOM 206 CB ALA A 24 9.749 25.784 -0.402 1.00 19.88 C ATOM 207 N ARG A 25 9.023 24.199 -2.915 1.00 43.10 N ATOM 208 CA ARG A 25 8.757 24.218 -4.310 1.00 38.52 C ATOM 209 C ARG A 25 7.617 23.282 -4.527 1.00 41.72 C ATOM 210 O ARG A 25 6.727 23.570 -5.329 1.00 56.08 O ATOM 211 CB ARG A 25 10.014 23.740 -5.010 1.00 48.85 C ATOM 212 CG ARG A 25 9.894 23.276 -6.443 1.00 49.08 C ATOM 213 CD ARG A 25 10.867 22.151 -6.769 1.00 39.86 C ATOM 214 NE ARG A 25 10.165 21.277 -7.661 1.00 53.10 N ATOM 215 CZ ARG A 25 10.132 19.966 -7.720 1.00 34.18 C ATOM 216 NH1 ARG A 25 10.852 19.185 -6.915 1.00 37.91 N ATOM 217 NH2 ARG A 25 9.364 19.415 -8.631 1.00 51.57 N ATOM 218 N LEU A 26 7.652 22.156 -3.780 1.00 31.20 N ATOM 219 CA LEU A 26 6.581 21.183 -3.911 1.00 29.09 C ATOM 220 C LEU A 26 5.314 21.638 -3.285 1.00 28.88 C ATOM 221 O LEU A 26 4.262 21.231 -3.717 1.00 44.76 O ATOM 222 CB LEU A 26 6.845 19.727 -3.578 1.00 17.06 C ATOM 223 CG LEU A 26 7.913 19.102 -4.402 1.00 24.50 C ATOM 224 CD1 LEU A 26 8.753 18.277 -3.443 1.00 30.25 C ATOM 225 CD2 LEU A 26 7.178 18.174 -5.340 1.00 27.51 C ATOM 226 N LYS A 27 5.442 22.526 -2.316 1.00 24.49 N ATOM 227 CA LYS A 27 4.334 23.132 -1.617 1.00 52.37 C ATOM 228 C LYS A 27 3.522 24.052 -2.531 1.00 50.39 C ATOM 229 O LYS A 27 2.278 24.009 -2.547 1.00 46.45 O ATOM 230 CB LYS A 27 4.805 23.734 -0.299 1.00 50.66 C ATOM 231 CG LYS A 27 4.842 22.606 0.719 1.00 54.11 C ATOM 232 CD LYS A 27 4.832 22.957 2.193 1.00 48.87 C ATOM 233 CE LYS A 27 4.752 21.638 2.957 1.00 64.92 C ATOM 234 NZ LYS A 27 4.815 21.721 4.424 1.00 70.42 N ATOM 235 N LYS A 28 4.293 24.835 -3.302 1.00 52.73 N ATOM 236 CA LYS A 28 3.872 25.752 -4.340 1.00 36.62 C ATOM 237 C LYS A 28 3.127 24.938 -5.434 1.00 56.63 C ATOM 238 O LYS A 28 2.077 25.324 -5.942 1.00 39.08 O ATOM 239 CB LYS A 28 5.106 26.474 -4.846 1.00 43.37 C ATOM 240 CG LYS A 28 4.792 27.465 -5.937 1.00 64.56 C ATOM 241 CD LYS A 28 5.940 27.568 -6.929 1.00 82.96 C ATOM 242 CE LYS A 28 5.568 27.375 -8.400 1.00 73.57 C ATOM 243 NZ LYS A 28 6.746 27.234 -9.285 1.00 77.03 N ATOM 244 N LEU A 29 3.617 23.731 -5.731 1.00 46.49 N ATOM 245 CA LEU A 29 2.917 22.842 -6.655 1.00 30.55 C ATOM 246 C LEU A 29 1.523 22.471 -6.133 1.00 49.37 C ATOM 247 O LEU A 29 0.595 22.391 -6.906 1.00 62.30 O ATOM 248 CB LEU A 29 3.601 21.478 -6.794 1.00 33.85 C ATOM 249 CG LEU A 29 4.849 21.471 -7.638 1.00 45.83 C ATOM 250 CD1 LEU A 29 4.879 20.209 -8.470 1.00 30.97 C ATOM 251 CD2 LEU A 29 4.944 22.693 -8.533 1.00 45.20 C ATOM 252 N VAL A 30 1.411 22.161 -4.828 1.00 55.80 N ATOM 253 CA VAL A 30 0.184 21.709 -4.154 1.00 36.38 C ATOM 254 C VAL A 30 -0.970 22.690 -4.228 1.00 34.24 C ATOM 255 O VAL A 30 -2.127 22.345 -4.499 1.00 65.62 O ATOM 256 CB VAL A 30 0.489 21.291 -2.708 1.00 62.71 C ATOM 257 CG1 VAL A 30 -0.783 21.014 -1.924 1.00 50.33 C ATOM 258 CG2 VAL A 30 1.285 20.000 -2.739 1.00 64.69 C