>>3AG2:HELIX   69 AH6 ASN L   17  LYS L   47  1                                  31    
NKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 69 AH6 ASN L 17 LYS L 47 1 31 ATOM 13727 N ASN L 17 36.552 324.007 222.656 1.00 34.93 N ANISOU13727 N ASN L 17 4329 4942 4002 343 235 -260 N ATOM 13728 CA ASN L 17 35.190 323.780 222.169 1.00 35.93 C ANISOU13728 CA ASN L 17 4426 5092 4132 349 243 -230 C ATOM 13729 C ASN L 17 35.203 322.965 220.880 1.00 37.84 C ANISOU13729 C ASN L 17 4674 5317 4387 325 222 -181 C ATOM 13730 O ASN L 17 35.763 323.408 219.880 1.00 30.21 O ANISOU13730 O ASN L 17 3723 4303 3454 328 209 -176 O ATOM 13731 CB ASN L 17 34.493 325.114 221.948 1.00 33.13 C ANISOU13731 CB ASN L 17 4052 4719 3815 387 258 -251 C ATOM 13732 CG ASN L 17 33.040 324.956 221.507 1.00 39.85 C ANISOU13732 CG ASN L 17 4869 5599 4671 397 267 -221 C ATOM 13733 OD1 ASN L 17 32.758 324.725 220.358 1.00 32.78 O ANISOU13733 OD1 ASN L 17 3971 4688 3796 390 254 -186 O ATOM 13734 ND2 ASN L 17 32.094 325.131 222.462 1.00 40.57 N ANISOU13734 ND2 ASN L 17 4934 5737 4743 414 290 -238 N ATOM 13735 N LYS L 18 34.512 321.825 220.874 1.00 33.70 N ANISOU13735 N LYS L 18 4136 4831 3837 303 221 -146 N ATOM 13736 CA LYS L 18 34.649 320.925 219.733 1.00 30.75 C ANISOU13736 CA LYS L 18 3771 4442 3470 276 201 -104 C ATOM 13737 C LYS L 18 33.987 321.479 218.488 1.00 33.19 C ANISOU13737 C LYS L 18 4065 4729 3816 290 197 -86 C ATOM 13738 O LYS L 18 34.352 321.057 217.374 1.00 35.02 O ANISOU13738 O LYS L 18 4310 4936 4062 273 178 -60 O ATOM 13739 CB LYS L 18 34.055 319.545 220.018 1.00 32.17 C ANISOU13739 CB LYS L 18 3939 4667 3616 247 201 -72 C ATOM 13740 CG LYS L 18 32.490 319.573 220.206 1.00 31.87 C ANISOU13740 CG LYS L 18 3862 4673 3572 259 219 -60 C ATOM 13741 CD LYS L 18 31.968 318.143 220.499 1.00 32.69 C ANISOU13741 CD LYS L 18 3957 4820 3644 226 218 -26 C ATOM 13742 CE LYS L 18 32.411 317.656 221.893 1.00 33.07 C ANISOU13742 CE LYS L 18 4013 4899 3651 216 227 -40 C ATOM 13743 NZ LYS L 18 31.966 316.254 222.183 1.00 32.50 N ANISOU13743 NZ LYS L 18 3934 4864 3550 183 227 -4 N ATOM 13744 N TRP L 19 33.047 322.420 218.635 1.00 30.98 N ANISOU13744 N TRP L 19 3760 4460 3553 322 214 -99 N ATOM 13745 CA TRP L 19 32.370 322.955 217.447 1.00 30.55 C ANISOU13745 CA TRP L 19 3688 4387 3532 338 209 -78 C ATOM 13746 C TRP L 19 33.159 324.091 216.836 1.00 38.49 C ANISOU13746 C TRP L 19 4712 5336 4577 358 203 -96 C ATOM 13747 O TRP L 19 33.206 324.243 215.596 1.00 34.00 O ANISOU13747 O TRP L 19 4145 4739 4034 357 189 -71 O ATOM 13748 CB TRP L 19 30.922 323.438 217.789 1.00 32.57 C ANISOU13748 CB TRP L 19 3905 4680 3791 365 230 -79 C ATOM 13749 CG TRP L 19 30.156 322.306 218.379 1.00 36.84 C ANISOU13749 CG TRP L 19 4427 5277 4293 342 236 -60 C ATOM 13750 CD1 TRP L 19 29.732 322.170 219.694 1.00 41.74 C ANISOU13750 CD1 TRP L 19 5034 5942 4884 347 257 -80 C ATOM 13751 CD2 TRP L 19 29.840 321.074 217.721 1.00 34.57 C ANISOU13751 CD2 TRP L 19 4135 5007 3992 308 222 -19 C ATOM 13752 NE1 TRP L 19 29.162 320.936 219.864 1.00 41.75 N ANISOU13752 NE1 TRP L 19 5022 5986 4854 317 256 -50 N ATOM 13753 CE2 TRP L 19 29.209 320.243 218.679 1.00 31.95 C ANISOU13753 CE2 TRP L 19 3787 4728 3623 293 235 -13 C ATOM 13754 CE3 TRP L 19 30.038 320.590 216.422 1.00 35.49 C ANISOU13754 CE3 TRP L 19 4260 5101 4123 288 200 13 C ATOM 13755 CZ2 TRP L 19 28.775 318.954 218.383 1.00 35.23 C ANISOU13755 CZ2 TRP L 19 4195 5171 4021 258 227 24 C ATOM 13756 CZ3 TRP L 19 29.616 319.321 216.117 1.00 40.48 C ANISOU13756 CZ3 TRP L 19 4885 5761 4736 253 192 46 C ATOM 13757 CH2 TRP L 19 28.981 318.515 217.082 1.00 35.98 C ANISOU13757 CH2 TRP L 19 4299 5239 4132 239 205 52 C ATOM 13758 N ARG L 20 33.745 324.930 217.683 1.00 34.82 N ANISOU13758 N ARG L 20 4258 4855 4117 377 214 -138 N ATOM 13759 CA ARG L 20 34.707 325.890 217.156 1.00 32.40 C ANISOU13759 CA ARG L 20 3974 4491 3847 389 207 -155 C ATOM 13760 C ARG L 20 35.884 325.170 216.505 1.00 32.86 C ANISOU13760 C ARG L 20 4063 4523 3901 357 184 -138 C ATOM 13761 O ARG L 20 36.364 325.593 215.437 1.00 33.25 O ANISOU13761 O ARG L 20 4123 4529 3980 359 171 -126 O ATOM 13762 CB ARG L 20 35.204 326.820 218.268 1.00 38.83 C ANISOU13762 CB ARG L 20 4796 5294 4664 410 222 -208 C ATOM 13763 CG ARG L 20 35.921 328.004 217.681 1.00 42.10 C ANISOU13763 CG ARG L 20 5226 5648 5124 429 218 -225 C ATOM 13764 CD ARG L 20 36.499 328.975 218.694 1.00 41.55 C ANISOU13764 CD ARG L 20 5166 5560 5061 447 232 -280 C ATOM 13765 NE ARG L 20 37.936 328.933 218.614 1.00249.34 N ANISOU13765 NE ARG L 20 31515 31843 31380 428 217 -293 N ATOM 13766 CZ ARG L 20 38.647 329.827 217.954 1.00 60.44 C ANISOU13766 CZ ARG L 20 7605 7862 7496 437 211 -302 C ATOM 13767 NH1 ARG L 20 38.022 330.843 217.367 1.00 89.60 N ANISOU13767 NH1 ARG L 20 11285 11528 11232 467 220 -298 N ATOM 13768 NH2 ARG L 20 39.964 329.718 217.903 1.00132.44 N ANISOU13768 NH2 ARG L 20 16753 16954 16615 417 198 -312 N ATOM 13769 N LEU L 21 36.329 324.067 217.101 1.00 31.98 N ANISOU13769 N LEU L 21 3963 4436 3751 329 178 -135 N ATOM 13770 CA LEU L 21 37.372 323.270 216.459 1.00 31.18 C ANISOU13770 CA LEU L 21 3888 4313 3645 298 157 -117 C ATOM 13771 C LEU L 21 36.902 322.723 215.117 1.00 31.16 C ANISOU13771 C LEU L 21 3878 4307 3653 284 143 -73 C ATOM 13772 O LEU L 21 37.674 322.717 214.150 1.00 30.00 O ANISOU13772 O LEU L 21 3750 4125 3525 274 127 -61 O ATOM 13773 CB LEU L 21 37.801 322.114 217.358 1.00 30.87 C ANISOU13773 CB LEU L 21 3861 4305 3565 271 154 -117 C ATOM 13774 CG LEU L 21 38.841 321.145 216.780 1.00 35.42 C ANISOU13774 CG LEU L 21 4463 4863 4134 239 133 -97 C ATOM 13775 CD1 LEU L 21 40.225 321.846 216.589 1.00 28.28 C ANISOU13775 CD1 LEU L 21 3585 3909 3249 243 124 -121 C ATOM 13776 CD2 LEU L 21 38.911 319.860 217.665 1.00 31.25 C ANISOU13776 CD2 LEU L 21 3938 4373 3564 214 133 -87 C ATOM 13777 N LEU L 22 35.679 322.186 215.053 1.00 32.80 N ANISOU13777 N LEU L 22 4060 4555 3849 281 148 -49 N ATOM 13778 CA LEU L 22 35.170 321.697 213.751 1.00 31.19 C ANISOU13778 CA LEU L 22 3846 4350 3654 268 135 -10 C ATOM 13779 C LEU L 22 35.269 322.774 212.682 1.00 39.30 C ANISOU13779 C LEU L 22 4873 5337 4721 289 129 -6 C ATOM 13780 O LEU L 22 35.682 322.506 211.533 1.00 33.37 O ANISOU13780 O LEU L 22 4133 4565 3981 275 112 17 O ATOM 13781 CB LEU L 22 33.737 321.211 213.921 1.00 29.45 C ANISOU13781 CB LEU L 22 3592 4179 3419 267 144 10 C ATOM 13782 CG LEU L 22 33.021 320.603 212.686 1.00 36.85 C ANISOU13782 CG LEU L 22 4513 5126 4360 251 131 50 C ATOM 13783 CD1 LEU L 22 33.852 319.442 212.119 1.00 31.39 C ANISOU13783 CD1 LEU L 22 3847 4424 3657 212 112 68 C ATOM 13784 CD2 LEU L 22 31.569 320.159 213.057 1.00 34.07 C ANISOU13784 CD2 LEU L 22 4125 4828 3992 251 143 65 C ATOM 13785 N ALA L 23 34.865 323.994 213.027 1.00 34.99 N ANISOU13785 N ALA L 23 4314 4783 4198 325 145 -27 N ATOM 13786 CA ALA L 23 34.973 325.120 212.100 1.00 36.25 C ANISOU13786 CA ALA L 23 4474 4902 4399 349 141 -23 C ATOM 13787 C ALA L 23 36.405 325.353 211.677 1.00 38.46 C ANISOU13787 C ALA L 23 4787 5134 4693 338 128 -32 C ATOM 13788 O ALA L 23 36.697 325.544 210.495 1.00 34.67 O ANISOU13788 O ALA L 23 4313 4626 4233 335 115 -9 O ATOM 13789 CB ALA L 23 34.438 326.399 212.762 1.00 33.06 C ANISOU13789 CB ALA L 23 4053 4492 4018 389 162 -51 C ATOM 13790 N MET L 24 37.320 325.434 212.640 1.00 28.41 N ANISOU13790 N MET L 24 3534 3850 3410 335 133 -66 N ATOM 13791 CA MET L 24 38.701 325.679 212.268 1.00 34.90 C ANISOU13791 CA MET L 24 4387 4628 4246 325 121 -76 C ATOM 13792 C MET L 24 39.252 324.570 211.380 1.00 34.94 C ANISOU13792 C MET L 24 4407 4632 4237 291 101 -46 C ATOM 13793 O MET L 24 39.994 324.846 210.437 1.00 31.63 O ANISOU13793 O MET L 24 4003 4177 3839 286 89 -36 O ATOM 13794 CB MET L 24 39.569 325.795 213.520 1.00 30.62 C ANISOU13794 CB MET L 24 3863 4083 3690 323 128 -118 C ATOM 13795 CG MET L 24 39.065 326.778 214.518 1.00 69.84 C ANISOU13795 CG MET L 24 8815 9054 8665 354 149 -154 C ATOM 13796 SD MET L 24 40.097 328.225 214.533 1.00152.70 S ANISOU13796 SD MET L 24 19329 19490 19201 374 152 -191 S ATOM 13797 CE MET L 24 39.312 329.071 213.173 1.00 49.65 C ANISOU13797 CE MET L 24 6260 6410 6194 398 152 -158 C ATOM 13798 N MET L 25 38.984 323.305 211.724 1.00 33.57 N ANISOU13798 N MET L 25 4231 4496 4029 266 97 -33 N ATOM 13799 CA MET L 25 39.555 322.224 210.925 1.00 33.74 C ANISOU13799 CA MET L 25 4267 4514 4038 234 79 -8 C ATOM 13800 C MET L 25 39.003 322.257 209.512 1.00 40.09 C ANISOU13800 C MET L 25 5060 5313 4859 233 69 26 C ATOM 13801 O MET L 25 39.723 321.960 208.550 1.00 37.98 O ANISOU13801 O MET L 25 4809 5024 4598 216 54 40 O ATOM 13802 CB MET L 25 39.276 320.865 211.572 1.00 27.33 C ANISOU13802 CB MET L 25 3453 3741 3189 209 78 1 C ATOM 13803 CG MET L 25 40.018 320.749 212.935 1.00 33.15 C ANISOU13803 CG MET L 25 4206 4484 3906 207 85 -30 C ATOM 13804 SD MET L 25 39.824 319.141 213.730 1.00 35.53 S ANISOU13804 SD MET L 25 4507 4828 4165 176 84 -17 S ATOM 13805 CE MET L 25 40.339 317.905 212.468 1.00 31.48 C ANISOU13805 CE MET L 25 4010 4301 3651 141 63 17 C ATOM 13806 N THR L 26 37.718 322.614 209.402 1.00 32.55 N ANISOU13806 N THR L 26 4076 4382 3911 251 78 38 N ATOM 13807 CA THR L 26 36.984 322.733 208.129 1.00 36.20 C ANISOU13807 CA THR L 26 4520 4847 4387 254 70 71 C ATOM 13808 C THR L 26 37.612 323.804 207.254 1.00 34.92 C ANISOU13808 C THR L 26 4368 4641 4259 271 64 73 C ATOM 13809 O THR L 26 37.910 323.566 206.070 1.00 38.93 O ANISOU13809 O THR L 26 4883 5138 4773 257 49 98 O ATOM 13810 CB THR L 26 35.478 323.060 208.489 1.00 31.05 C ANISOU13810 CB THR L 26 3832 4232 3736 277 84 77 C ATOM 13811 OG1 THR L 26 34.829 321.808 208.648 1.00 52.72 O ANISOU13811 OG1 THR L 26 6564 7018 6449 251 81 93 O ATOM 13812 CG2 THR L 26 34.828 323.896 207.419 1.00 75.41 C ANISOU13812 CG2 THR L 26 9430 9841 9382 299 81 100 C ATOM 13813 N LEU L 27 37.884 324.987 207.837 1.00 32.29 N ANISOU13813 N LEU L 27 4039 4281 3950 299 77 46 N ATOM 13814 CA LEU L 27 38.598 326.022 207.092 1.00 31.94 C ANISOU13814 CA LEU L 27 4006 4188 3940 313 73 47 C ATOM 13815 C LEU L 27 39.985 325.552 206.707 1.00 35.57 C ANISOU13815 C LEU L 27 4498 4623 4395 287 59 45 C ATOM 13816 O LEU L 27 40.464 325.851 205.616 1.00 32.24 O ANISOU13816 O LEU L 27 4084 4176 3991 284 48 63 O ATOM 13817 CB LEU L 27 38.723 327.321 207.880 1.00 30.69 C ANISOU13817 CB LEU L 27 3849 4003 3810 345 89 14 C ATOM 13818 CG LEU L 27 37.358 327.948 208.095 1.00 55.22 C ANISOU13818 CG LEU L 27 6923 7129 6928 377 104 18 C ATOM 13819 CD1 LEU L 27 37.470 329.014 209.150 1.00 46.49 C ANISOU13819 CD1 LEU L 27 5819 6003 5843 405 122 -23 C ATOM 13820 CD2 LEU L 27 36.900 328.565 206.777 1.00 53.54 C ANISOU13820 CD2 LEU L 27 6697 6901 6744 392 97 54 C ATOM 13821 N PHE L 28 40.659 324.860 207.623 1.00 28.82 N ANISOU13821 N PHE L 28 3660 3775 3516 269 59 22 N ATOM 13822 CA PHE L 28 42.062 324.521 207.413 1.00 30.31 C ANISOU13822 CA PHE L 28 3877 3937 3702 247 48 14 C ATOM 13823 C PHE L 28 42.204 323.488 206.300 1.00 28.77 C ANISOU13823 C PHE L 28 3687 3751 3493 219 31 46 C ATOM 13824 O PHE L 28 42.792 323.768 205.269 1.00 32.06 O ANISOU13824 O PHE L 28 4113 4142 3926 215 22 60 O ATOM 13825 CB PHE L 28 42.660 323.986 208.724 1.00 29.90 C ANISOU13825 CB PHE L 28 3839 3895 3625 236 52 -16 C ATOM 13826 CG PHE L 28 44.151 323.592 208.627 1.00 31.59 C ANISOU13826 CG PHE L 28 4082 4085 3835 214 41 -26 C ATOM 13827 CD1 PHE L 28 45.134 324.550 208.687 1.00 35.88 C ANISOU13827 CD1 PHE L 28 4640 4589 4403 224 42 -48 C ATOM 13828 CD2 PHE L 28 44.515 322.295 208.547 1.00 27.29 C ANISOU13828 CD2 PHE L 28 3547 3557 3264 186 30 -14 C ATOM 13829 CE1 PHE L 28 46.491 324.200 208.632 1.00 29.58 C ANISOU13829 CE1 PHE L 28 3866 3771 3601 205 31 -57 C ATOM 13830 CE2 PHE L 28 45.831 321.927 208.544 1.00 26.54 C ANISOU13830 CE2 PHE L 28 3477 3442 3166 169 20 -23 C ATOM 13831 CZ PHE L 28 46.828 322.894 208.552 1.00 29.47 C ANISOU13831 CZ PHE L 28 3861 3776 3560 178 21 -44 C ATOM 13832 N PHE L 29 41.617 322.306 206.478 1.00 31.16 N ANISOU13832 N PHE L 29 3982 4092 3767 200 28 58 N ATOM 13833 CA PHE L 29 41.716 321.286 205.451 1.00 32.43 C ANISOU13833 CA PHE L 29 4146 4261 3915 172 13 85 C ATOM 13834 C PHE L 29 40.941 321.687 204.217 1.00 39.79 C ANISOU13834 C PHE L 29 5060 5198 4861 180 7 114 C ATOM 13835 O PHE L 29 41.351 321.362 203.100 1.00 32.96 O ANISOU13835 O PHE L 29 4203 4325 3997 164 -6 133 O ATOM 13836 CB PHE L 29 41.194 319.963 205.970 1.00 28.32 C ANISOU13836 CB PHE L 29 3619 3777 3362 149 12 90 C ATOM 13837 CG PHE L 29 42.072 319.358 206.988 1.00 27.88 C ANISOU13837 CG PHE L 29 3584 3719 3289 136 13 69 C ATOM 13838 CD1 PHE L 29 43.307 318.906 206.629 1.00 33.24 C ANISOU13838 CD1 PHE L 29 4288 4374 3968 118 2 66 C ATOM 13839 CD2 PHE L 29 41.671 319.278 208.314 1.00 30.73 C ANISOU13839 CD2 PHE L 29 3939 4103 3636 143 26 52 C ATOM 13840 CE1 PHE L 29 44.160 318.350 207.597 1.00 42.52 C ANISOU13840 CE1 PHE L 29 5482 5548 5128 107 3 47 C ATOM 13841 CE2 PHE L 29 42.498 318.728 209.256 1.00 29.83 C ANISOU13841 CE2 PHE L 29 3843 3989 3504 132 26 34 C ATOM 13842 CZ PHE L 29 43.724 318.256 208.909 1.00 33.77 C ANISOU13842 CZ PHE L 29 4365 4463 4002 114 14 33 C ATOM 13843 N GLY L 30 39.799 322.356 204.401 1.00 32.12 N ANISOU13843 N GLY L 30 4062 4242 3899 205 18 119 N ATOM 13844 CA GLY L 30 39.000 322.744 203.241 1.00 31.01 C ANISOU13844 CA GLY L 30 3901 4110 3772 214 12 150 C ATOM 13845 C GLY L 30 39.707 323.784 202.383 1.00 33.34 C ANISOU13845 C GLY L 30 4207 4365 4097 229 8 157 C ATOM 13846 O GLY L 30 39.577 323.775 201.153 1.00 35.19 O ANISOU13846 O GLY L 30 4435 4601 4334 223 -4 185 O ATOM 13847 N SER L 31 40.457 324.706 202.999 1.00 31.35 N ANISOU13847 N SER L 31 3970 4076 3866 246 17 131 N ATOM 13848 CA SER L 31 41.151 325.663 202.155 1.00 32.36 C ANISOU13848 CA SER L 31 4107 4164 4023 257 13 140 C ATOM 13849 C SER L 31 42.213 324.966 201.308 1.00 31.93 C ANISOU13849 C SER L 31 4074 4099 3957 227 -2 150 C ATOM 13850 O SER L 31 42.326 325.262 200.113 1.00 32.44 O ANISOU13850 O SER L 31 4137 4154 4032 226 -11 176 O ATOM 13851 CB SER L 31 41.793 326.797 202.960 1.00 31.04 C ANISOU13851 CB SER L 31 3953 3958 3884 279 26 109 C ATOM 13852 OG SER L 31 42.723 326.300 203.935 1.00 32.47 O ANISOU13852 OG SER L 31 4155 4133 4048 263 27 76 O ATOM 13853 N GLY L 32 42.970 324.026 201.889 1.00 27.24 N ANISOU13853 N GLY L 32 3499 3508 3341 203 -5 131 N ATOM 13854 CA GLY L 32 43.970 323.301 201.073 1.00 33.02 C ANISOU13854 CA GLY L 32 4252 4232 4063 175 -19 139 C ATOM 13855 C GLY L 32 43.312 322.523 199.939 1.00 32.00 C ANISOU13855 C GLY L 32 4109 4132 3917 158 -31 170 C ATOM 13856 O GLY L 32 43.790 322.514 198.789 1.00 28.23 O ANISOU13856 O GLY L 32 3638 3646 3442 148 -41 188 O ATOM 13857 N PHE L 33 42.195 321.867 200.235 1.00 29.17 N ANISOU13857 N PHE L 33 3731 3811 3540 154 -30 177 N ATOM 13858 CA PHE L 33 41.580 321.031 199.215 1.00 26.96 C ANISOU13858 CA PHE L 33 3440 3563 3243 134 -42 204 C ATOM 13859 C PHE L 33 40.940 321.879 198.112 1.00 31.44 C ANISOU13859 C PHE L 33 3987 4134 3825 152 -45 233 C ATOM 13860 O PHE L 33 40.974 321.502 196.935 1.00 30.89 O ANISOU13860 O PHE L 33 3915 4074 3746 136 -58 254 O ATOM 13861 CB PHE L 33 40.545 320.103 199.845 1.00 32.18 C ANISOU13861 CB PHE L 33 4084 4263 3881 124 -39 203 C ATOM 13862 CG PHE L 33 39.954 319.108 198.870 1.00 30.23 C ANISOU13862 CG PHE L 33 3824 4047 3614 98 -52 226 C ATOM 13863 CD1 PHE L 33 40.640 317.953 198.539 1.00 27.73 C ANISOU13863 CD1 PHE L 33 3526 3731 3280 66 -61 222 C ATOM 13864 CD2 PHE L 33 38.698 319.307 198.341 1.00 26.35 C ANISOU13864 CD2 PHE L 33 3303 3587 3122 107 -53 249 C ATOM 13865 CE1 PHE L 33 40.078 317.053 197.639 1.00 30.80 C ANISOU13865 CE1 PHE L 33 3903 4148 3652 42 -72 239 C ATOM 13866 CE2 PHE L 33 38.100 318.387 197.475 1.00 29.09 C ANISOU13866 CE2 PHE L 33 3636 3966 3449 82 -66 267 C ATOM 13867 CZ PHE L 33 38.773 317.268 197.140 1.00 28.19 C ANISOU13867 CZ PHE L 33 3541 3851 3319 50 -75 261 C ATOM 13868 N ALA L 34 40.416 323.041 198.465 1.00 26.63 N ANISOU13868 N ALA L 34 3364 3515 3240 185 -35 233 N ATOM 13869 CA ALA L 34 39.748 323.867 197.467 1.00 30.73 C ANISOU13869 CA ALA L 34 3862 4038 3775 204 -38 264 C ATOM 13870 C ALA L 34 40.748 324.581 196.572 1.00 34.38 C ANISOU13870 C ALA L 34 4342 4465 4258 207 -43 275 C ATOM 13871 O ALA L 34 40.433 324.845 195.404 1.00 33.34 O ANISOU13871 O ALA L 34 4197 4342 4127 210 -52 307 O ATOM 13872 CB ALA L 34 38.825 324.918 198.149 1.00 29.87 C ANISOU13872 CB ALA L 34 3732 3928 3689 241 -24 262 C ATOM 13873 N ALA L 35 41.956 324.881 197.081 1.00 27.92 N ANISOU13873 N ALA L 35 3550 3609 3451 206 -38 250 N ATOM 13874 CA ALA L 35 42.854 325.758 196.334 1.00 26.01 C ANISOU13874 CA ALA L 35 3320 3329 3232 212 -40 261 C ATOM 13875 C ALA L 35 43.116 325.266 194.902 1.00 24.01 C ANISOU13875 C ALA L 35 3068 3090 2964 191 -55 289 C ATOM 13876 O ALA L 35 43.030 326.100 193.991 1.00 28.32 O ANISOU13876 O ALA L 35 3606 3627 3528 205 -58 317 O ATOM 13877 CB ALA L 35 44.152 325.982 197.114 1.00 27.67 C ANISOU13877 CB ALA L 35 3558 3500 3454 208 -34 228 C ATOM 13878 N PRO L 36 43.405 323.979 194.626 1.00 27.63 N ANISOU13878 N PRO L 36 3535 3571 3391 159 -65 285 N ATOM 13879 CA PRO L 36 43.694 323.610 193.210 1.00 31.26 C ANISOU13879 CA PRO L 36 3996 4044 3838 141 -79 310 C ATOM 13880 C PRO L 36 42.481 323.836 192.299 1.00 32.75 C ANISOU13880 C PRO L 36 4155 4266 4022 150 -85 346 C ATOM 13881 O PRO L 36 42.635 324.254 191.139 1.00 31.76 O ANISOU13881 O PRO L 36 4026 4143 3899 151 -92 373 O ATOM 13882 CB PRO L 36 44.088 322.113 193.296 1.00 24.14 C ANISOU13882 CB PRO L 36 3107 3160 2905 106 -86 293 C ATOM 13883 CG PRO L 36 44.679 321.959 194.758 1.00 30.22 C ANISOU13883 CG PRO L 36 3895 3907 3680 107 -76 257 C ATOM 13884 CD PRO L 36 43.753 322.899 195.567 1.00 29.14 C ANISOU13884 CD PRO L 36 3741 3769 3563 139 -64 256 C ATOM 13885 N PHE L 37 41.268 323.598 192.801 1.00 33.75 N ANISOU13885 N PHE L 37 4259 4422 4141 158 -83 347 N ATOM 13886 CA PHE L 37 40.080 323.864 191.996 1.00 28.70 C ANISOU13886 CA PHE L 37 3588 3816 3498 169 -89 381 C ATOM 13887 C PHE L 37 39.996 325.321 191.621 1.00 38.37 C ANISOU13887 C PHE L 37 4805 5018 4756 203 -85 404 C ATOM 13888 O PHE L 37 39.734 325.646 190.464 1.00 32.74 O ANISOU13888 O PHE L 37 4079 4320 4042 206 -94 438 O ATOM 13889 CB PHE L 37 38.798 323.425 192.702 1.00 27.75 C ANISOU13889 CB PHE L 37 3444 3731 3367 173 -86 376 C ATOM 13890 CG PHE L 37 38.765 321.951 192.947 1.00 26.95 C ANISOU13890 CG PHE L 37 3349 3656 3235 139 -92 359 C ATOM 13891 CD1 PHE L 37 39.297 321.431 194.158 1.00 27.25 C ANISOU13891 CD1 PHE L 37 3407 3677 3270 130 -83 326 C ATOM 13892 CD2 PHE L 37 38.339 321.084 191.925 1.00 30.92 C ANISOU13892 CD2 PHE L 37 3840 4197 3711 113 -107 376 C ATOM 13893 CE1 PHE L 37 39.328 320.075 194.367 1.00 29.32 C ANISOU13893 CE1 PHE L 37 3675 3959 3505 98 -88 313 C ATOM 13894 CE2 PHE L 37 38.354 319.739 192.106 1.00 28.69 C ANISOU13894 CE2 PHE L 37 3564 3934 3404 80 -111 360 C ATOM 13895 CZ PHE L 37 38.835 319.205 193.337 1.00 31.52 C ANISOU13895 CZ PHE L 37 3942 4274 3761 72 -102 330 C ATOM 13896 N PHE L 38 40.286 326.213 192.574 1.00 27.00 N ANISOU13896 N PHE L 38 3374 3539 3346 227 -70 385 N ATOM 13897 CA PHE L 38 40.242 327.637 192.248 1.00 31.74 C ANISOU13897 CA PHE L 38 3967 4110 3983 260 -64 407 C ATOM 13898 C PHE L 38 41.434 328.097 191.440 1.00 30.21 C ANISOU13898 C PHE L 38 3794 3884 3801 253 -68 418 C ATOM 13899 O PHE L 38 41.310 329.065 190.672 1.00 34.20 O ANISOU13899 O PHE L 38 4290 4377 4329 273 -68 450 O ATOM 13900 CB PHE L 38 40.078 328.460 193.533 1.00 29.57 C ANISOU13900 CB PHE L 38 3692 3804 3738 289 -46 381 C ATOM 13901 CG PHE L 38 38.689 328.349 194.047 1.00 34.32 C ANISOU13901 CG PHE L 38 4265 4440 4335 305 -42 383 C ATOM 13902 CD1 PHE L 38 38.327 327.271 194.840 1.00 35.24 C ANISOU13902 CD1 PHE L 38 4380 4587 4423 286 -41 359 C ATOM 13903 CD2 PHE L 38 37.722 329.226 193.615 1.00 42.51 C ANISOU13903 CD2 PHE L 38 5275 5485 5393 336 -40 413 C ATOM 13904 CE1 PHE L 38 37.011 327.117 195.253 1.00 39.18 C ANISOU13904 CE1 PHE L 38 4850 5121 4915 299 -37 364 C ATOM 13905 CE2 PHE L 38 36.403 329.094 194.035 1.00 37.22 C ANISOU13905 CE2 PHE L 38 4575 4849 4716 351 -37 417 C ATOM 13906 CZ PHE L 38 36.050 328.026 194.833 1.00 35.45 C ANISOU13906 CZ PHE L 38 4349 4656 4464 331 -35 392 C ATOM 13907 N ILE L 39 42.578 327.406 191.522 1.00 30.07 N ANISOU13907 N ILE L 39 3802 3854 3769 225 -70 395 N ATOM 13908 CA ILE L 39 43.673 327.782 190.626 1.00 32.44 C ANISOU13908 CA ILE L 39 4120 4130 4077 217 -74 409 C ATOM 13909 C ILE L 39 43.331 327.402 189.178 1.00 29.91 C ANISOU13909 C ILE L 39 3785 3848 3733 203 -89 447 C ATOM 13910 O ILE L 39 43.590 328.153 188.237 1.00 33.23 O ANISOU13910 O ILE L 39 4202 4257 4165 212 -92 478 O ATOM 13911 CB ILE L 39 45.004 327.160 191.099 1.00 30.59 C ANISOU13911 CB ILE L 39 3915 3874 3834 192 -73 375 C ATOM 13912 CG1 ILE L 39 45.396 327.771 192.461 1.00 32.46 C ANISOU13912 CG1 ILE L 39 4165 4071 4098 208 -59 340 C ATOM 13913 CG2 ILE L 39 46.110 327.376 190.032 1.00 35.12 C ANISOU13913 CG2 ILE L 39 4503 4431 4410 178 -78 391 C ATOM 13914 CD1 ILE L 39 46.622 327.047 193.127 1.00 37.28 C ANISOU13914 CD1 ILE L 39 4803 4666 4697 184 -58 303 C ATOM 13915 N VAL L 40 42.754 326.233 188.983 1.00 26.78 N ANISOU13915 N VAL L 40 3380 3496 3301 182 -99 445 N ATOM 13916 CA VAL L 40 42.318 325.828 187.657 1.00 31.21 C ANISOU13916 CA VAL L 40 3925 4099 3836 169 -113 477 C ATOM 13917 C VAL L 40 41.290 326.809 187.140 1.00 34.16 C ANISOU13917 C VAL L 40 4270 4485 4226 199 -115 516 C ATOM 13918 O VAL L 40 41.343 327.227 185.985 1.00 30.76 O ANISOU13918 O VAL L 40 3831 4065 3793 201 -122 552 O ATOM 13919 CB VAL L 40 41.715 324.421 187.709 1.00 28.99 C ANISOU13919 CB VAL L 40 3635 3862 3517 142 -122 463 C ATOM 13920 CG1 VAL L 40 40.875 324.125 186.375 1.00 31.03 C ANISOU13920 CG1 VAL L 40 3868 4173 3750 133 -138 499 C ATOM 13921 CG2 VAL L 40 42.767 323.427 188.015 1.00 32.04 C ANISOU13921 CG2 VAL L 40 4049 4236 3887 112 -123 430 C ATOM 13922 N ARG L 41 40.319 327.173 187.997 1.00 33.33 N ANISOU13922 N ARG L 41 4147 4382 4136 223 -107 512 N ATOM 13923 CA ARG L 41 39.319 328.141 187.579 1.00 29.64 C ANISOU13923 CA ARG L 41 3651 3924 3687 255 -107 549 C ATOM 13924 C ARG L 41 39.959 329.435 187.121 1.00 39.71 C ANISOU13924 C ARG L 41 4933 5156 4997 277 -101 573 C ATOM 13925 O ARG L 41 39.591 329.996 186.073 1.00 37.20 O ANISOU13925 O ARG L 41 4599 4854 4683 289 -109 616 O ATOM 13926 CB ARG L 41 38.341 328.426 188.737 1.00 31.64 C ANISOU13926 CB ARG L 41 3888 4177 3958 280 -96 534 C ATOM 13927 CG ARG L 41 37.338 329.514 188.368 1.00 35.94 C ANISOU13927 CG ARG L 41 4402 4727 4527 318 -94 571 C ATOM 13928 CD ARG L 41 36.310 329.624 189.529 1.00 45.08 C ANISOU13928 CD ARG L 41 5541 5892 5697 340 -82 553 C ATOM 13929 NE ARG L 41 35.430 330.773 189.358 1.00 46.34 N ANISOU13929 NE ARG L 41 5673 6046 5887 382 -77 584 N ATOM 13930 CZ ARG L 41 35.695 331.988 189.826 1.00 75.11 C ANISOU13930 CZ ARG L 41 9324 9639 9576 414 -63 581 C ATOM 13931 NH1 ARG L 41 36.816 332.207 190.488 1.00 49.24 N ANISOU13931 NH1 ARG L 41 6079 6315 6316 408 -52 548 N ATOM 13932 NH2 ARG L 41 34.847 332.986 189.628 1.00 67.11 N ANISOU13932 NH2 ARG L 41 8284 8623 8592 453 -59 611 N ATOM 13933 N HIS L 42 40.926 329.924 187.905 1.00 37.25 N ANISOU13933 N HIS L 42 4647 4792 4713 282 -88 545 N ATOM 13934 CA HIS L 42 41.658 331.148 187.585 1.00 34.71 C ANISOU13934 CA HIS L 42 4337 4423 4429 300 -81 562 C ATOM 13935 C HIS L 42 42.372 331.040 186.242 1.00 38.16 C ANISOU13935 C HIS L 42 4780 4869 4850 281 -92 592 C ATOM 13936 O HIS L 42 42.324 331.965 185.410 1.00 43.69 O ANISOU13936 O HIS L 42 5471 5560 5569 298 -93 634 O ATOM 13937 CB HIS L 42 42.654 331.413 188.720 1.00 34.89 C ANISOU13937 CB HIS L 42 4387 4394 4476 300 -67 518 C ATOM 13938 CG HIS L 42 43.689 332.439 188.389 1.00 39.82 C ANISOU13938 CG HIS L 42 5027 4967 5134 307 -61 529 C ATOM 13939 ND1 HIS L 42 43.423 333.794 188.372 1.00 40.83 N ANISOU13939 ND1 HIS L 42 5147 5060 5307 341 -51 551 N ATOM 13940 CD2 HIS L 42 45.003 332.311 188.061 1.00 35.99 C ANISOU13940 CD2 HIS L 42 4568 4461 4647 284 -62 521 C ATOM 13941 CE1 HIS L 42 44.517 334.455 188.047 1.00 37.15 C ANISOU13941 CE1 HIS L 42 4699 4551 4865 337 -47 556 C ATOM 13942 NE2 HIS L 42 45.492 333.578 187.844 1.00 38.13 N ANISOU13942 NE2 HIS L 42 4843 4684 4959 303 -53 539 N ATOM 13943 N GLN L 43 43.022 329.902 185.995 1.00 34.79 N ANISOU13943 N GLN L 43 4368 4462 4386 245 -100 573 N ATOM 13944 CA GLN L 43 43.705 329.755 184.717 1.00 32.59 C ANISOU13944 CA GLN L 43 4096 4198 4090 225 -110 599 C ATOM 13945 C GLN L 43 42.697 329.656 183.549 1.00 31.78 C ANISOU13945 C GLN L 43 3963 4148 3963 228 -124 644 C ATOM 13946 O GLN L 43 42.964 330.177 182.463 1.00 36.01 O ANISOU13946 O GLN L 43 4495 4688 4498 230 -129 682 O ATOM 13947 CB GLN L 43 44.633 328.538 184.755 1.00 31.06 C ANISOU13947 CB GLN L 43 3925 4012 3864 188 -114 565 C ATOM 13948 CG GLN L 43 45.957 328.787 185.588 1.00 26.71 C ANISOU13948 CG GLN L 43 3404 3407 3337 183 -102 530 C ATOM 13949 CD GLN L 43 46.940 329.697 184.759 1.00 34.14 C ANISOU13949 CD GLN L 43 4355 4318 4298 185 -99 556 C ATOM 13950 OE1 GLN L 43 46.709 329.925 183.588 1.00 39.90 O ANISOU13950 OE1 GLN L 43 5071 5071 5017 186 -107 597 O ATOM 13951 NE2 GLN L 43 48.031 330.171 185.372 1.00 32.23 N ANISOU13951 NE2 GLN L 43 4136 4027 4084 185 -88 533 N ATOM 13952 N LEU L 44 41.561 329.019 183.753 1.00 35.72 N ANISOU13952 N LEU L 44 4442 4689 4441 227 -130 640 N ATOM 13953 CA LEU L 44 40.554 328.961 182.679 1.00 33.56 C ANISOU13953 CA LEU L 44 4137 4469 4145 231 -145 682 C ATOM 13954 C LEU L 44 39.972 330.337 182.382 1.00 38.64 C ANISOU13954 C LEU L 44 4760 5097 4823 270 -141 726 C ATOM 13955 O LEU L 44 39.744 330.688 181.221 1.00 40.54 O ANISOU13955 O LEU L 44 4985 5364 5054 275 -151 771 O ATOM 13956 CB LEU L 44 39.437 327.996 183.062 1.00 35.68 C ANISOU13956 CB LEU L 44 4386 4783 4387 221 -152 667 C ATOM 13957 CG LEU L 44 39.883 326.552 183.059 1.00 43.23 C ANISOU13957 CG LEU L 44 5359 5763 5306 180 -158 633 C ATOM 13958 CD1 LEU L 44 38.782 325.663 183.577 1.00 36.95 C ANISOU13958 CD1 LEU L 44 4544 5005 4490 171 -163 616 C ATOM 13959 CD2 LEU L 44 40.205 326.212 181.605 1.00 41.83 C ANISOU13959 CD2 LEU L 44 5178 5620 5096 158 -173 658 C ATOM 13960 N LEU L 45 39.744 331.140 183.404 1.00 34.80 N ANISOU13960 N LEU L 45 4275 4570 4378 300 -127 715 N ATOM 13961 CA LEU L 45 39.156 332.451 183.171 1.00 45.21 C ANISOU13961 CA LEU L 45 5573 5871 5733 340 -122 755 C ATOM 13962 C LEU L 45 40.122 333.452 182.531 1.00 60.82 C ANISOU13962 C LEU L 45 7565 7806 7738 348 -117 783 C ATOM 13963 O LEU L 45 39.662 334.456 181.987 1.00114.39 O ANISOU13963 O LEU L 45 14331 14583 14547 377 -117 829 O ATOM 13964 CB LEU L 45 38.655 332.986 184.498 1.00 39.17 C ANISOU13964 CB LEU L 45 4805 5073 5005 369 -106 729 C ATOM 13965 CG LEU L 45 37.397 332.249 184.927 1.00 46.34 C ANISOU13965 CG LEU L 45 5688 6030 5890 370 -111 719 C ATOM 13966 CD1 LEU L 45 36.965 332.699 186.334 1.00 52.44 C ANISOU13966 CD1 LEU L 45 6458 6771 6694 396 -94 687 C ATOM 13967 CD2 LEU L 45 36.291 332.508 183.893 1.00 45.30 C ANISOU13967 CD2 LEU L 45 5519 5945 5747 386 -124 772 C ATOM 13968 N LYS L 46 41.450 333.233 182.619 1.00 43.39 N ANISOU13968 N LYS L 46 5389 5568 5529 324 -113 758 N ATOM 13969 CA LYS L 46 42.402 334.146 181.976 1.00 74.93 C ANISOU13969 CA LYS L 46 9397 9525 9550 328 -108 786 C ATOM 13970 C LYS L 46 42.215 334.148 180.466 1.00 80.66 C ANISOU13970 C LYS L 46 10106 10293 10248 322 -122 840 C ATOM 13971 O LYS L 46 42.126 335.207 179.833 1.00 97.12 O ANISOU13971 O LYS L 46 12180 12363 12359 345 -120 887 O ATOM 13972 CB LYS L 46 43.842 333.756 182.327 1.00 65.61 C ANISOU13972 CB LYS L 46 8251 8311 8366 300 -101 747 C ATOM 13973 CG LYS L 46 44.288 334.261 183.665 1.00 42.08 C ANISOU13973 CG LYS L 46 5290 5273 5427 312 -85 706 C ATOM 13974 CD LYS L 46 45.608 333.605 184.108 1.00 51.38 C ANISOU13974 CD LYS L 46 6498 6430 6593 281 -82 662 C ATOM 13975 CE LYS L 46 46.711 334.588 184.079 1.00 57.38 C ANISOU13975 CE LYS L 46 7277 7134 7392 285 -71 666 C ATOM 13976 NZ LYS L 46 47.900 334.040 184.744 1.00 37.40 N ANISOU13976 NZ LYS L 46 4773 4580 4855 260 -66 618 N ATOM 13977 N LYS L 47 42.185 332.963 179.876 1.00 60.71 N ATOM 13978 CA LYS L 47 41.683 332.728 178.540 1.00 86.97 C ATOM 13979 C LYS L 47 41.622 331.222 178.387 1.00157.04 C ATOM 13980 O LYS L 47 42.515 330.514 178.886 1.00 79.80 O ATOM 13981 CB LYS L 47 42.565 333.358 177.473 1.00146.47 C ATOM 13982 CG LYS L 47 41.874 334.466 176.718 1.00123.38 C ATOM 13983 CD LYS L 47 42.664 334.821 175.491 1.00 97.98 C ATOM 13984 CE LYS L 47 44.083 335.196 175.863 1.00 92.64 C ATOM 13985 NZ LYS L 47 44.840 335.588 174.651 1.00161.06 N ATOM 13986 OXT LYS L 47 40.674 330.705 177.796 1.00156.68 O