>>3AG2:HELIX   73 AI1 ASN N   11  GLY N   42  1                                  32    
NHKDIGTLYLLFGAWAGMVGTALSLLIRAELG
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 73 AI1 ASN N 11 GLY N 42 1 32 ATOM 14418 N ASN N 11 128.809 301.483 215.520 1.00 33.91 N ANISOU14418 N ASN N 11 4056 3674 5155 -104 -875 -288 N ATOM 14419 CA ASN N 11 129.244 302.703 216.214 1.00 32.16 C ANISOU14419 CA ASN N 11 3850 3478 4893 -121 -878 -283 C ATOM 14420 C ASN N 11 129.459 303.832 215.205 1.00 36.79 C ANISOU14420 C ASN N 11 4426 4100 5453 -128 -823 -313 C ATOM 14421 O ASN N 11 130.258 303.688 214.276 1.00 36.32 O ANISOU14421 O ASN N 11 4328 4042 5429 -115 -809 -340 O ATOM 14422 CB ASN N 11 130.574 302.423 217.005 1.00 34.55 C ANISOU14422 CB ASN N 11 4132 3761 5235 -113 -933 -278 C ATOM 14423 CG ASN N 11 131.121 303.667 217.685 1.00 36.52 C ANISOU14423 CG ASN N 11 4394 4038 5445 -131 -936 -276 C ATOM 14424 OD1 ASN N 11 131.861 304.449 217.084 1.00 39.96 O ANISOU14424 OD1 ASN N 11 4809 4495 5880 -133 -910 -301 O ATOM 14425 ND2 ASN N 11 130.771 303.851 218.961 1.00 33.20 N ANISOU14425 ND2 ASN N 11 4008 3615 4991 -146 -970 -246 N ATOM 14426 N HIS N 12 128.807 304.977 215.436 1.00 31.28 N ANISOU14426 N HIS N 12 3759 3431 4695 -149 -795 -307 N ATOM 14427 CA HIS N 12 128.838 306.058 214.440 1.00 34.46 C ANISOU14427 CA HIS N 12 4156 3867 5072 -158 -742 -331 C ATOM 14428 C HIS N 12 130.246 306.586 214.186 1.00 37.34 C ANISOU14428 C HIS N 12 4488 4240 5459 -156 -746 -351 C ATOM 14429 O HIS N 12 130.545 307.009 213.052 1.00 35.11 O ANISOU14429 O HIS N 12 4184 3975 5181 -155 -708 -374 O ATOM 14430 CB HIS N 12 127.921 307.214 214.841 1.00 30.28 C ANISOU14430 CB HIS N 12 3665 3362 4478 -181 -716 -320 C ATOM 14431 CG HIS N 12 128.416 308.035 216.001 1.00 35.21 C ANISOU14431 CG HIS N 12 4307 3993 5079 -195 -744 -310 C ATOM 14432 ND1 HIS N 12 129.029 309.260 215.834 1.00 32.45 N ANISOU14432 ND1 HIS N 12 3952 3666 4710 -207 -724 -324 N ATOM 14433 CD2 HIS N 12 128.331 307.844 217.344 1.00 37.46 C ANISOU14433 CD2 HIS N 12 4615 4265 5353 -200 -788 -287 C ATOM 14434 CE1 HIS N 12 129.336 309.766 217.018 1.00 49.34 C ANISOU14434 CE1 HIS N 12 6111 5807 6830 -218 -755 -313 C ATOM 14435 NE2 HIS N 12 128.933 308.921 217.952 1.00 37.98 N ANISOU14435 NE2 HIS N 12 4689 4347 5394 -214 -795 -290 N ATOM 14436 N LYS N 13 131.144 306.571 215.204 1.00 31.24 N ANISOU14436 N LYS N 13 3711 3457 4702 -156 -792 -341 N ATOM 14437 CA LYS N 13 132.466 307.124 214.954 1.00 28.72 C ANISOU14437 CA LYS N 13 3361 3148 4404 -156 -794 -360 C ATOM 14438 C LYS N 13 133.311 306.172 214.128 1.00 33.49 C ANISOU14438 C LYS N 13 3918 3735 5072 -133 -801 -381 C ATOM 14439 O LYS N 13 133.957 306.592 213.176 1.00 33.08 O ANISOU14439 O LYS N 13 3838 3698 5033 -131 -773 -405 O ATOM 14440 CB LYS N 13 133.208 307.450 216.287 1.00 31.99 C ANISOU14440 CB LYS N 13 3784 3559 4814 -165 -842 -344 C ATOM 14441 CG LYS N 13 132.353 308.312 217.218 1.00 32.40 C ANISOU14441 CG LYS N 13 3883 3625 4803 -187 -840 -325 C ATOM 14442 CD LYS N 13 133.112 308.561 218.567 1.00 39.15 C ANISOU14442 CD LYS N 13 4746 4477 5653 -195 -891 -311 C ATOM 14443 CE LYS N 13 132.252 309.259 219.564 1.00 45.65 C ANISOU14443 CE LYS N 13 5615 5311 6417 -214 -894 -294 C ATOM 14444 NZ LYS N 13 131.183 308.356 220.165 1.00 36.61 N ANISOU14444 NZ LYS N 13 4498 4148 5264 -210 -916 -268 N ATOM 14445 N ASP N 14 133.301 304.892 214.482 1.00 33.16 N ANISOU14445 N ASP N 14 3869 3659 5072 -114 -838 -371 N ATOM 14446 CA ASP N 14 134.063 303.919 213.713 1.00 37.51 C ANISOU14446 CA ASP N 14 4375 4189 5688 -89 -845 -394 C ATOM 14447 C ASP N 14 133.553 303.831 212.279 1.00 32.75 C ANISOU14447 C ASP N 14 3759 3599 5086 -83 -793 -420 C ATOM 14448 O ASP N 14 134.342 303.710 211.326 1.00 31.54 O ANISOU14448 O ASP N 14 3567 3449 4969 -71 -777 -450 O ATOM 14449 CB ASP N 14 133.966 302.546 214.374 1.00 30.33 C ANISOU14449 CB ASP N 14 3464 3237 4822 -72 -895 -375 C ATOM 14450 CG ASP N 14 134.814 302.429 215.673 1.00 35.53 C ANISOU14450 CG ASP N 14 4123 3880 5498 -73 -954 -353 C ATOM 14451 OD1 ASP N 14 135.525 303.387 216.056 1.00 36.24 O ANISOU14451 OD1 ASP N 14 4212 3992 5567 -87 -957 -354 O ATOM 14452 OD2 ASP N 14 134.782 301.331 216.273 1.00 35.16 O ANISOU14452 OD2 ASP N 14 4075 3796 5488 -60 -999 -334 O ATOM 14453 N ILE N 15 132.228 303.829 212.115 1.00 29.17 N ANISOU14453 N ILE N 15 3338 3152 4594 -91 -768 -408 N ATOM 14454 CA ILE N 15 131.656 303.832 210.764 1.00 36.15 C ANISOU14454 CA ILE N 15 4214 4053 5471 -88 -718 -431 C ATOM 14455 C ILE N 15 132.079 305.072 209.993 1.00 38.03 C ANISOU14455 C ILE N 15 4442 4327 5682 -102 -677 -449 C ATOM 14456 O ILE N 15 132.425 304.988 208.802 1.00 32.10 O ANISOU14456 O ILE N 15 3661 3585 4951 -94 -649 -478 O ATOM 14457 CB ILE N 15 130.136 303.644 210.854 1.00 36.21 C ANISOU14457 CB ILE N 15 4259 4061 5438 -97 -701 -411 C ATOM 14458 CG1 ILE N 15 129.930 302.172 211.233 1.00 27.15 C ANISOU14458 CG1 ILE N 15 3106 2874 4337 -78 -739 -401 C ATOM 14459 CG2 ILE N 15 129.414 304.017 209.496 1.00 27.86 C ANISOU14459 CG2 ILE N 15 3201 3030 4354 -102 -643 -430 C ATOM 14460 CD1 ILE N 15 128.476 301.863 211.688 1.00 29.76 C ANISOU14460 CD1 ILE N 15 3476 3198 4633 -88 -738 -373 C ATOM 14461 N GLY N 16 132.067 306.241 210.634 1.00 32.04 N ANISOU14461 N GLY N 16 3708 3587 4878 -124 -674 -434 N ATOM 14462 CA GLY N 16 132.577 307.441 209.972 1.00 29.35 C ANISOU14462 CA GLY N 16 3356 3277 4517 -139 -642 -449 C ATOM 14463 C GLY N 16 134.037 307.315 209.602 1.00 33.23 C ANISOU14463 C GLY N 16 3802 3766 5059 -128 -654 -472 C ATOM 14464 O GLY N 16 134.480 307.797 208.556 1.00 33.39 O ANISOU14464 O GLY N 16 3798 3807 5083 -130 -622 -494 O ATOM 14465 N THR N 17 134.825 306.653 210.472 1.00 28.91 N ANISOU14465 N THR N 17 3241 3195 4551 -116 -703 -466 N ATOM 14466 CA THR N 17 136.232 306.443 210.157 1.00 31.00 C ANISOU14466 CA THR N 17 3458 3454 4867 -103 -717 -488 C ATOM 14467 C THR N 17 136.409 305.556 208.916 1.00 34.91 C ANISOU14467 C THR N 17 3915 3941 5408 -81 -698 -520 C ATOM 14468 O THR N 17 137.234 305.847 208.049 1.00 33.56 O ANISOU14468 O THR N 17 3709 3785 5258 -78 -677 -547 O ATOM 14469 CB THR N 17 136.944 305.865 211.390 1.00 35.16 C ANISOU14469 CB THR N 17 3979 3953 5426 -95 -776 -472 C ATOM 14470 OG1 THR N 17 136.970 306.915 212.349 1.00 31.87 O ANISOU14470 OG1 THR N 17 3592 3553 4965 -118 -787 -450 O ATOM 14471 CG2 THR N 17 138.394 305.436 211.056 1.00 31.47 C ANISOU14471 CG2 THR N 17 3459 3476 5021 -78 -794 -496 C ATOM 14472 N LEU N 18 135.650 304.464 208.832 1.00 29.93 N ANISOU14472 N LEU N 18 3291 3286 4794 -64 -704 -519 N ATOM 14473 CA LEU N 18 135.620 303.629 207.618 1.00 35.11 C ANISOU14473 CA LEU N 18 3916 3935 5487 -44 -682 -552 C ATOM 14474 C LEU N 18 135.299 304.459 206.363 1.00 34.92 C ANISOU14474 C LEU N 18 3890 3949 5430 -56 -625 -572 C ATOM 14475 O LEU N 18 135.989 304.352 205.347 1.00 37.53 O ANISOU14475 O LEU N 18 4180 4288 5790 -47 -605 -606 O ATOM 14476 CB LEU N 18 134.611 302.479 207.776 1.00 32.38 C ANISOU14476 CB LEU N 18 3588 3562 5154 -30 -695 -542 C ATOM 14477 CG LEU N 18 134.988 301.401 208.817 1.00 33.66 C ANISOU14477 CG LEU N 18 3744 3679 5365 -12 -753 -527 C ATOM 14478 CD1 LEU N 18 133.845 300.478 209.093 1.00 40.43 C ANISOU14478 CD1 LEU N 18 4626 4513 6221 -7 -765 -509 C ATOM 14479 CD2 LEU N 18 136.219 300.615 208.368 1.00 34.40 C ANISOU14479 CD2 LEU N 18 3784 3751 5534 14 -771 -560 C ATOM 14480 N TYR N 19 134.269 305.287 206.427 1.00 33.12 N ANISOU14480 N TYR N 19 3702 3742 5139 -79 -600 -550 N ATOM 14481 CA TYR N 19 133.920 306.152 205.307 1.00 35.00 C ANISOU14481 CA TYR N 19 3941 4015 5342 -93 -550 -563 C ATOM 14482 C TYR N 19 135.065 307.082 204.942 1.00 36.18 C ANISOU14482 C TYR N 19 4063 4186 5497 -103 -539 -578 C ATOM 14483 O TYR N 19 135.351 307.275 203.744 1.00 37.27 O ANISOU14483 O TYR N 19 4173 4343 5643 -102 -506 -605 O ATOM 14484 CB TYR N 19 132.695 306.980 205.645 1.00 31.83 C ANISOU14484 CB TYR N 19 3589 3630 4875 -116 -531 -533 C ATOM 14485 CG TYR N 19 131.349 306.344 205.321 1.00 36.88 C ANISOU14485 CG TYR N 19 4252 4265 5496 -112 -515 -527 C ATOM 14486 CD1 TYR N 19 130.894 306.274 204.015 1.00 29.76 C ANISOU14486 CD1 TYR N 19 3340 3380 4588 -110 -477 -547 C ATOM 14487 CD2 TYR N 19 130.515 305.886 206.336 1.00 26.51 C ANISOU14487 CD2 TYR N 19 2972 2932 4168 -113 -539 -499 C ATOM 14488 CE1 TYR N 19 129.631 305.748 203.707 1.00 33.11 C ANISOU14488 CE1 TYR N 19 3786 3802 4992 -109 -462 -540 C ATOM 14489 CE2 TYR N 19 129.255 305.401 206.091 1.00 28.58 C ANISOU14489 CE2 TYR N 19 3257 3192 4409 -113 -524 -490 C ATOM 14490 CZ TYR N 19 128.803 305.339 204.763 1.00 32.17 C ANISOU14490 CZ TYR N 19 3701 3665 4858 -111 -485 -510 C ATOM 14491 OH TYR N 19 127.580 304.867 204.549 1.00 29.29 O ANISOU14491 OH TYR N 19 3358 3297 4472 -113 -472 -500 O ATOM 14492 N LEU N 20 135.739 307.665 205.952 1.00 33.79 N ANISOU14492 N LEU N 20 3765 3881 5191 -114 -567 -560 N ATOM 14493 CA LEU N 20 136.851 308.564 205.646 1.00 33.97 C ANISOU14493 CA LEU N 20 3762 3925 5220 -125 -559 -571 C ATOM 14494 C LEU N 20 137.966 307.803 204.969 1.00 39.71 C ANISOU14494 C LEU N 20 4434 4644 6009 -104 -564 -606 C ATOM 14495 O LEU N 20 138.570 308.298 204.013 1.00 32.38 O ANISOU14495 O LEU N 20 3476 3739 5088 -109 -536 -628 O ATOM 14496 CB LEU N 20 137.379 309.254 206.912 1.00 30.01 C ANISOU14496 CB LEU N 20 3276 3421 4706 -140 -592 -547 C ATOM 14497 CG LEU N 20 136.384 310.257 207.509 1.00 33.77 C ANISOU14497 CG LEU N 20 3803 3911 5118 -165 -582 -518 C ATOM 14498 CD1 LEU N 20 136.954 310.816 208.818 1.00 32.44 C ANISOU14498 CD1 LEU N 20 3648 3738 4940 -178 -618 -499 C ATOM 14499 CD2 LEU N 20 136.186 311.411 206.496 1.00 36.26 C ANISOU14499 CD2 LEU N 20 4120 4257 5401 -185 -536 -525 C ATOM 14500 N LEU N 21 138.231 306.580 205.436 1.00 30.28 N ANISOU14500 N LEU N 21 3226 3417 4863 -79 -599 -611 N ATOM 14501 CA LEU N 21 139.297 305.779 204.840 1.00 35.62 C ANISOU14501 CA LEU N 21 3848 4081 5603 -56 -606 -647 C ATOM 14502 C LEU N 21 138.923 305.415 203.417 1.00 37.19 C ANISOU14502 C LEU N 21 4029 4293 5810 -46 -564 -682 C ATOM 14503 O LEU N 21 139.761 305.439 202.496 1.00 35.28 O ANISOU14503 O LEU N 21 3744 4065 5597 -40 -544 -716 O ATOM 14504 CB LEU N 21 139.496 304.496 205.649 1.00 32.16 C ANISOU14504 CB LEU N 21 3403 3600 5215 -31 -654 -643 C ATOM 14505 CG LEU N 21 140.186 304.883 206.974 1.00 42.09 C ANISOU14505 CG LEU N 21 4670 4850 6473 -40 -698 -614 C ATOM 14506 CD1 LEU N 21 140.074 303.757 207.994 1.00 41.12 C ANISOU14506 CD1 LEU N 21 4555 4686 6384 -21 -749 -597 C ATOM 14507 CD2 LEU N 21 141.649 305.235 206.693 1.00 40.52 C ANISOU14507 CD2 LEU N 21 4425 4664 6308 -40 -700 -634 C ATOM 14508 N PHE N 22 137.691 304.957 203.254 1.00 33.32 N ANISOU14508 N PHE N 22 3567 3796 5299 -42 -553 -675 N ATOM 14509 CA PHE N 22 137.208 304.568 201.949 1.00 31.72 C ANISOU14509 CA PHE N 22 3350 3605 5099 -34 -514 -707 C ATOM 14510 C PHE N 22 137.339 305.737 200.976 1.00 32.18 C ANISOU14510 C PHE N 22 3401 3705 5121 -56 -470 -717 C ATOM 14511 O PHE N 22 137.905 305.600 199.884 1.00 37.24 O ANISOU14511 O PHE N 22 4003 4361 5787 -48 -445 -756 O ATOM 14512 CB PHE N 22 135.757 304.099 202.071 1.00 30.93 C ANISOU14512 CB PHE N 22 3289 3495 4969 -34 -510 -688 C ATOM 14513 CG PHE N 22 135.156 303.721 200.763 1.00 31.97 C ANISOU14513 CG PHE N 22 3409 3639 5097 -27 -472 -719 C ATOM 14514 CD1 PHE N 22 134.519 304.681 199.987 1.00 30.70 C ANISOU14514 CD1 PHE N 22 3265 3515 4883 -49 -429 -715 C ATOM 14515 CD2 PHE N 22 135.191 302.411 200.327 1.00 34.75 C ANISOU14515 CD2 PHE N 22 3735 3967 5500 0 -480 -751 C ATOM 14516 CE1 PHE N 22 133.883 304.314 198.738 1.00 36.38 C ANISOU14516 CE1 PHE N 22 3977 4250 5597 -44 -394 -744 C ATOM 14517 CE2 PHE N 22 134.615 302.027 199.098 1.00 37.68 C ANISOU14517 CE2 PHE N 22 4096 4353 5869 6 -445 -782 C ATOM 14518 CZ PHE N 22 133.956 302.984 198.294 1.00 32.73 C ANISOU14518 CZ PHE N 22 3486 3766 5184 -17 -401 -778 C ATOM 14519 N GLY N 23 136.858 306.906 201.385 1.00 30.68 N ANISOU14519 N GLY N 23 3247 3534 4875 -83 -461 -684 N ATOM 14520 CA GLY N 23 136.880 308.067 200.507 1.00 31.04 C ANISOU14520 CA GLY N 23 3290 3617 4886 -105 -421 -687 C ATOM 14521 C GLY N 23 138.285 308.499 200.161 1.00 42.56 C ANISOU14521 C GLY N 23 4705 5091 6375 -108 -419 -707 C ATOM 14522 O GLY N 23 138.544 308.939 199.037 1.00 35.06 O ANISOU14522 O GLY N 23 3732 4169 5421 -116 -384 -730 O ATOM 14523 N ALA N 24 139.213 308.402 201.133 1.00 33.50 N ANISOU14523 N ALA N 24 3546 3926 5256 -104 -457 -698 N ATOM 14524 CA ALA N 24 140.612 308.753 200.878 1.00 36.79 C ANISOU14524 CA ALA N 24 3919 4356 5705 -106 -459 -715 C ATOM 14525 C ALA N 24 141.223 307.852 199.807 1.00 42.43 C ANISOU14525 C ALA N 24 4583 5072 6468 -83 -443 -763 C ATOM 14526 O ALA N 24 141.911 308.319 198.888 1.00 38.22 O ANISOU14526 O ALA N 24 4015 4567 5940 -91 -415 -785 O ATOM 14527 CB ALA N 24 141.401 308.644 202.188 1.00 32.99 C ANISOU14527 CB ALA N 24 3436 3852 5247 -103 -507 -696 C ATOM 14528 N TRP N 25 140.991 306.548 199.924 1.00 34.13 N ANISOU14528 N TRP N 25 3525 3989 5454 -55 -461 -780 N ATOM 14529 CA TRP N 25 141.454 305.597 198.904 1.00 31.35 C ANISOU14529 CA TRP N 25 3127 3634 5150 -31 -445 -831 C ATOM 14530 C TRP N 25 140.830 305.927 197.554 1.00 40.75 C ANISOU14530 C TRP N 25 4316 4858 6308 -41 -394 -854 C ATOM 14531 O TRP N 25 141.524 305.949 196.526 1.00 35.16 O ANISOU14531 O TRP N 25 3568 4174 5618 -39 -366 -891 O ATOM 14532 CB TRP N 25 141.099 304.149 199.322 1.00 36.76 C ANISOU14532 CB TRP N 25 3813 4275 5878 -1 -476 -842 C ATOM 14533 CG TRP N 25 141.837 303.101 198.540 1.00 40.01 C ANISOU14533 CG TRP N 25 4174 4674 6352 27 -472 -896 C ATOM 14534 CD1 TRP N 25 143.151 302.644 198.790 1.00 37.38 C ANISOU14534 CD1 TRP N 25 3799 4327 6078 43 -497 -914 C ATOM 14535 CD2 TRP N 25 141.376 302.366 197.386 1.00 37.34 C ANISOU14535 CD2 TRP N 25 3821 4340 6028 42 -442 -941 C ATOM 14536 NE1 TRP N 25 143.516 301.719 197.817 1.00 43.64 N ANISOU14536 NE1 TRP N 25 4551 5113 6916 66 -481 -969 N ATOM 14537 CE2 TRP N 25 142.460 301.526 196.956 1.00 35.64 C ANISOU14537 CE2 TRP N 25 3553 4111 5877 66 -448 -989 C ATOM 14538 CE3 TRP N 25 140.161 302.344 196.649 1.00 32.34 C ANISOU14538 CE3 TRP N 25 3211 3721 5356 37 -410 -948 C ATOM 14539 CZ2 TRP N 25 142.347 300.650 195.856 1.00 39.99 C ANISOU14539 CZ2 TRP N 25 4077 4660 6457 85 -424 -1046 C ATOM 14540 CZ3 TRP N 25 140.063 301.472 195.523 1.00 43.83 C ANISOU14540 CZ3 TRP N 25 4637 5177 6840 56 -386 -1004 C ATOM 14541 CH2 TRP N 25 141.151 300.639 195.152 1.00 41.63 C ANISOU14541 CH2 TRP N 25 4309 4883 6627 80 -394 -1054 C ATOM 14542 N ALA N 26 139.516 306.190 197.543 1.00 34.88 N ANISOU14542 N ALA N 26 3617 4119 5517 -52 -380 -832 N ATOM 14543 CA ALA N 26 138.820 306.499 196.289 1.00 30.87 C ANISOU14543 CA ALA N 26 3111 3642 4975 -62 -333 -850 C ATOM 14544 C ALA N 26 139.382 307.756 195.650 1.00 39.74 C ANISOU14544 C ALA N 26 4220 4807 6073 -88 -304 -848 C ATOM 14545 O ALA N 26 139.467 307.849 194.413 1.00 39.83 O ANISOU14545 O ALA N 26 4206 4847 6078 -91 -266 -880 O ATOM 14546 CB ALA N 26 137.312 306.716 196.533 1.00 31.30 C ANISOU14546 CB ALA N 26 3219 3696 4979 -73 -327 -817 C ATOM 14547 N GLY N 27 139.716 308.741 196.473 1.00 32.16 N ANISOU14547 N GLY N 27 3277 3850 5093 -108 -320 -810 N ATOM 14548 CA GLY N 27 140.327 309.958 195.976 1.00 36.13 C ANISOU14548 CA GLY N 27 3764 4387 5575 -134 -297 -803 C ATOM 14549 C GLY N 27 141.602 309.682 195.203 1.00 34.50 C ANISOU14549 C GLY N 27 3500 4198 5411 -125 -285 -842 C ATOM 14550 O GLY N 27 141.921 310.399 194.264 1.00 37.28 O ANISOU14550 O GLY N 27 3831 4586 5746 -142 -252 -851 O ATOM 14551 N MET N 28 142.364 308.661 195.610 1.00 30.36 N ANISOU14551 N MET N 28 2947 3648 4940 -99 -313 -864 N ATOM 14552 CA MET N 28 143.582 308.309 194.869 1.00 43.41 C ANISOU14552 CA MET N 28 4543 5317 6636 -88 -301 -903 C ATOM 14553 C MET N 28 143.227 307.791 193.491 1.00 53.43 C ANISOU14553 C MET N 28 5791 6607 7902 -80 -260 -949 C ATOM 14554 O MET N 28 143.843 308.166 192.494 1.00 32.96 O ANISOU14554 O MET N 28 3164 4052 5307 -89 -228 -970 O ATOM 14555 CB MET N 28 144.394 307.247 195.613 1.00 31.25 C ANISOU14555 CB MET N 28 2976 3740 5156 -60 -341 -917 C ATOM 14556 CG MET N 28 144.829 307.641 197.040 1.00 35.89 C ANISOU14556 CG MET N 28 3581 4306 5748 -67 -386 -875 C ATOM 14557 SD MET N 28 145.900 309.080 196.957 1.00 43.40 S ANISOU14557 SD MET N 28 4511 5297 6682 -99 -375 -854 S ATOM 14558 CE MET N 28 145.060 310.327 197.898 1.00 38.20 C ANISOU14558 CE MET N 28 3913 4638 5964 -131 -387 -798 C ATOM 14559 N VAL N 29 142.238 306.902 193.438 1.00 33.82 N ANISOU14559 N VAL N 29 3329 4101 5421 -62 -263 -963 N ATOM 14560 CA VAL N 29 141.752 306.331 192.181 1.00 36.48 C ANISOU14560 CA VAL N 29 3652 4455 5754 -53 -227 -1009 C ATOM 14561 C VAL N 29 141.284 307.441 191.252 1.00 39.56 C ANISOU14561 C VAL N 29 4052 4892 6086 -83 -184 -999 C ATOM 14562 O VAL N 29 141.628 307.492 190.050 1.00 34.64 O ANISOU14562 O VAL N 29 3398 4306 5458 -87 -148 -1034 O ATOM 14563 CB VAL N 29 140.629 305.320 192.485 1.00 33.60 C ANISOU14563 CB VAL N 29 3316 4055 5396 -33 -242 -1014 C ATOM 14564 CG1 VAL N 29 140.026 304.728 191.166 1.00 36.29 C ANISOU14564 CG1 VAL N 29 3645 4414 5729 -26 -205 -1063 C ATOM 14565 CG2 VAL N 29 141.133 304.223 193.379 1.00 38.16 C ANISOU14565 CG2 VAL N 29 3881 4584 6034 -5 -286 -1022 C ATOM 14566 N GLY N 30 140.537 308.384 191.817 1.00 36.48 N ANISOU14566 N GLY N 30 3706 4502 5651 -105 -188 -949 N ATOM 14567 CA GLY N 30 139.935 309.438 191.026 1.00 32.22 C ANISOU14567 CA GLY N 30 3184 4002 5058 -133 -152 -934 C ATOM 14568 C GLY N 30 140.969 310.428 190.541 1.00 44.61 C ANISOU14568 C GLY N 30 4722 5607 6622 -155 -133 -929 C ATOM 14569 O GLY N 30 140.891 310.898 189.408 1.00 34.04 O ANISOU14569 O GLY N 30 3370 4308 5256 -170 -95 -941 O ATOM 14570 N THR N 31 141.967 310.735 191.381 1.00 34.88 N ANISOU14570 N THR N 31 3476 4362 5414 -157 -161 -910 N ATOM 14571 CA THR N 31 143.067 311.617 190.970 1.00 31.60 C ANISOU14571 CA THR N 31 3026 3980 4999 -176 -146 -903 C ATOM 14572 C THR N 31 143.863 310.976 189.844 1.00 40.05 C ANISOU14572 C THR N 31 4044 5079 6096 -163 -119 -953 C ATOM 14573 O THR N 31 144.223 311.624 188.851 1.00 40.35 O ANISOU14573 O THR N 31 4058 5159 6113 -181 -85 -957 O ATOM 14574 CB THR N 31 143.975 311.905 192.172 1.00 42.17 C ANISOU14574 CB THR N 31 4360 5297 6365 -178 -186 -877 C ATOM 14575 OG1 THR N 31 143.228 312.558 193.187 1.00 40.25 O ANISOU14575 OG1 THR N 31 4168 5033 6093 -192 -208 -832 O ATOM 14576 CG2 THR N 31 145.177 312.810 191.826 1.00 34.26 C ANISOU14576 CG2 THR N 31 3321 4328 5369 -199 -174 -867 C ATOM 14577 N ALA N 32 144.162 309.695 189.991 1.00 30.27 N ANISOU14577 N ALA N 32 2785 3815 4903 -131 -135 -990 N ATOM 14578 CA ALA N 32 144.945 309.030 188.956 1.00 39.65 C ANISOU14578 CA ALA N 32 3922 5027 6116 -117 -111 -1041 C ATOM 14579 C ALA N 32 144.187 309.064 187.627 1.00 47.83 C ANISOU14579 C ALA N 32 4961 6100 7113 -125 -66 -1066 C ATOM 14580 O ALA N 32 144.781 309.359 186.582 1.00 36.29 O ANISOU14580 O ALA N 32 3464 4683 5640 -134 -32 -1084 O ATOM 14581 CB ALA N 32 145.269 307.598 189.376 1.00 30.76 C ANISOU14581 CB ALA N 32 2778 3861 5048 -80 -139 -1078 C ATOM 14582 N LEU N 33 142.861 308.846 187.666 1.00 37.63 N ANISOU14582 N LEU N 33 3710 4793 5795 -124 -65 -1063 N ATOM 14583 CA LEU N 33 142.061 308.905 186.439 1.00 42.85 C ANISOU14583 CA LEU N 33 4377 5490 6415 -134 -25 -1085 C ATOM 14584 C LEU N 33 142.116 310.301 185.824 1.00 42.98 C ANISOU14584 C LEU N 33 4395 5552 6382 -168 5 -1052 C ATOM 14585 O LEU N 33 142.285 310.433 184.615 1.00 38.00 O ANISOU14585 O LEU N 33 3741 4967 5731 -177 42 -1075 O ATOM 14586 CB LEU N 33 140.604 308.461 186.718 1.00 34.80 C ANISOU14586 CB LEU N 33 3403 4442 5376 -127 -34 -1081 C ATOM 14587 CG LEU N 33 140.445 306.967 187.047 1.00 34.08 C ANISOU14587 CG LEU N 33 3307 4310 5333 -93 -57 -1121 C ATOM 14588 CD1 LEU N 33 139.131 306.667 187.754 1.00 33.77 C ANISOU14588 CD1 LEU N 33 3316 4235 5281 -87 -77 -1097 C ATOM 14589 CD2 LEU N 33 140.546 306.070 185.722 1.00 29.26 C ANISOU14589 CD2 LEU N 33 2663 3724 4731 -80 -27 -1190 C ATOM 14590 N SER N 34 142.068 311.353 186.655 1.00 37.81 N ANISOU14590 N SER N 34 3766 4887 5713 -189 -13 -997 N ATOM 14591 CA SER N 34 142.130 312.717 186.149 1.00 36.81 C ANISOU14591 CA SER N 34 3641 4798 5546 -222 11 -962 C ATOM 14592 C SER N 34 143.495 313.013 185.531 1.00 39.58 C ANISOU14592 C SER N 34 3940 5185 5913 -228 29 -972 C ATOM 14593 O SER N 34 143.589 313.768 184.555 1.00 41.63 O ANISOU14593 O SER N 34 4188 5491 6141 -250 63 -963 O ATOM 14594 CB SER N 34 141.843 313.711 187.302 1.00 37.20 C ANISOU14594 CB SER N 34 3729 4821 5583 -240 -16 -905 C ATOM 14595 OG SER N 34 143.016 313.850 188.085 1.00 39.13 O ANISOU14595 OG SER N 34 3951 5052 5864 -239 -43 -894 O ATOM 14596 N LEU N 35 144.554 312.415 186.066 1.00 37.07 N ANISOU14596 N LEU N 35 3591 4850 5644 -210 7 -988 N ATOM 14597 CA LEU N 35 145.885 312.632 185.496 1.00 35.12 C ANISOU14597 CA LEU N 35 3291 4638 5414 -214 23 -997 C ATOM 14598 C LEU N 35 146.022 311.936 184.155 1.00 43.45 C ANISOU14598 C LEU N 35 4314 5732 6464 -202 61 -1047 C ATOM 14599 O LEU N 35 146.603 312.510 183.229 1.00 37.54 O ANISOU14599 O LEU N 35 3535 5031 5696 -217 93 -1043 O ATOM 14600 CB LEU N 35 146.947 312.158 186.481 1.00 38.71 C ANISOU14600 CB LEU N 35 3722 5062 5924 -196 -13 -1000 C ATOM 14601 CG LEU N 35 147.021 313.190 187.608 1.00 41.93 C ANISOU14601 CG LEU N 35 4156 5449 6328 -217 -43 -945 C ATOM 14602 CD1 LEU N 35 147.845 312.600 188.806 1.00 50.02 C ANISOU14602 CD1 LEU N 35 5167 6434 7404 -197 -88 -945 C ATOM 14603 CD2 LEU N 35 147.634 314.564 187.168 1.00 51.65 C ANISOU14603 CD2 LEU N 35 5370 6720 7536 -252 -23 -909 C ATOM 14604 N LEU N 36 145.460 310.723 184.021 1.00 42.06 N ANISOU14604 N LEU N 36 4145 5535 6301 -175 58 -1092 N ATOM 14605 CA LEU N 36 145.435 310.066 182.726 1.00 41.34 C ANISOU14605 CA LEU N 36 4029 5481 6198 -166 93 -1142 C ATOM 14606 C LEU N 36 144.686 310.914 181.715 1.00 46.64 C ANISOU14606 C LEU N 36 4717 6197 6806 -194 130 -1125 C ATOM 14607 O LEU N 36 145.157 311.101 180.585 1.00 39.18 O ANISOU14607 O LEU N 36 3742 5304 5840 -201 166 -1139 O ATOM 14608 CB LEU N 36 144.822 308.674 182.845 1.00 39.10 C ANISOU14608 CB LEU N 36 3756 5161 5940 -136 79 -1191 C ATOM 14609 CG LEU N 36 145.790 307.703 183.484 1.00 41.81 C ANISOU14609 CG LEU N 36 4068 5470 6349 -105 50 -1217 C ATOM 14610 CD1 LEU N 36 145.097 306.545 184.132 1.00 34.74 C ANISOU14610 CD1 LEU N 36 3195 4520 5486 -79 19 -1243 C ATOM 14611 CD2 LEU N 36 146.804 307.162 182.371 1.00 32.16 C ANISOU14611 CD2 LEU N 36 2791 4288 5139 -93 80 -1265 C ATOM 14612 N ILE N 37 143.563 311.512 182.131 1.00 37.50 N ANISOU14612 N ILE N 37 3608 5024 5618 -210 122 -1090 N ATOM 14613 CA ILE N 37 142.808 312.391 181.245 1.00 42.23 C ANISOU14613 CA ILE N 37 4225 5662 6157 -237 154 -1068 C ATOM 14614 C ILE N 37 143.705 313.501 180.723 1.00 42.27 C ANISOU14614 C ILE N 37 4202 5711 6147 -262 176 -1035 C ATOM 14615 O ILE N 37 143.823 313.710 179.505 1.00 37.35 O ANISOU14615 O ILE N 37 3560 5140 5493 -272 213 -1045 O ATOM 14616 CB ILE N 37 141.576 312.992 181.966 1.00 39.62 C ANISOU14616 CB ILE N 37 3950 5302 5802 -251 137 -1026 C ATOM 14617 CG1 ILE N 37 140.500 311.943 182.280 1.00 31.10 C ANISOU14617 CG1 ILE N 37 2900 4188 4728 -230 122 -1054 C ATOM 14618 CG2 ILE N 37 141.038 314.131 181.136 1.00 29.07 C ANISOU14618 CG2 ILE N 37 2627 4007 4410 -282 167 -992 C ATOM 14619 CD1 ILE N 37 139.320 312.507 183.213 1.00 31.56 C ANISOU14619 CD1 ILE N 37 3014 4211 4766 -240 100 -1007 C ATOM 14620 N ARG N 38 144.394 314.207 181.636 1.00 38.77 N ANISOU14620 N ARG N 38 3755 5248 5728 -271 152 -996 N ATOM 14621 CA ARG N 38 145.178 315.382 181.269 1.00 61.41 C ANISOU14621 CA ARG N 38 6599 8150 8582 -299 169 -957 C ATOM 14622 C ARG N 38 146.486 315.008 180.584 1.00 59.86 C ANISOU14622 C ARG N 38 6346 7991 8409 -289 188 -985 C ATOM 14623 O ARG N 38 147.034 315.825 179.823 1.00 37.20 O ANISOU14623 O ARG N 38 3451 5166 5519 -310 215 -962 O ATOM 14624 CB ARG N 38 145.423 316.278 182.508 1.00 42.44 C ANISOU14624 CB ARG N 38 4215 5714 6197 -314 135 -907 C ATOM 14625 CG ARG N 38 144.139 317.017 182.919 1.00 35.17 C ANISOU14625 CG ARG N 38 3349 4772 5241 -332 126 -870 C ATOM 14626 CD ARG N 38 144.105 318.517 182.522 1.00 36.92 C ANISOU14626 CD ARG N 38 3577 5021 5430 -369 142 -818 C ATOM 14627 NE ARG N 38 144.441 318.832 181.102 1.00 44.02 N ANISOU14627 NE ARG N 38 4444 5978 6303 -382 185 -821 N ATOM 14628 CZ ARG N 38 143.617 319.227 180.126 1.00 44.66 C ANISOU14628 CZ ARG N 38 4540 6091 6338 -395 214 -812 C ATOM 14629 NH1 ARG N 38 142.275 319.284 180.268 1.00 30.60 N ANISOU14629 NH1 ARG N 38 2806 4292 4529 -397 210 -804 N ATOM 14630 NH2 ARG N 38 144.176 319.579 178.953 1.00 43.30 N ANISOU14630 NH2 ARG N 38 4332 5972 6147 -407 250 -809 N ATOM 14631 N ALA N 39 146.978 313.788 180.798 1.00 31.09 N ANISOU14631 N ALA N 39 2679 4329 4806 -257 176 -1032 N ATOM 14632 CA ALA N 39 148.138 313.337 180.020 1.00 43.34 C ANISOU14632 CA ALA N 39 4175 5918 6375 -245 199 -1064 C ATOM 14633 C ALA N 39 147.756 313.114 178.560 1.00 37.74 C ANISOU14633 C ALA N 39 3457 5259 5622 -247 243 -1093 C ATOM 14634 O ALA N 39 148.534 313.447 177.653 1.00 40.58 O ANISOU14634 O ALA N 39 3779 5670 5970 -255 274 -1091 O ATOM 14635 CB ALA N 39 148.704 312.045 180.573 1.00 32.27 C ANISOU14635 CB ALA N 39 2752 4482 5029 -209 175 -1109 C ATOM 14636 N GLU N 40 146.584 312.538 178.325 1.00 37.40 N ANISOU14636 N GLU N 40 3448 5206 5557 -239 245 -1118 N ATOM 14637 CA GLU N 40 146.098 312.367 176.964 1.00 36.84 C ANISOU14637 CA GLU N 40 3374 5183 5439 -244 283 -1144 C ATOM 14638 C GLU N 40 145.978 313.703 176.252 1.00 44.29 C ANISOU14638 C GLU N 40 4321 6173 6332 -278 311 -1094 C ATOM 14639 O GLU N 40 146.249 313.794 175.050 1.00 40.64 O ANISOU14639 O GLU N 40 3835 5766 5839 -284 347 -1104 O ATOM 14640 CB GLU N 40 144.761 311.605 176.964 1.00 35.86 C ANISOU14640 CB GLU N 40 3289 5035 5299 -233 275 -1174 C ATOM 14641 CG GLU N 40 144.085 311.481 175.583 1.00 37.82 C ANISOU14641 CG GLU N 40 3542 5334 5492 -241 311 -1198 C ATOM 14642 CD GLU N 40 144.920 310.642 174.563 1.00 53.57 C ANISOU14642 CD GLU N 40 5491 7369 7493 -223 337 -1252 C ATOM 14643 OE1 GLU N 40 145.329 311.184 173.507 1.00 43.57 O ANISOU14643 OE1 GLU N 40 4202 6161 6190 -238 371 -1242 O ATOM 14644 OE2 GLU N 40 145.213 309.468 174.817 1.00 49.37 O ANISOU14644 OE2 GLU N 40 4945 6810 7004 -194 322 -1302 O ATOM 14645 N LEU N 41 145.548 314.743 176.961 1.00 36.17 N ANISOU14645 N LEU N 41 3324 5123 5296 -301 294 -1039 N ATOM 14646 CA LEU N 41 145.313 316.059 176.361 1.00 37.10 C ANISOU14646 CA LEU N 41 3450 5277 5369 -335 317 -986 C ATOM 14647 C LEU N 41 146.536 316.977 176.431 1.00 44.60 C ANISOU14647 C LEU N 41 4364 6245 6336 -352 321 -947 C ATOM 14648 O LEU N 41 146.484 318.101 175.930 1.00 36.97 O ANISOU14648 O LEU N 41 3399 5308 5339 -380 339 -901 O ATOM 14649 CB LEU N 41 144.129 316.752 177.060 1.00 34.38 C ANISOU14649 CB LEU N 41 3160 4898 5006 -351 297 -946 C ATOM 14650 CG LEU N 41 142.788 316.004 176.911 1.00 36.96 C ANISOU14650 CG LEU N 41 3524 5211 5308 -339 295 -977 C ATOM 14651 CD1 LEU N 41 141.694 316.780 177.611 1.00 36.48 C ANISOU14651 CD1 LEU N 41 3513 5118 5229 -356 277 -932 C ATOM 14652 CD2 LEU N 41 142.452 315.884 175.402 1.00 36.35 C ANISOU14652 CD2 LEU N 41 3436 5192 5182 -346 335 -997 C ATOM 14653 N GLY N 42 147.613 316.545 177.081 1.00 34.45 N ATOM 14654 CA GLY N 42 148.756 317.415 177.404 1.00 34.58 C ATOM 14655 C GLY N 42 149.617 317.784 176.191 1.00 40.26 C ATOM 14656 O GLY N 42 150.433 318.705 176.277 1.00 45.88 O