>>3AG2:HELIX   98 AK8 ALA O   58  GLU O   89  1                                  32    
AQEVETIWTILPAIILILIALPSLRILYMMDE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 98 AK8 ALA O 58 GLU O 89 1 32 ATOM 18862 N ALA O 58 120.646 340.857 211.542 1.00 55.17 N ANISOU18862 N ALA O 58 7214 6551 7196 -513 -163 -419 N ATOM 18863 CA ALA O 58 120.767 340.470 210.144 1.00 64.47 C ANISOU18863 CA ALA O 58 8388 7737 8371 -519 -172 -380 C ATOM 18864 C ALA O 58 119.639 340.939 209.232 1.00 63.48 C ANISOU18864 C ALA O 58 8283 7596 8241 -507 -174 -348 C ATOM 18865 O ALA O 58 119.788 340.824 208.008 1.00 57.78 O ANISOU18865 O ALA O 58 7542 6876 7538 -507 -191 -320 O ATOM 18866 CB ALA O 58 120.868 338.944 210.038 1.00 46.84 C ANISOU18866 CB ALA O 58 6138 5531 6129 -508 -179 -374 C ATOM 18867 N GLN O 59 118.537 341.474 209.759 1.00 99.18 N ANISOU18867 N GLN O 59 12833 12101 12749 -495 -161 -353 N ATOM 18868 CA GLN O 59 117.368 341.707 208.910 1.00 66.42 C ANISOU18868 CA GLN O 59 8688 7923 8625 -457 -212 -311 C ATOM 18869 C GLN O 59 117.612 342.822 207.891 1.00 97.87 C ANISOU18869 C GLN O 59 12654 11888 12642 -471 -208 -301 C ATOM 18870 O GLN O 59 117.280 342.683 206.705 1.00 57.88 O ANISOU18870 O GLN O 59 7557 6829 7606 -466 -202 -285 O ATOM 18871 CB GLN O 59 116.142 342.015 209.774 1.00 64.56 C ANISOU18871 CB GLN O 59 8425 7655 8450 -391 -251 -333 C ATOM 18872 CG GLN O 59 114.933 341.191 209.379 1.00147.55 C ANISOU18872 CG GLN O 59 18904 18181 18978 -367 -221 -341 C ATOM 18873 CD GLN O 59 113.983 340.955 210.525 1.00158.99 C ANISOU18873 CD GLN O 59 20345 19634 20430 -345 -195 -381 C ATOM 18874 OE1 GLN O 59 112.942 341.603 210.617 1.00141.87 O ANISOU18874 OE1 GLN O 59 18202 17448 18252 -343 -179 -383 O ATOM 18875 NE2 GLN O 59 114.327 340.015 211.403 1.00131.24 N ANISOU18875 NE2 GLN O 59 16812 16145 16910 -342 -183 -410 N ATOM 18876 N GLU O 60 118.193 343.935 208.337 1.00 52.32 N ANISOU18876 N GLU O 60 6907 6105 6867 -497 -196 -315 N ATOM 18877 CA GLU O 60 118.390 345.081 207.453 1.00 59.12 C ANISOU18877 CA GLU O 60 7757 6945 7760 -512 -193 -304 C ATOM 18878 C GLU O 60 119.197 344.690 206.225 1.00 70.67 C ANISOU18878 C GLU O 60 9179 8430 9244 -530 -190 -288 C ATOM 18879 O GLU O 60 118.813 344.992 205.086 1.00 57.08 O ANISOU18879 O GLU O 60 7434 6706 7549 -531 -182 -268 O ATOM 18880 CB GLU O 60 119.086 346.222 208.210 1.00 83.78 C ANISOU18880 CB GLU O 60 10903 10051 10880 -539 -179 -329 C ATOM 18881 CG GLU O 60 119.644 345.856 209.624 1.00143.73 C ANISOU18881 CG GLU O 60 18502 17657 18452 -546 -159 -372 C ATOM 18882 CD GLU O 60 121.111 345.376 209.631 1.00198.26 C ANISOU18882 CD GLU O 60 25376 24584 25369 -566 -169 -382 C ATOM 18883 OE1 GLU O 60 121.366 344.199 209.273 1.00 73.38 O ANISOU18883 OE1 GLU O 60 9541 8796 9546 -561 -176 -371 O ATOM 18884 OE2 GLU O 60 122.010 346.167 210.015 1.00125.61 O ANISOU18884 OE2 GLU O 60 16170 15369 16185 -586 -174 -401 O ATOM 18885 N VAL O 61 120.313 343.990 206.440 1.00 53.21 N ANISOU18885 N VAL O 61 6952 6242 7021 -545 -190 -299 N ATOM 18886 CA VAL O 61 121.291 343.810 205.376 1.00 55.86 C ANISOU18886 CA VAL O 61 7249 6596 7380 -565 -191 -287 C ATOM 18887 C VAL O 61 120.855 342.708 204.427 1.00 44.71 C ANISOU18887 C VAL O 61 5809 5207 5973 -549 -189 -270 C ATOM 18888 O VAL O 61 121.240 342.729 203.247 1.00 78.65 O ANISOU18888 O VAL O 61 10073 9517 10292 -562 -182 -255 O ATOM 18889 CB VAL O 61 122.694 343.556 205.976 1.00 57.81 C ANISOU18889 CB VAL O 61 7486 6855 7623 -585 -197 -308 C ATOM 18890 CG1 VAL O 61 122.782 342.160 206.616 1.00 41.97 C ANISOU18890 CG1 VAL O 61 5478 4874 5596 -570 -202 -320 C ATOM 18891 CG2 VAL O 61 123.795 343.780 204.938 1.00142.81 C ANISOU18891 CG2 VAL O 61 18213 17631 18417 -610 -200 -297 C ATOM 18892 N GLU O 62 120.005 341.774 204.900 1.00 45.18 N ANISOU18892 N GLU O 62 5880 5273 6012 -523 -192 -273 N ATOM 18893 CA GLU O 62 119.542 340.697 204.029 1.00 60.44 C ANISOU18893 CA GLU O 62 7786 7228 7950 -509 -185 -262 C ATOM 18894 C GLU O 62 118.556 341.196 202.975 1.00 49.34 C ANISOU18894 C GLU O 62 6365 5815 6565 -505 -167 -246 C ATOM 18895 O GLU O 62 118.446 340.581 201.908 1.00 46.01 O ANISOU18895 O GLU O 62 5913 5415 6152 -507 -154 -236 O ATOM 18896 CB GLU O 62 118.965 339.553 204.865 1.00 45.75 C ANISOU18896 CB GLU O 62 5941 5377 6063 -484 -192 -270 C ATOM 18897 CG GLU O 62 120.058 338.940 205.755 1.00 52.70 C ANISOU18897 CG GLU O 62 6828 6272 6923 -496 -199 -287 C ATOM 18898 CD GLU O 62 120.016 337.426 205.890 1.00 53.22 C ANISOU18898 CD GLU O 62 6885 6361 6974 -483 -201 -289 C ATOM 18899 OE1 GLU O 62 120.938 336.880 206.517 1.00 44.16 O ANISOU18899 OE1 GLU O 62 5734 5226 5819 -493 -204 -305 O ATOM 18900 OE2 GLU O 62 119.087 336.777 205.384 1.00 41.78 O ANISOU18900 OE2 GLU O 62 5429 4917 5527 -464 -197 -279 O ATOM 18901 N THR O 63 117.884 342.319 203.226 1.00 38.09 N ANISOU18901 N THR O 63 4961 4362 5149 -502 -164 -244 N ATOM 18902 CA THR O 63 117.083 342.959 202.180 1.00 40.45 C ANISOU18902 CA THR O 63 5247 4654 5469 -507 -141 -226 C ATOM 18903 C THR O 63 117.973 343.393 201.018 1.00 58.11 C ANISOU18903 C THR O 63 7452 6900 7724 -536 -132 -210 C ATOM 18904 O THR O 63 117.690 343.104 199.845 1.00 48.46 O ANISOU18904 O THR O 63 6200 5700 6511 -539 -110 -194 O ATOM 18905 CB THR O 63 116.337 344.168 202.755 1.00 61.04 C ANISOU18905 CB THR O 63 7884 7225 8083 -500 -140 -229 C ATOM 18906 OG1 THR O 63 115.678 343.805 203.977 1.00 61.57 O ANISOU18906 OG1 THR O 63 7977 7283 8133 -473 -151 -248 O ATOM 18907 CG2 THR O 63 115.295 344.653 201.775 1.00 63.93 C ANISOU18907 CG2 THR O 63 8240 7584 8465 -502 -112 -210 C ATOM 18908 N ILE O 64 119.062 344.092 201.350 1.00 41.83 N ANISOU18908 N ILE O 64 5396 4829 5668 -556 -145 -214 N ATOM 18909 CA ILE O 64 120.093 344.476 200.389 1.00 50.76 C ANISOU18909 CA ILE O 64 6497 5973 6818 -585 -140 -201 C ATOM 18910 C ILE O 64 120.554 343.268 199.603 1.00 71.65 C ANISOU18910 C ILE O 64 9106 8656 9464 -585 -135 -198 C ATOM 18911 O ILE O 64 120.578 343.271 198.368 1.00 49.87 O ANISOU18911 O ILE O 64 6313 5918 6719 -594 -115 -180 O ATOM 18912 CB ILE O 64 121.281 345.123 201.118 1.00 59.82 C ANISOU18912 CB ILE O 64 7657 7108 7965 -606 -155 -215 C ATOM 18913 CG1 ILE O 64 120.851 346.404 201.833 1.00 65.03 C ANISOU18913 CG1 ILE O 64 8353 7728 8625 -608 -156 -220 C ATOM 18914 CG2 ILE O 64 122.459 345.334 200.166 1.00 61.45 C ANISOU18914 CG2 ILE O 64 7826 7332 8192 -636 -150 -203 C ATOM 18915 CD1 ILE O 64 121.972 346.984 202.699 1.00 66.29 C ANISOU18915 CD1 ILE O 64 8528 7877 8782 -629 -166 -241 C ATOM 18916 N TRP O 65 120.969 342.219 200.293 1.00 38.80 N ANISOU18916 N TRP O 65 4948 4508 5285 -574 -150 -216 N ATOM 18917 CA TRP O 65 121.612 341.190 199.504 1.00 46.25 C ANISOU18917 CA TRP O 65 5853 5487 6233 -574 -144 -215 C ATOM 18918 C TRP O 65 120.648 340.091 199.043 1.00 43.92 C ANISOU18918 C TRP O 65 5548 5213 5927 -549 -128 -214 C ATOM 18919 O TRP O 65 121.089 339.054 198.550 1.00 53.07 O ANISOU18919 O TRP O 65 6680 6400 7084 -545 -124 -219 O ATOM 18920 CB TRP O 65 122.849 340.681 200.231 1.00 94.93 C ANISOU18920 CB TRP O 65 12017 11659 12392 -582 -164 -232 C ATOM 18921 CG TRP O 65 122.810 340.005 201.497 1.00 59.18 C ANISOU18921 CG TRP O 65 7519 7127 7841 -568 -181 -251 C ATOM 18922 CD1 TRP O 65 122.032 338.944 201.851 1.00131.69 C ANISOU18922 CD1 TRP O 65 16713 16319 17006 -543 -181 -256 C ATOM 18923 CD2 TRP O 65 123.754 340.195 202.568 1.00 74.52 C ANISOU18923 CD2 TRP O 65 9475 9062 9775 -579 -196 -267 C ATOM 18924 NE1 TRP O 65 122.389 338.499 203.111 1.00201.28 N ANISOU18924 NE1 TRP O 65 25549 25130 25798 -537 -195 -272 N ATOM 18925 CE2 TRP O 65 123.458 339.230 203.562 1.00 39.94 C ANISOU18925 CE2 TRP O 65 5117 4688 5371 -559 -204 -281 C ATOM 18926 CE3 TRP O 65 124.802 341.099 202.787 1.00 50.79 C ANISOU18926 CE3 TRP O 65 6467 6048 6782 -604 -202 -273 C ATOM 18927 CZ2 TRP O 65 124.165 339.154 204.793 1.00 48.09 C ANISOU18927 CZ2 TRP O 65 6165 5717 6390 -565 -215 -302 C ATOM 18928 CZ3 TRP O 65 125.507 341.027 203.994 1.00 48.33 C ANISOU18928 CZ3 TRP O 65 6171 5733 6460 -609 -215 -295 C ATOM 18929 CH2 TRP O 65 125.180 340.070 204.988 1.00 42.04 C ANISOU18929 CH2 TRP O 65 5393 4943 5638 -590 -220 -310 C ATOM 18930 N THR O 66 119.352 340.380 199.072 1.00 36.06 N ANISOU18930 N THR O 66 4570 4204 4926 -536 -116 -208 N ATOM 18931 CA THR O 66 118.322 339.697 198.285 1.00 41.22 C ANISOU18931 CA THR O 66 5210 4879 5573 -520 -92 -201 C ATOM 18932 C THR O 66 117.821 340.543 197.117 1.00 56.93 C ANISOU18932 C THR O 66 7183 6871 7576 -533 -64 -179 C ATOM 18933 O THR O 66 117.763 340.090 195.951 1.00 45.71 O ANISOU18933 O THR O 66 5731 5480 6155 -537 -43 -169 O ATOM 18934 CB THR O 66 117.184 339.342 199.263 1.00 47.87 C ANISOU18934 CB THR O 66 6085 5706 6397 -496 -97 -211 C ATOM 18935 OG1 THR O 66 117.549 338.125 199.942 1.00 52.39 O ANISOU18935 OG1 THR O 66 6662 6290 6953 -484 -114 -226 O ATOM 18936 CG2 THR O 66 115.846 339.225 198.580 1.00 67.79 C ANISOU18936 CG2 THR O 66 8605 8239 8915 -486 -68 -200 C ATOM 18937 N ILE O 67 117.517 341.812 197.382 1.00 39.57 N ANISOU18937 N ILE O 67 5004 4642 5388 -542 -65 -169 N ATOM 18938 CA ILE O 67 116.924 342.673 196.357 1.00 54.91 C ANISOU18938 CA ILE O 67 6936 6585 7344 -554 -40 -143 C ATOM 18939 C ILE O 67 117.928 343.044 195.267 1.00 47.63 C ANISOU18939 C ILE O 67 5979 5681 6437 -580 -33 -126 C ATOM 18940 O ILE O 67 117.591 343.037 194.064 1.00 44.03 O ANISOU18940 O ILE O 67 5497 5249 5982 -586 -8 -105 O ATOM 18941 CB ILE O 67 116.329 343.921 197.014 1.00 51.85 C ANISOU18941 CB ILE O 67 6581 6155 6964 -554 -44 -139 C ATOM 18942 CG1 ILE O 67 115.056 343.528 197.752 1.00 63.05 C ANISOU18942 CG1 ILE O 67 8027 7563 8366 -527 -39 -150 C ATOM 18943 CG2 ILE O 67 116.017 344.920 195.954 1.00 60.89 C ANISOU18943 CG2 ILE O 67 7714 7297 8125 -572 -22 -108 C ATOM 18944 CD1 ILE O 67 114.003 342.926 196.843 1.00 75.56 C ANISOU18944 CD1 ILE O 67 9597 9174 9939 -519 -9 -137 C ATOM 18945 N LEU O 68 119.172 343.391 195.654 1.00 43.50 N ANISOU18945 N LEU O 68 5454 5150 5926 -596 -54 -132 N ATOM 18946 CA LEU O 68 120.186 343.687 194.636 1.00 52.93 C ANISOU18946 CA LEU O 68 6611 6365 7134 -622 -47 -115 C ATOM 18947 C LEU O 68 120.499 342.491 193.748 1.00 48.97 C ANISOU18947 C LEU O 68 6073 5908 6627 -616 -33 -119 C ATOM 18948 O LEU O 68 120.430 342.648 192.521 1.00 42.87 O ANISOU18948 O LEU O 68 5271 5160 5858 -627 -10 -96 O ATOM 18949 CB LEU O 68 121.480 344.200 195.261 1.00 48.95 C ANISOU18949 CB LEU O 68 6112 5847 6642 -642 -71 -124 C ATOM 18950 CG LEU O 68 121.480 345.695 195.360 1.00 79.23 C ANISOU18950 CG LEU O 68 9965 9650 10490 -664 -73 -109 C ATOM 18951 CD1 LEU O 68 120.563 346.145 196.513 1.00 82.13 C ANISOU18951 CD1 LEU O 68 10379 9977 10849 -648 -83 -123 C ATOM 18952 CD2 LEU O 68 122.914 346.094 195.548 1.00 61.48 C ANISOU18952 CD2 LEU O 68 7706 7400 8252 -691 -87 -114 C ATOM 18953 N PRO O 69 120.807 341.290 194.270 1.00 50.02 N ANISOU18953 N PRO O 69 6205 6053 6747 -599 -44 -144 N ATOM 18954 CA PRO O 69 120.952 340.150 193.355 1.00 42.67 C ANISOU18954 CA PRO O 69 5242 5164 5808 -591 -28 -149 C ATOM 18955 C PRO O 69 119.723 339.938 192.482 1.00 38.10 C ANISOU18955 C PRO O 69 4659 4603 5216 -582 1 -136 C ATOM 18956 O PRO O 69 119.878 339.649 191.287 1.00 40.74 O ANISOU18956 O PRO O 69 4960 4971 5548 -589 22 -127 O ATOM 18957 CB PRO O 69 121.253 338.970 194.310 1.00 40.72 C ANISOU18957 CB PRO O 69 5006 4917 5549 -572 -48 -178 C ATOM 18958 CG PRO O 69 121.993 339.677 195.499 1.00 41.28 C ANISOU18958 CG PRO O 69 5100 4956 5627 -581 -77 -185 C ATOM 18959 CD PRO O 69 121.129 340.911 195.668 1.00 42.53 C ANISOU18959 CD PRO O 69 5284 5084 5789 -587 -73 -169 C ATOM 18960 N ALA O 70 118.511 340.105 193.033 1.00 36.62 N ANISOU18960 N ALA O 70 4502 4394 5018 -569 3 -136 N ATOM 18961 CA ALA O 70 117.291 339.928 192.258 1.00 34.14 C ANISOU18961 CA ALA O 70 4185 4096 4689 -561 29 -122 C ATOM 18962 C ALA O 70 117.288 340.879 191.070 1.00 38.22 C ANISOU18962 C ALA O 70 4680 4625 5216 -582 50 -89 C ATOM 18963 O ALA O 70 116.997 340.488 189.947 1.00 38.74 O ANISOU18963 O ALA O 70 4723 4726 5271 -584 73 -78 O ATOM 18964 CB ALA O 70 116.039 340.187 193.111 1.00 36.30 C ANISOU18964 CB ALA O 70 4496 4342 4954 -546 28 -124 C ATOM 18965 N ILE O 71 117.634 342.139 191.320 1.00 38.28 N ANISOU18965 N ILE O 71 4696 4603 5244 -599 41 -73 N ATOM 18966 CA ILE O 71 117.697 343.107 190.243 1.00 46.33 C ANISOU18966 CA ILE O 71 5695 5632 6276 -620 58 -36 C ATOM 18967 C ILE O 71 118.722 342.675 189.208 1.00 53.90 C ANISOU18967 C ILE O 71 6611 6631 7237 -632 67 -31 C ATOM 18968 O ILE O 71 118.463 342.708 187.995 1.00 47.34 O ANISOU18968 O ILE O 71 5756 5831 6400 -638 91 -7 O ATOM 18969 CB ILE O 71 118.019 344.495 190.802 1.00 41.34 C ANISOU18969 CB ILE O 71 5082 4959 5666 -638 42 -23 C ATOM 18970 CG1 ILE O 71 116.790 345.035 191.525 1.00 44.93 C ANISOU18970 CG1 ILE O 71 5577 5378 6118 -625 42 -22 C ATOM 18971 CG2 ILE O 71 118.412 345.428 189.659 1.00 49.90 C ANISOU18971 CG2 ILE O 71 6139 6055 6764 -664 55 17 C ATOM 18972 CD1 ILE O 71 117.107 346.265 192.333 1.00 44.14 C ANISOU18972 CD1 ILE O 71 5504 5233 6036 -638 23 -21 C ATOM 18973 N ILE O 72 119.909 342.295 189.678 1.00 41.68 N ANISOU18973 N ILE O 72 5055 5084 5698 -636 48 -53 N ATOM 18974 CA ILE O 72 120.980 341.915 188.767 1.00 41.18 C ANISOU18974 CA ILE O 72 4950 5056 5639 -648 57 -50 C ATOM 18975 C ILE O 72 120.520 340.781 187.864 1.00 44.47 C ANISOU18975 C ILE O 72 5349 5516 6033 -633 80 -59 C ATOM 18976 O ILE O 72 120.714 340.821 186.644 1.00 44.40 O ANISOU18976 O ILE O 72 5309 5542 6020 -642 103 -40 O ATOM 18977 CB ILE O 72 122.241 341.540 189.562 1.00 38.80 C ANISOU18977 CB ILE O 72 4646 4747 5349 -651 32 -76 C ATOM 18978 CG1 ILE O 72 122.812 342.826 190.170 1.00 39.31 C ANISOU18978 CG1 ILE O 72 4724 4777 5435 -673 12 -63 C ATOM 18979 CG2 ILE O 72 123.274 340.864 188.630 1.00 39.68 C ANISOU18979 CG2 ILE O 72 4713 4900 5462 -657 44 -81 C ATOM 18980 CD1 ILE O 72 123.948 342.614 191.075 1.00 45.67 C ANISOU18980 CD1 ILE O 72 5532 5571 6248 -678 -15 -86 C ATOM 18981 N LEU O 73 119.863 339.778 188.449 1.00 35.05 N ANISOU18981 N LEU O 73 4175 4321 4820 -610 76 -86 N ATOM 18982 CA LEU O 73 119.404 338.629 187.671 1.00 36.22 C ANISOU18982 CA LEU O 73 4309 4508 4944 -597 95 -98 C ATOM 18983 C LEU O 73 118.407 339.061 186.599 1.00 45.72 C ANISOU18983 C LEU O 73 5507 5732 6133 -600 122 -68 C ATOM 18984 O LEU O 73 118.454 338.582 185.466 1.00 40.15 O ANISOU18984 O LEU O 73 4776 5068 5411 -601 142 -64 O ATOM 18985 CB LEU O 73 118.757 337.593 188.609 1.00 31.97 C ANISOU18985 CB LEU O 73 3798 3958 4390 -573 83 -128 C ATOM 18986 CG LEU O 73 119.641 336.876 189.642 1.00 43.27 C ANISOU18986 CG LEU O 73 5235 5376 5830 -563 57 -158 C ATOM 18987 CD1 LEU O 73 118.753 336.000 190.529 1.00 38.83 C ANISOU18987 CD1 LEU O 73 4701 4799 5251 -540 46 -178 C ATOM 18988 CD2 LEU O 73 120.699 336.052 188.937 1.00 34.36 C ANISOU18988 CD2 LEU O 73 4071 4280 4703 -565 63 -174 C ATOM 18989 N ILE O 74 117.500 339.976 186.933 1.00 39.70 N ANISOU18989 N ILE O 74 4768 4941 5374 -602 122 -45 N ATOM 18990 CA ILE O 74 116.555 340.458 185.938 1.00 43.08 C ANISOU18990 CA ILE O 74 5190 5386 5790 -605 145 -12 C ATOM 18991 C ILE O 74 117.282 341.187 184.807 1.00 57.06 C ANISOU18991 C ILE O 74 6928 7179 7573 -624 160 19 C ATOM 18992 O ILE O 74 116.936 341.060 183.630 1.00 46.64 O ANISOU18992 O ILE O 74 5590 5896 6236 -623 183 37 O ATOM 18993 CB ILE O 74 115.510 341.359 186.602 1.00 51.23 C ANISOU18993 CB ILE O 74 6255 6380 6831 -602 141 6 C ATOM 18994 CG1 ILE O 74 114.698 340.561 187.615 1.00 43.22 C ANISOU18994 CG1 ILE O 74 5272 5350 5802 -581 132 -23 C ATOM 18995 CG2 ILE O 74 114.610 341.943 185.517 1.00 50.36 C ANISOU18995 CG2 ILE O 74 6135 6287 6711 -605 165 46 C ATOM 18996 CD1 ILE O 74 113.828 341.425 188.574 1.00 49.58 C ANISOU18996 CD1 ILE O 74 6113 6110 6616 -577 124 -15 C ATOM 18997 N LEU O 75 118.310 341.941 185.145 1.00 44.03 N ANISOU18997 N LEU O 75 5270 5507 5951 -640 146 26 N ATOM 18998 CA LEU O 75 119.091 342.635 184.138 1.00 50.20 C ANISOU18998 CA LEU O 75 6019 6307 6749 -659 159 57 C ATOM 18999 C LEU O 75 119.876 341.692 183.241 1.00 69.41 C ANISOU18999 C LEU O 75 8418 8789 9166 -658 174 41 C ATOM 19000 O LEU O 75 120.348 342.133 182.191 1.00 46.67 O ANISOU19000 O LEU O 75 5509 5933 6292 -670 193 66 O ATOM 19001 CB LEU O 75 120.053 343.601 184.818 1.00 45.98 C ANISOU19001 CB LEU O 75 5485 5737 6249 -679 137 65 C ATOM 19002 CG LEU O 75 119.496 345.013 185.018 1.00 58.05 C ANISOU19002 CG LEU O 75 7031 7227 7797 -690 133 102 C ATOM 19003 CD1 LEU O 75 118.046 345.011 185.237 1.00 62.42 C ANISOU19003 CD1 LEU O 75 7614 7769 8335 -674 139 106 C ATOM 19004 CD2 LEU O 75 120.208 345.627 186.173 1.00 43.94 C ANISOU19004 CD2 LEU O 75 5266 5401 6029 -706 100 91 C ATOM 19005 N ILE O 76 120.074 340.441 183.653 1.00 39.58 N ANISOU19005 N ILE O 76 4643 5023 5371 -644 165 -1 N ATOM 19006 CA ILE O 76 120.675 339.421 182.796 1.00 46.94 C ANISOU19006 CA ILE O 76 5546 6002 6285 -640 180 -21 C ATOM 19007 C ILE O 76 119.601 338.694 181.998 1.00 43.73 C ANISOU19007 C ILE O 76 5143 5629 5842 -626 199 -24 C ATOM 19008 O ILE O 76 119.728 338.496 180.780 1.00 45.13 O ANISOU19008 O ILE O 76 5297 5849 6001 -629 221 -15 O ATOM 19009 CB ILE O 76 121.495 338.432 183.644 1.00 43.06 C ANISOU19009 CB ILE O 76 5057 5506 5801 -632 160 -64 C ATOM 19010 CG1 ILE O 76 122.697 339.114 184.286 1.00 40.37 C ANISOU19010 CG1 ILE O 76 4708 5139 5493 -648 140 -60 C ATOM 19011 CG2 ILE O 76 121.860 337.232 182.811 1.00 35.60 C ANISOU19011 CG2 ILE O 76 4086 4606 4833 -624 176 -90 C ATOM 19012 CD1 ILE O 76 123.339 338.302 185.453 1.00 41.46 C ANISOU19012 CD1 ILE O 76 4855 5257 5638 -637 114 -100 C ATOM 19013 N ALA O 77 118.517 338.350 182.684 1.00 37.13 N ANISOU19013 N ALA O 77 4339 4774 4995 -612 191 -34 N ATOM 19014 CA ALA O 77 117.424 337.573 182.093 1.00 43.04 C ANISOU19014 CA ALA O 77 5094 5551 5710 -598 205 -40 C ATOM 19015 C ALA O 77 116.737 338.305 180.949 1.00 51.98 C ANISOU19015 C ALA O 77 6217 6705 6827 -604 227 0 C ATOM 19016 O ALA O 77 116.317 337.689 179.964 1.00 42.91 O ANISOU19016 O ALA O 77 5059 5597 5647 -598 242 -2 O ATOM 19017 CB ALA O 77 116.382 337.262 183.163 1.00 36.42 C ANISOU19017 CB ALA O 77 4290 4681 4867 -583 191 -53 C ATOM 19018 N LEU O 78 116.539 339.605 181.091 1.00 41.63 N ANISOU19018 N LEU O 78 4913 5365 5539 -613 227 37 N ATOM 19019 CA LEU O 78 115.842 340.351 180.041 1.00 61.61 C ANISOU19019 CA LEU O 78 7437 7912 8059 -616 249 78 C ATOM 19020 C LEU O 78 116.540 340.242 178.681 1.00 56.91 C ANISOU19020 C LEU O 78 6811 7365 7449 -625 269 86 C ATOM 19021 O LEU O 78 115.890 339.813 177.713 1.00 46.86 O ANISOU19021 O LEU O 78 5534 6130 6141 -618 284 91 O ATOM 19022 CB LEU O 78 115.654 341.803 180.495 1.00 58.56 C ANISOU19022 CB LEU O 78 7062 7481 7708 -626 246 114 C ATOM 19023 CG LEU O 78 114.369 342.253 181.184 1.00 64.61 C ANISOU19023 CG LEU O 78 7859 8212 8477 -616 240 127 C ATOM 19024 CD1 LEU O 78 113.580 341.112 181.823 1.00 73.35 C ANISOU19024 CD1 LEU O 78 8987 9323 9558 -598 230 94 C ATOM 19025 CD2 LEU O 78 114.738 343.274 182.218 1.00 57.58 C ANISOU19025 CD2 LEU O 78 6982 7269 7626 -626 223 136 C ATOM 19026 N PRO O 79 117.834 340.569 178.527 1.00 46.11 N ANISOU19026 N PRO O 79 5419 5999 6102 -639 270 88 N ATOM 19027 CA PRO O 79 118.433 340.388 177.186 1.00 42.11 C ANISOU19027 CA PRO O 79 4882 5542 5575 -646 292 94 C ATOM 19028 C PRO O 79 118.594 338.936 176.800 1.00 66.11 C ANISOU19028 C PRO O 79 7913 8625 8581 -636 294 53 C ATOM 19029 O PRO O 79 118.499 338.622 175.608 1.00 46.25 O ANISOU19029 O PRO O 79 5384 6155 6034 -636 312 56 O ATOM 19030 CB PRO O 79 119.790 341.106 177.291 1.00 43.60 C ANISOU19030 CB PRO O 79 5048 5717 5801 -665 291 104 C ATOM 19031 CG PRO O 79 120.085 341.138 178.775 1.00 51.73 C ANISOU19031 CG PRO O 79 6094 6699 6862 -664 262 85 C ATOM 19032 CD PRO O 79 118.737 341.340 179.402 1.00 44.87 C ANISOU19032 CD PRO O 79 5259 5801 5988 -652 254 92 C ATOM 19033 N SER O 80 118.830 338.054 177.773 1.00 42.75 N ANISOU19033 N SER O 80 4964 5651 5629 -627 275 13 N ATOM 19034 CA SER O 80 118.919 336.619 177.510 1.00 45.55 C ANISOU19034 CA SER O 80 5313 6040 5956 -616 276 -31 C ATOM 19035 C SER O 80 117.646 336.117 176.832 1.00 36.74 C ANISOU19035 C SER O 80 4209 4950 4800 -605 286 -30 C ATOM 19036 O SER O 80 117.695 335.400 175.822 1.00 42.46 O ANISOU19036 O SER O 80 4919 5721 5493 -603 299 -45 O ATOM 19037 CB SER O 80 119.140 335.873 178.835 1.00 40.72 C ANISOU19037 CB SER O 80 4716 5395 5361 -606 253 -69 C ATOM 19038 OG SER O 80 119.183 334.467 178.627 1.00 42.12 O ANISOU19038 OG SER O 80 4888 5599 5516 -593 255 -113 O ATOM 19039 N LEU O 81 116.498 336.492 177.372 1.00 39.09 N ANISOU19039 N LEU O 81 4534 5219 5100 -598 278 -13 N ATOM 19040 CA LEU O 81 115.239 335.991 176.833 1.00 48.65 C ANISOU19040 CA LEU O 81 5757 6453 6275 -588 284 -12 C ATOM 19041 C LEU O 81 114.860 336.694 175.535 1.00 52.03 C ANISOU19041 C LEU O 81 6174 6912 6682 -594 303 27 C ATOM 19042 O LEU O 81 114.233 336.085 174.673 1.00 42.05 O ANISOU19042 O LEU O 81 4909 5687 5382 -589 310 21 O ATOM 19043 CB LEU O 81 114.134 336.148 177.870 1.00 44.21 C ANISOU19043 CB LEU O 81 5226 5850 5723 -577 271 -6 C ATOM 19044 CG LEU O 81 114.331 335.318 179.151 1.00 68.29 C ANISOU19044 CG LEU O 81 8290 8871 8787 -568 251 -46 C ATOM 19045 CD1 LEU O 81 113.172 335.507 180.128 1.00 42.01 C ANISOU19045 CD1 LEU O 81 4993 5506 5465 -559 240 -38 C ATOM 19046 CD2 LEU O 81 114.546 333.814 178.857 1.00 38.47 C ANISOU19046 CD2 LEU O 81 4504 5124 4987 -560 251 -92 C ATOM 19047 N ARG O 82 115.198 337.968 175.400 1.00 44.28 N ANISOU19047 N ARG O 82 5186 5913 5724 -606 310 66 N ATOM 19048 CA ARG O 82 115.049 338.653 174.113 1.00 44.80 C ANISOU19048 CA ARG O 82 5240 6010 5771 -614 329 102 C ATOM 19049 C ARG O 82 115.720 337.855 173.003 1.00 49.19 C ANISOU19049 C ARG O 82 5772 6623 6294 -618 341 81 C ATOM 19050 O ARG O 82 115.082 337.490 172.003 1.00 52.51 O ANISOU19050 O ARG O 82 6192 7085 6676 -616 350 84 O ATOM 19051 CB ARG O 82 115.651 340.050 174.252 1.00 56.31 C ANISOU19051 CB ARG O 82 6691 7437 7267 -629 335 138 C ATOM 19052 CG ARG O 82 115.411 341.026 173.126 1.00 65.49 C ANISOU19052 CG ARG O 82 7848 8618 8419 -638 355 181 C ATOM 19053 CD ARG O 82 116.390 342.186 173.282 1.00 88.35 C ANISOU19053 CD ARG O 82 10730 11485 11354 -656 361 205 C ATOM 19054 NE AARG O 82 117.700 341.922 172.738 0.70140.10 N ANISOU19054 NE AARG O 82 17254 18069 17907 -668 369 193 N ATOM 19055 NE BARG O 82 117.615 341.903 172.511 0.30133.37 N ANISOU19055 NE BARG O 82 16402 17226 17048 -668 372 196 N ATOM 19056 CZ AARG O 82 118.026 342.171 171.483 0.70 88.99 C ANISOU19056 CZ AARG O 82 10763 11638 11410 -679 388 212 C ATOM 19057 CZ BARG O 82 118.811 341.549 173.001 0.30 54.27 C ANISOU19057 CZ BARG O 82 6366 7203 7052 -674 366 171 C ATOM 19058 NH1AARG O 82 117.130 342.679 170.644 0.70 72.16 N ANISOU19058 NH1AARG O 82 8641 9523 9253 -679 399 243 N ATOM 19059 NH1BARG O 82 119.024 341.423 174.291 0.30 20.21 N ANISOU19059 NH1BARG O 82 2062 2847 2770 -669 345 152 N ATOM 19060 NH2AARG O 82 119.249 341.910 171.073 0.70 91.42 N ANISOU19060 NH2AARG O 82 11043 11972 11720 -689 396 200 N ATOM 19061 NH2BARG O 82 119.812 341.314 172.175 0.30 94.18 N ANISOU19061 NH2BARG O 82 11392 12298 12096 -683 379 166 N ATOM 19062 N ILE O 83 117.001 337.511 173.199 1.00 40.16 N ANISOU19062 N ILE O 83 4608 5484 5166 -625 341 56 N ATOM 19063 CA ILE O 83 117.735 336.729 172.221 1.00 36.56 C ANISOU19063 CA ILE O 83 4127 5080 4682 -628 353 32 C ATOM 19064 C ILE O 83 117.073 335.377 172.008 1.00 56.64 C ANISOU19064 C ILE O 83 6678 7652 7189 -615 349 -8 C ATOM 19065 O ILE O 83 116.896 334.930 170.869 1.00 43.58 O ANISOU19065 O ILE O 83 5014 6048 5496 -617 361 -14 O ATOM 19066 CB ILE O 83 119.219 336.610 172.628 1.00 47.72 C ANISOU19066 CB ILE O 83 5518 6487 6124 -636 352 11 C ATOM 19067 CG1 ILE O 83 119.802 338.019 172.786 1.00 37.08 C ANISOU19067 CG1 ILE O 83 4163 5112 4814 -651 356 54 C ATOM 19068 CG2 ILE O 83 120.033 335.821 171.565 1.00 39.47 C ANISOU19068 CG2 ILE O 83 4446 5501 5052 -639 368 -15 C ATOM 19069 CD1 ILE O 83 121.293 338.067 173.053 1.00 39.18 C ANISOU19069 CD1 ILE O 83 4402 5373 5109 -661 356 42 C ATOM 19070 N LEU O 84 116.647 334.726 173.088 1.00 40.62 N ANISOU19070 N LEU O 84 4669 5592 5173 -603 332 -36 N ATOM 19071 CA LEU O 84 116.009 333.421 172.957 1.00 37.21 C ANISOU19071 CA LEU O 84 4245 5182 4712 -592 327 -75 C ATOM 19072 C LEU O 84 114.781 333.480 172.048 1.00 34.45 C ANISOU19072 C LEU O 84 3904 4861 4324 -590 333 -54 C ATOM 19073 O LEU O 84 114.608 332.644 171.150 1.00 45.63 O ANISOU19073 O LEU O 84 5312 6322 5703 -590 338 -78 O ATOM 19074 CB LEU O 84 115.624 332.884 174.346 1.00 49.06 C ANISOU19074 CB LEU O 84 5768 6638 6234 -580 308 -100 C ATOM 19075 CG LEU O 84 114.960 331.507 174.361 1.00 42.38 C ANISOU19075 CG LEU O 84 4931 5807 5365 -568 302 -142 C ATOM 19076 CD1 LEU O 84 116.004 330.379 174.307 1.00 42.76 C ANISOU19076 CD1 LEU O 84 4960 5873 5415 -566 303 -194 C ATOM 19077 CD2 LEU O 84 114.120 331.377 175.647 1.00 43.87 C ANISOU19077 CD2 LEU O 84 5148 5947 5572 -557 284 -144 C ATOM 19078 N TYR O 85 113.910 334.462 172.255 1.00 39.75 N ANISOU19078 N TYR O 85 4592 5506 5003 -589 330 -11 N ATOM 19079 CA TYR O 85 112.714 334.512 171.424 1.00 51.19 C ANISOU19079 CA TYR O 85 6050 6982 6418 -587 333 9 C ATOM 19080 C TYR O 85 113.035 334.974 170.003 1.00 76.63 C ANISOU19080 C TYR O 85 9252 10251 9612 -599 350 33 C ATOM 19081 O TYR O 85 112.501 334.431 169.021 1.00 47.71 O ANISOU19081 O TYR O 85 5586 6634 5909 -599 353 26 O ATOM 19082 CB TYR O 85 111.673 335.379 172.101 1.00 38.88 C ANISOU19082 CB TYR O 85 4515 5381 4878 -580 326 46 C ATOM 19083 CG TYR O 85 110.961 334.507 173.139 1.00 43.00 C ANISOU19083 CG TYR O 85 5057 5878 5405 -567 310 16 C ATOM 19084 CD1 TYR O 85 109.868 333.691 172.768 1.00 57.19 C ANISOU19084 CD1 TYR O 85 6863 7698 7171 -559 306 4 C ATOM 19085 CD2 TYR O 85 111.430 334.437 174.451 1.00 57.67 C ANISOU19085 CD2 TYR O 85 6923 7691 7298 -563 299 -2 C ATOM 19086 CE1 TYR O 85 109.222 332.860 173.707 1.00 38.67 C ANISOU19086 CE1 TYR O 85 4534 5329 4830 -548 292 -23 C ATOM 19087 CE2 TYR O 85 110.813 333.631 175.386 1.00 50.62 C ANISOU19087 CE2 TYR O 85 6049 6776 6408 -552 286 -28 C ATOM 19088 CZ TYR O 85 109.734 332.850 175.010 1.00 52.30 C ANISOU19088 CZ TYR O 85 6269 7010 6591 -544 283 -39 C ATOM 19089 OH TYR O 85 109.169 332.078 175.947 1.00 44.78 O ANISOU19089 OH TYR O 85 5333 6034 5645 -534 270 -63 O ATOM 19090 N MET O 86 113.949 335.929 169.863 1.00 43.21 N ANISOU19090 N MET O 86 5005 6011 5401 -610 360 59 N ATOM 19091 CA MET O 86 114.343 336.340 168.525 1.00 68.02 C ANISOU19091 CA MET O 86 8128 9199 8517 -622 377 80 C ATOM 19092 C MET O 86 114.912 335.158 167.731 1.00 49.57 C ANISOU19092 C MET O 86 5771 6917 6145 -624 383 36 C ATOM 19093 O MET O 86 114.589 334.996 166.547 1.00128.11 O ANISOU19093 O MET O 86 15711 16915 16051 -630 390 42 O ATOM 19094 CB MET O 86 115.298 337.531 168.634 1.00 40.63 C ANISOU19094 CB MET O 86 4647 5708 5082 -635 387 113 C ATOM 19095 CG MET O 86 116.676 337.346 168.175 1.00138.90 C ANISOU19095 CG MET O 86 17064 18181 17529 -646 399 97 C ATOM 19096 SD MET O 86 117.545 338.885 168.511 1.00 81.56 S ANISOU19096 SD MET O 86 9793 10880 10315 -662 407 141 S ATOM 19097 CE MET O 86 116.250 339.974 169.125 1.00 53.09 C ANISOU19097 CE MET O 86 6218 7222 6730 -657 398 183 C ATOM 19098 N MET O 87 115.663 334.253 168.391 1.00 78.80 N ANISOU19098 N MET O 87 9468 10611 9862 -620 378 -10 N ATOM 19099 CA MET O 87 116.095 333.023 167.715 1.00 44.04 C ANISOU19099 CA MET O 87 5048 6256 5427 -619 384 -59 C ATOM 19100 C MET O 87 114.905 332.170 167.271 1.00127.02 C ANISOU19100 C MET O 87 15570 16792 15898 -613 376 -78 C ATOM 19101 O MET O 87 114.933 331.573 166.191 1.00 72.01 O ANISOU19101 O MET O 87 8589 9879 8892 -617 384 -97 O ATOM 19102 CB MET O 87 117.035 332.172 168.608 1.00 64.95 C ANISOU19102 CB MET O 87 7689 8885 8103 -613 378 -107 C ATOM 19103 CG MET O 87 118.382 332.783 169.031 1.00154.46 C ANISOU19103 CG MET O 87 19007 20202 19478 -620 384 -99 C ATOM 19104 SD MET O 87 119.597 331.619 169.760 1.00 99.37 S ANISOU19104 SD MET O 87 12014 13217 12525 -613 380 -161 S ATOM 19105 CE MET O 87 118.699 330.944 171.138 1.00 46.29 C ANISOU19105 CE MET O 87 5323 6444 5821 -597 355 -186 C ATOM 19106 N ASP O 88 113.855 332.095 168.091 1.00 48.83 N ANISOU19106 N ASP O 88 5692 6852 6007 -602 361 -73 N ATOM 19107 CA ASP O 88 112.722 331.216 167.794 1.00 63.12 C ANISOU19107 CA ASP O 88 7515 8684 7785 -596 352 -94 C ATOM 19108 C ASP O 88 111.775 331.770 166.728 1.00 91.68 C ANISOU19108 C ASP O 88 11133 12334 11366 -602 355 -55 C ATOM 19109 O ASP O 88 111.051 330.984 166.103 1.00 60.35 O ANISOU19109 O ASP O 88 7166 8401 7363 -602 350 -75 O ATOM 19110 CB ASP O 88 111.917 330.941 169.073 1.00 60.50 C ANISOU19110 CB ASP O 88 7208 8301 7478 -584 335 -101 C ATOM 19111 CG ASP O 88 110.814 329.912 168.867 1.00 51.73 C ANISOU19111 CG ASP O 88 6107 7209 6339 -578 326 -127 C ATOM 19112 OD1 ASP O 88 111.147 328.724 168.692 1.00 51.96 O ANISOU19112 OD1 ASP O 88 6127 7261 6356 -578 326 -178 O ATOM 19113 OD2 ASP O 88 109.620 330.285 168.894 1.00 51.05 O ANISOU19113 OD2 ASP O 88 6037 7114 6245 -575 318 -97 O ATOM 19114 N GLU O 89 111.757 333.088 166.524 1.00 59.83 N ATOM 19115 CA GLU O 89 110.769 333.739 165.674 1.00102.16 C ATOM 19116 C GLU O 89 110.846 333.247 164.234 1.00170.39 C ATOM 19117 O GLU O 89 111.932 332.994 163.709 1.00 71.34 O ATOM 19118 CB GLU O 89 110.968 335.250 165.729 1.00 67.09 C ATOM 19119 CG GLU O 89 110.378 335.878 166.966 1.00115.00 C ATOM 19120 CD GLU O 89 110.798 337.315 167.124 1.00198.49 C ATOM 19121 OE1 GLU O 89 111.507 337.817 166.219 1.00126.42 O ATOM 19122 OE2 GLU O 89 110.420 337.930 168.149 1.00 90.37 O