>>3AG2:HELIX   38 AE2 ASP C  190  LYS C  224  1                                  35    
DGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 38 AE2 ASP C 190 LYS C 224 1 35 ATOM 7400 N ASP C 190 78.934 333.443 175.886 1.00 29.42 N ANISOU 7400 N ASP C 190 3931 3401 3847 -247 74 518 N ATOM 7401 CA ASP C 190 79.734 332.810 174.838 1.00 27.46 C ANISOU 7401 CA ASP C 190 3674 3198 3563 -265 81 526 C ATOM 7402 C ASP C 190 79.643 331.280 174.906 1.00 28.03 C ANISOU 7402 C ASP C 190 3750 3312 3589 -263 72 487 C ATOM 7403 O ASP C 190 80.628 330.547 175.062 1.00 30.48 O ANISOU 7403 O ASP C 190 4059 3635 3889 -274 74 453 O ATOM 7404 CB ASP C 190 81.168 333.323 174.875 1.00 30.33 C ANISOU 7404 CB ASP C 190 4030 3540 3953 -285 94 521 C ATOM 7405 CG ASP C 190 81.272 334.710 174.284 1.00 37.78 C ANISOU 7405 CG ASP C 190 4967 4458 4930 -291 106 574 C ATOM 7406 OD1 ASP C 190 80.336 335.129 173.618 1.00 33.11 O ANISOU 7406 OD1 ASP C 190 4374 3876 4332 -281 106 617 O ATOM 7407 OD2 ASP C 190 82.247 335.431 174.483 1.00 33.65 O ANISOU 7407 OD2 ASP C 190 4439 3904 4443 -306 116 574 O ATOM 7408 N GLY C 191 78.434 330.806 174.644 1.00 29.70 N ANISOU 7408 N GLY C 191 3963 3549 3772 -250 62 496 N ATOM 7409 CA GLY C 191 78.141 329.403 174.654 1.00 26.32 C ANISOU 7409 CA GLY C 191 3539 3158 3302 -247 53 463 C ATOM 7410 C GLY C 191 78.533 328.716 175.969 1.00 26.26 C ANISOU 7410 C GLY C 191 3542 3130 3307 -244 46 408 C ATOM 7411 O GLY C 191 78.638 329.311 177.045 1.00 28.32 O ANISOU 7411 O GLY C 191 3808 3347 3606 -239 44 392 O ATOM 7412 N VAL C 192 78.739 327.410 175.858 1.00 26.59 N ANISOU 7412 N VAL C 192 3585 3204 3314 -248 42 377 N ATOM 7413 CA VAL C 192 78.968 326.616 177.051 1.00 28.07 C ANISOU 7413 CA VAL C 192 3781 3377 3506 -243 34 328 C ATOM 7414 C VAL C 192 80.356 326.867 177.619 1.00 39.46 C ANISOU 7414 C VAL C 192 5222 4796 4977 -253 41 306 C ATOM 7415 O VAL C 192 80.595 326.646 178.818 1.00 29.17 O ANISOU 7415 O VAL C 192 3925 3468 3691 -248 34 271 O ATOM 7416 CB VAL C 192 78.671 325.158 176.635 1.00 31.99 C ANISOU 7416 CB VAL C 192 4280 3916 3959 -243 28 308 C ATOM 7417 CG1 VAL C 192 79.823 324.522 175.791 1.00 31.49 C ANISOU 7417 CG1 VAL C 192 4208 3883 3873 -259 38 299 C ATOM 7418 CG2 VAL C 192 78.262 324.339 177.771 1.00 34.71 C ANISOU 7418 CG2 VAL C 192 4635 4249 4303 -233 17 270 C ATOM 7419 N TYR C 193 81.300 327.333 176.801 1.00 31.52 N ANISOU 7419 N TYR C 193 4205 3797 3973 -268 53 326 N ATOM 7420 CA TYR C 193 82.597 327.703 177.397 1.00 23.61 C ANISOU 7420 CA TYR C 193 3199 2769 3002 -279 59 306 C ATOM 7421 C TYR C 193 82.420 328.841 178.380 1.00 28.73 C ANISOU 7421 C TYR C 193 3853 3368 3697 -274 57 308 C ATOM 7422 O TYR C 193 82.867 328.770 179.536 1.00 28.63 O ANISOU 7422 O TYR C 193 3843 3329 3704 -272 52 272 O ATOM 7423 CB TYR C 193 83.605 328.106 176.283 1.00 25.70 C ANISOU 7423 CB TYR C 193 3450 3052 3264 -297 75 332 C ATOM 7424 CG TYR C 193 84.956 328.448 176.876 1.00 28.53 C ANISOU 7424 CG TYR C 193 3801 3385 3652 -309 81 311 C ATOM 7425 CD1 TYR C 193 85.242 329.727 177.336 1.00 28.34 C ANISOU 7425 CD1 TYR C 193 3776 3319 3674 -315 86 324 C ATOM 7426 CD2 TYR C 193 85.956 327.471 176.974 1.00 27.60 C ANISOU 7426 CD2 TYR C 193 3679 3289 3520 -316 83 277 C ATOM 7427 CE1 TYR C 193 86.486 330.011 177.918 1.00 32.98 C ANISOU 7427 CE1 TYR C 193 4356 3886 4289 -328 90 301 C ATOM 7428 CE2 TYR C 193 87.225 327.756 177.550 1.00 35.33 C ANISOU 7428 CE2 TYR C 193 4650 4249 4526 -327 87 257 C ATOM 7429 CZ TYR C 193 87.459 329.020 178.021 1.00 44.44 C ANISOU 7429 CZ TYR C 193 5801 5361 5722 -334 90 269 C ATOM 7430 OH TYR C 193 88.676 329.311 178.599 1.00 39.51 O ANISOU 7430 OH TYR C 193 5168 4720 5125 -346 94 247 O ATOM 7431 N GLY C 194 81.776 329.913 177.939 1.00 26.75 N ANISOU 7431 N GLY C 194 3600 3100 3462 -271 61 348 N ATOM 7432 CA GLY C 194 81.552 331.041 178.831 1.00 27.36 C ANISOU 7432 CA GLY C 194 3682 3127 3585 -265 60 349 C ATOM 7433 C GLY C 194 80.627 330.653 179.985 1.00 34.55 C ANISOU 7433 C GLY C 194 4605 4026 4498 -247 46 319 C ATOM 7434 O GLY C 194 80.808 331.119 181.105 1.00 29.46 O ANISOU 7434 O GLY C 194 3965 3344 3885 -244 43 294 O ATOM 7435 N SER C 195 79.625 329.805 179.717 1.00 27.37 N ANISOU 7435 N SER C 195 3700 3147 3553 -235 38 321 N ATOM 7436 CA SER C 195 78.686 329.381 180.778 1.00 30.58 C ANISOU 7436 CA SER C 195 4116 3544 3958 -218 26 295 C ATOM 7437 C SER C 195 79.433 328.677 181.914 1.00 29.46 C ANISOU 7437 C SER C 195 3980 3395 3820 -220 20 245 C ATOM 7438 O SER C 195 79.314 329.027 183.113 1.00 27.27 O ANISOU 7438 O SER C 195 3708 3088 3567 -213 14 221 O ATOM 7439 CB SER C 195 77.617 328.428 180.190 1.00 22.96 C ANISOU 7439 CB SER C 195 3153 2619 2951 -210 19 304 C ATOM 7440 OG SER C 195 76.837 329.029 179.115 1.00 29.55 O ANISOU 7440 OG SER C 195 3982 3467 3779 -206 22 352 O ATOM 7441 N THR C 196 80.158 327.623 181.559 1.00 29.00 N ANISOU 7441 N THR C 196 3918 3367 3733 -229 20 229 N ATOM 7442 CA THR C 196 80.836 326.867 182.589 1.00 33.53 C ANISOU 7442 CA THR C 196 4495 3937 4307 -229 13 185 C ATOM 7443 C THR C 196 81.911 327.705 183.253 1.00 31.17 C ANISOU 7443 C THR C 196 4192 3606 4046 -239 17 171 C ATOM 7444 O THR C 196 82.068 327.653 184.481 1.00 30.27 O ANISOU 7444 O THR C 196 4082 3473 3945 -234 10 139 O ATOM 7445 CB THR C 196 81.457 325.635 181.994 1.00 26.80 C ANISOU 7445 CB THR C 196 3639 3121 3422 -237 14 173 C ATOM 7446 OG1 THR C 196 82.352 326.008 180.920 1.00 32.91 O ANISOU 7446 OG1 THR C 196 4402 3906 4196 -252 27 194 O ATOM 7447 CG2 THR C 196 80.402 324.664 181.555 1.00 27.77 C ANISOU 7447 CG2 THR C 196 3768 3274 3510 -228 8 177 C ATOM 7448 N PHE C 197 82.661 328.492 182.467 1.00 28.96 N ANISOU 7448 N PHE C 197 3902 3320 3781 -253 29 195 N ATOM 7449 CA PHE C 197 83.733 329.303 183.040 1.00 28.95 C ANISOU 7449 CA PHE C 197 3895 3289 3816 -265 34 182 C ATOM 7450 C PHE C 197 83.199 330.229 184.124 1.00 31.42 C ANISOU 7450 C PHE C 197 4215 3560 4163 -257 29 172 C ATOM 7451 O PHE C 197 83.663 330.208 185.277 1.00 29.93 O ANISOU 7451 O PHE C 197 4028 3355 3990 -257 23 135 O ATOM 7452 CB PHE C 197 84.445 330.124 181.956 1.00 29.78 C ANISOU 7452 CB PHE C 197 3989 3393 3935 -282 49 216 C ATOM 7453 CG PHE C 197 85.573 330.941 182.515 1.00 30.06 C ANISOU 7453 CG PHE C 197 4017 3397 4008 -297 54 202 C ATOM 7454 CD1 PHE C 197 85.327 332.193 183.058 1.00 29.30 C ANISOU 7454 CD1 PHE C 197 3923 3256 3954 -297 56 207 C ATOM 7455 CD2 PHE C 197 86.871 330.435 182.519 1.00 34.08 C ANISOU 7455 CD2 PHE C 197 4515 3921 4512 -311 57 181 C ATOM 7456 CE1 PHE C 197 86.350 332.956 183.589 1.00 31.82 C ANISOU 7456 CE1 PHE C 197 4234 3546 4310 -313 60 192 C ATOM 7457 CE2 PHE C 197 87.923 331.205 183.054 1.00 36.49 C ANISOU 7457 CE2 PHE C 197 4811 4199 4854 -326 60 167 C ATOM 7458 CZ PHE C 197 87.662 332.457 183.577 1.00 35.27 C ANISOU 7458 CZ PHE C 197 4660 4000 4740 -328 62 172 C ATOM 7459 N PHE C 198 82.250 331.091 183.754 1.00 27.56 N ANISOU 7459 N PHE C 198 3729 3054 3689 -249 33 204 N ATOM 7460 CA PHE C 198 81.803 332.128 184.664 1.00 33.24 C ANISOU 7460 CA PHE C 198 4454 3731 4446 -241 32 196 C ATOM 7461 C PHE C 198 80.900 331.604 185.768 1.00 28.73 C ANISOU 7461 C PHE C 198 3892 3158 3864 -223 19 167 C ATOM 7462 O PHE C 198 80.970 332.130 186.879 1.00 29.94 O ANISOU 7462 O PHE C 198 4049 3282 4044 -220 16 140 O ATOM 7463 CB PHE C 198 81.123 333.252 183.887 1.00 33.24 C ANISOU 7463 CB PHE C 198 4452 3710 4467 -238 41 242 C ATOM 7464 CG PHE C 198 82.109 334.094 183.150 1.00 34.40 C ANISOU 7464 CG PHE C 198 4589 3843 4639 -258 54 267 C ATOM 7465 CD1 PHE C 198 83.048 334.851 183.865 1.00 37.35 C ANISOU 7465 CD1 PHE C 198 4960 4181 5052 -271 58 244 C ATOM 7466 CD2 PHE C 198 82.192 334.050 181.767 1.00 27.33 C ANISOU 7466 CD2 PHE C 198 3687 2974 3725 -265 63 309 C ATOM 7467 CE1 PHE C 198 84.015 335.629 183.213 1.00 35.71 C ANISOU 7467 CE1 PHE C 198 4741 3958 4869 -292 70 266 C ATOM 7468 CE2 PHE C 198 83.199 334.807 181.099 1.00 26.56 C ANISOU 7468 CE2 PHE C 198 3578 2864 3648 -286 76 332 C ATOM 7469 CZ PHE C 198 84.104 335.598 181.827 1.00 28.32 C ANISOU 7469 CZ PHE C 198 3797 3048 3914 -299 80 311 C ATOM 7470 N VAL C 199 80.067 330.596 185.524 1.00 26.67 N ANISOU 7470 N VAL C 199 3636 2930 3567 -211 12 170 N ATOM 7471 CA VAL C 199 79.225 330.132 186.649 1.00 28.56 C ANISOU 7471 CA VAL C 199 3885 3169 3798 -195 1 143 C ATOM 7472 C VAL C 199 80.069 329.386 187.684 1.00 27.41 C ANISOU 7472 C VAL C 199 3740 3028 3646 -199 -7 98 C ATOM 7473 O VAL C 199 79.874 329.571 188.883 1.00 27.04 O ANISOU 7473 O VAL C 199 3698 2964 3612 -192 -13 70 O ATOM 7474 CB VAL C 199 78.063 329.271 186.123 1.00 32.13 C ANISOU 7474 CB VAL C 199 4340 3652 4214 -183 -4 159 C ATOM 7475 CG1 VAL C 199 77.352 328.571 187.247 1.00 31.99 C ANISOU 7475 CG1 VAL C 199 4331 3640 4184 -169 -15 129 C ATOM 7476 CG2 VAL C 199 77.068 330.194 185.341 1.00 27.05 C ANISOU 7476 CG2 VAL C 199 3696 3000 3583 -175 2 202 C ATOM 7477 N ALA C 200 80.986 328.506 187.247 1.00 30.22 N ANISOU 7477 N ALA C 200 4091 3409 3980 -210 -7 92 N ATOM 7478 CA ALA C 200 81.860 327.797 188.193 1.00 28.87 C ANISOU 7478 CA ALA C 200 3920 3245 3805 -214 -14 53 C ATOM 7479 C ALA C 200 82.816 328.746 188.917 1.00 33.54 C ANISOU 7479 C ALA C 200 4506 3806 4432 -224 -12 34 C ATOM 7480 O ALA C 200 82.909 328.718 190.156 1.00 31.72 O ANISOU 7480 O ALA C 200 4278 3566 4209 -220 -20 1 O ATOM 7481 CB ALA C 200 82.654 326.691 187.497 1.00 25.63 C ANISOU 7481 CB ALA C 200 3504 2867 3368 -222 -13 51 C ATOM 7482 N THR C 201 83.573 329.578 188.166 1.00 30.96 N ANISOU 7482 N THR C 201 4170 3467 4128 -240 -1 52 N ATOM 7483 CA THR C 201 84.484 330.481 188.882 1.00 28.57 C ANISOU 7483 CA THR C 201 3860 3134 3860 -252 1 32 C ATOM 7484 C THR C 201 83.708 331.551 189.601 1.00 30.13 C ANISOU 7484 C THR C 201 4066 3295 4088 -244 0 27 C ATOM 7485 O THR C 201 84.227 332.162 190.547 1.00 30.62 O ANISOU 7485 O THR C 201 4125 3333 4176 -250 -2 -2 O ATOM 7486 CB THR C 201 85.514 331.162 187.943 1.00 28.47 C ANISOU 7486 CB THR C 201 3836 3114 3868 -273 13 53 C ATOM 7487 OG1 THR C 201 84.863 332.094 187.028 1.00 31.52 O ANISOU 7487 OG1 THR C 201 4224 3483 4270 -273 24 95 O ATOM 7488 CG2 THR C 201 86.327 330.095 187.170 1.00 30.96 C ANISOU 7488 CG2 THR C 201 4143 3468 4152 -280 15 56 C ATOM 7489 N GLY C 202 82.489 331.845 189.132 1.00 26.28 N ANISOU 7489 N GLY C 202 3584 2802 3598 -230 3 55 N ATOM 7490 CA GLY C 202 81.737 332.900 189.777 1.00 24.67 C ANISOU 7490 CA GLY C 202 3386 2562 3426 -221 5 51 C ATOM 7491 C GLY C 202 81.216 332.410 191.120 1.00 30.98 C ANISOU 7491 C GLY C 202 4193 3365 4213 -206 -7 13 C ATOM 7492 O GLY C 202 81.279 333.135 192.115 1.00 31.29 O ANISOU 7492 O GLY C 202 4233 3377 4280 -206 -8 -14 O ATOM 7493 N PHE C 203 80.700 331.173 191.165 1.00 27.42 N ANISOU 7493 N PHE C 203 3746 2949 3723 -196 -15 10 N ATOM 7494 CA PHE C 203 80.305 330.659 192.495 1.00 30.68 C ANISOU 7494 CA PHE C 203 4165 3369 4124 -184 -26 -25 C ATOM 7495 C PHE C 203 81.516 330.508 193.387 1.00 31.73 C ANISOU 7495 C PHE C 203 4293 3502 4262 -196 -32 -63 C ATOM 7496 O PHE C 203 81.436 330.708 194.602 1.00 29.00 O ANISOU 7496 O PHE C 203 3949 3146 3922 -191 -38 -95 O ATOM 7497 CB PHE C 203 79.577 329.323 192.401 1.00 27.42 C ANISOU 7497 CB PHE C 203 3758 2992 3669 -172 -34 -21 C ATOM 7498 CG PHE C 203 78.083 329.490 192.251 1.00 30.25 C ANISOU 7498 CG PHE C 203 4121 3349 4022 -155 -33 -2 C ATOM 7499 CD1 PHE C 203 77.322 329.987 193.315 1.00 36.91 C ANISOU 7499 CD1 PHE C 203 4969 4175 4878 -142 -35 -21 C ATOM 7500 CD2 PHE C 203 77.444 329.181 191.063 1.00 32.73 C ANISOU 7500 CD2 PHE C 203 4436 3681 4320 -152 -29 35 C ATOM 7501 CE1 PHE C 203 75.960 330.188 193.208 1.00 28.59 C ANISOU 7501 CE1 PHE C 203 3919 3121 3821 -125 -34 -3 C ATOM 7502 CE2 PHE C 203 76.060 329.384 190.951 1.00 32.14 C ANISOU 7502 CE2 PHE C 203 4364 3605 4241 -136 -29 53 C ATOM 7503 CZ PHE C 203 75.326 329.879 192.043 1.00 32.95 C ANISOU 7503 CZ PHE C 203 4471 3691 4359 -122 -31 34 C ATOM 7504 N HIS C 204 82.653 330.104 192.811 1.00 26.05 N ANISOU 7504 N HIS C 204 3565 2796 3536 -211 -31 -59 N ATOM 7505 CA HIS C 204 83.852 330.038 193.643 1.00 30.32 C ANISOU 7505 CA HIS C 204 4099 3337 4084 -222 -37 -94 C ATOM 7506 C HIS C 204 84.195 331.428 194.196 1.00 31.02 C ANISOU 7506 C HIS C 204 4184 3388 4215 -232 -32 -110 C ATOM 7507 O HIS C 204 84.477 331.601 195.393 1.00 32.95 O ANISOU 7507 O HIS C 204 4428 3626 4467 -232 -40 -147 O ATOM 7508 CB HIS C 204 85.038 329.469 192.831 1.00 31.27 C ANISOU 7508 CB HIS C 204 4208 3477 4195 -237 -34 -85 C ATOM 7509 CG HIS C 204 86.295 329.476 193.616 1.00 29.51 C ANISOU 7509 CG HIS C 204 3975 3256 3982 -249 -40 -117 C ATOM 7510 ND1 HIS C 204 87.231 330.491 193.528 1.00 28.77 N ANISOU 7510 ND1 HIS C 204 3871 3140 3922 -268 -33 -122 N ATOM 7511 CD2 HIS C 204 86.697 328.670 194.635 1.00 30.43 C ANISOU 7511 CD2 HIS C 204 4090 3392 4081 -245 -53 -148 C ATOM 7512 CE1 HIS C 204 88.181 330.265 194.427 1.00 29.55 C ANISOU 7512 CE1 HIS C 204 3961 3246 4021 -276 -42 -156 C ATOM 7513 NE2 HIS C 204 87.886 329.158 195.092 1.00 29.76 N ANISOU 7513 NE2 HIS C 204 3992 3299 4015 -261 -54 -171 N ATOM 7514 N GLY C 205 84.128 332.446 193.337 1.00 33.72 N ANISOU 7514 N GLY C 205 4524 3702 4586 -239 -20 -82 N ATOM 7515 CA GLY C 205 84.408 333.820 193.776 1.00 26.96 C ANISOU 7515 CA GLY C 205 3665 2804 3774 -249 -14 -95 C ATOM 7516 C GLY C 205 83.502 334.280 194.917 1.00 31.28 C ANISOU 7516 C GLY C 205 4221 3333 4332 -234 -19 -121 C ATOM 7517 O GLY C 205 83.940 334.951 195.857 1.00 31.42 O ANISOU 7517 O GLY C 205 4236 3330 4374 -241 -21 -156 O ATOM 7518 N LEU C 206 82.217 333.966 194.821 1.00 31.30 N ANISOU 7518 N LEU C 206 4233 3343 4317 -213 -19 -106 N ATOM 7519 CA LEU C 206 81.284 334.254 195.893 1.00 31.77 C ANISOU 7519 CA LEU C 206 4299 3391 4380 -196 -23 -130 C ATOM 7520 C LEU C 206 81.727 333.559 197.166 1.00 34.86 C ANISOU 7520 C LEU C 206 4690 3806 4750 -196 -36 -174 C ATOM 7521 O LEU C 206 81.681 334.151 198.247 1.00 30.78 O ANISOU 7521 O LEU C 206 4175 3273 4249 -195 -38 -209 O ATOM 7522 CB LEU C 206 79.881 333.774 195.488 1.00 31.13 C ANISOU 7522 CB LEU C 206 4226 3325 4276 -175 -23 -103 C ATOM 7523 CG LEU C 206 78.895 333.808 196.646 1.00 43.57 C ANISOU 7523 CG LEU C 206 5809 4900 5847 -156 -27 -129 C ATOM 7524 CD1 LEU C 206 78.795 335.243 197.100 1.00 42.80 C ANISOU 7524 CD1 LEU C 206 5711 4757 5795 -156 -19 -145 C ATOM 7525 CD2 LEU C 206 77.557 333.313 196.165 1.00 38.92 C ANISOU 7525 CD2 LEU C 206 5225 4328 5236 -137 -27 -100 C ATOM 7526 N HIS C 207 82.173 332.298 197.056 1.00 32.37 N ANISOU 7526 N HIS C 207 4372 3528 4398 -198 -44 -173 N ATOM 7527 CA HIS C 207 82.642 331.595 198.262 1.00 33.70 C ANISOU 7527 CA HIS C 207 4539 3720 4545 -198 -57 -211 C ATOM 7528 C HIS C 207 83.917 332.217 198.824 1.00 34.44 C ANISOU 7528 C HIS C 207 4623 3801 4663 -217 -60 -242 C ATOM 7529 O HIS C 207 84.103 332.221 200.048 1.00 28.77 O ANISOU 7529 O HIS C 207 3903 3089 3940 -216 -69 -280 O ATOM 7530 CB HIS C 207 82.842 330.097 197.979 1.00 34.74 C ANISOU 7530 CB HIS C 207 4671 3893 4636 -194 -65 -201 C ATOM 7531 CG HIS C 207 81.557 329.332 197.964 1.00 36.42 C ANISOU 7531 CG HIS C 207 4893 4123 4821 -175 -68 -186 C ATOM 7532 ND1 HIS C 207 80.634 329.466 196.947 1.00 38.57 N ANISOU 7532 ND1 HIS C 207 5171 4391 5095 -168 -59 -151 N ATOM 7533 CD2 HIS C 207 80.976 328.520 198.892 1.00 31.75 C ANISOU 7533 CD2 HIS C 207 4307 3555 4202 -162 -77 -202 C ATOM 7534 CE1 HIS C 207 79.572 328.724 197.212 1.00 46.33 C ANISOU 7534 CE1 HIS C 207 6160 5391 6050 -152 -64 -147 C ATOM 7535 NE2 HIS C 207 79.764 328.118 198.371 1.00 38.77 N ANISOU 7535 NE2 HIS C 207 5204 4451 5075 -148 -74 -176 N ATOM 7536 N VAL C 208 84.786 332.775 197.964 1.00 29.50 N ANISOU 7536 N VAL C 208 3989 3159 4062 -235 -52 -227 N ATOM 7537 CA VAL C 208 85.975 333.492 198.456 1.00 34.95 C ANISOU 7537 CA VAL C 208 4667 3833 4779 -256 -53 -256 C ATOM 7538 C VAL C 208 85.548 334.732 199.242 1.00 35.18 C ANISOU 7538 C VAL C 208 4701 3826 4842 -255 -49 -282 C ATOM 7539 O VAL C 208 86.104 335.039 200.313 1.00 33.09 O ANISOU 7539 O VAL C 208 4429 3558 4584 -264 -56 -323 O ATOM 7540 CB VAL C 208 86.915 333.867 197.284 1.00 35.87 C ANISOU 7540 CB VAL C 208 4774 3939 4916 -276 -43 -230 C ATOM 7541 CG1 VAL C 208 88.048 334.806 197.778 1.00 35.01 C ANISOU 7541 CG1 VAL C 208 4653 3807 4843 -299 -42 -259 C ATOM 7542 CG2 VAL C 208 87.532 332.617 196.707 1.00 30.52 C ANISOU 7542 CG2 VAL C 208 4090 3301 4205 -277 -47 -215 C ATOM 7543 N ILE C 209 84.549 335.451 198.736 1.00 29.71 N ANISOU 7543 N ILE C 209 4016 3103 4170 -245 -38 -258 N ATOM 7544 CA ILE C 209 84.044 336.624 199.426 1.00 30.57 C ANISOU 7544 CA ILE C 209 4129 3174 4313 -242 -33 -281 C ATOM 7545 C ILE C 209 83.440 336.232 200.779 1.00 36.29 C ANISOU 7545 C ILE C 209 4859 3917 5013 -226 -43 -320 C ATOM 7546 O ILE C 209 83.680 336.894 201.790 1.00 30.52 O ANISOU 7546 O ILE C 209 4125 3171 4300 -232 -46 -362 O ATOM 7547 CB ILE C 209 83.051 337.381 198.533 1.00 35.21 C ANISOU 7547 CB ILE C 209 4724 3729 4926 -231 -19 -243 C ATOM 7548 CG1 ILE C 209 83.827 338.087 197.409 1.00 34.68 C ANISOU 7548 CG1 ILE C 209 4650 3636 4892 -251 -8 -213 C ATOM 7549 CG2 ILE C 209 82.312 338.441 199.292 1.00 33.58 C ANISOU 7549 CG2 ILE C 209 4523 3485 4751 -221 -13 -267 C ATOM 7550 CD1 ILE C 209 82.916 338.541 196.262 1.00 36.50 C ANISOU 7550 CD1 ILE C 209 4886 3846 5136 -240 5 -162 C ATOM 7551 N ILE C 210 82.633 335.166 200.799 1.00 30.65 N ANISOU 7551 N ILE C 210 4151 3237 4259 -207 -49 -306 N ATOM 7552 CA ILE C 210 82.036 334.690 202.045 1.00 28.90 C ANISOU 7552 CA ILE C 210 3934 3038 4010 -192 -58 -338 C ATOM 7553 C ILE C 210 83.124 334.263 203.024 1.00 31.03 C ANISOU 7553 C ILE C 210 4195 3332 4264 -205 -72 -376 C ATOM 7554 O ILE C 210 83.066 334.554 204.216 1.00 31.76 O ANISOU 7554 O ILE C 210 4287 3427 4355 -203 -77 -417 O ATOM 7555 CB ILE C 210 81.079 333.518 201.766 1.00 31.46 C ANISOU 7555 CB ILE C 210 4265 3395 4294 -173 -62 -311 C ATOM 7556 CG1 ILE C 210 79.819 334.045 201.076 1.00 33.42 C ANISOU 7556 CG1 ILE C 210 4520 3620 4557 -158 -50 -280 C ATOM 7557 CG2 ILE C 210 80.720 332.741 203.086 1.00 29.10 C ANISOU 7557 CG2 ILE C 210 3968 3130 3959 -161 -74 -342 C ATOM 7558 CD1 ILE C 210 79.002 332.913 200.504 1.00 38.46 C ANISOU 7558 CD1 ILE C 210 5164 4290 5158 -144 -53 -248 C ATOM 7559 N GLY C 211 84.112 333.497 202.532 1.00 25.07 N ANISOU 7559 N GLY C 211 3432 2600 3494 -217 -77 -364 N ATOM 7560 CA GLY C 211 85.186 333.071 203.422 1.00 29.44 C ANISOU 7560 CA GLY C 211 3975 3179 4032 -228 -91 -398 C ATOM 7561 C GLY C 211 86.015 334.229 203.966 1.00 29.10 C ANISOU 7561 C GLY C 211 3922 3109 4024 -248 -90 -434 C ATOM 7562 O GLY C 211 86.460 334.194 205.118 1.00 30.50 O ANISOU 7562 O GLY C 211 4093 3303 4191 -252 -101 -474 O ATOM 7563 N SER C 212 86.272 335.243 203.127 1.00 30.35 N ANISOU 7563 N SER C 212 4079 3228 4225 -261 -77 -419 N ATOM 7564 CA SER C 212 87.050 336.405 203.574 1.00 26.67 C ANISOU 7564 CA SER C 212 3604 2731 3798 -283 -75 -452 C ATOM 7565 C SER C 212 86.264 337.149 204.636 1.00 29.61 C ANISOU 7565 C SER C 212 3983 3085 4182 -273 -74 -489 C ATOM 7566 O SER C 212 86.837 337.649 205.608 1.00 31.40 O ANISOU 7566 O SER C 212 4202 3309 4418 -285 -80 -535 O ATOM 7567 CB SER C 212 87.337 337.361 202.382 1.00 32.84 C ANISOU 7567 CB SER C 212 4384 3470 4625 -298 -59 -423 C ATOM 7568 OG SER C 212 88.193 336.711 201.445 1.00 32.49 O ANISOU 7568 OG SER C 212 4331 3445 4569 -309 -59 -393 O ATOM 7569 N THR C 213 84.945 337.277 204.416 1.00 31.12 N ANISOU 7569 N THR C 213 4188 3263 4373 -251 -65 -470 N ATOM 7570 CA THR C 213 84.080 337.909 205.426 1.00 31.20 C ANISOU 7570 CA THR C 213 4204 3259 4391 -238 -63 -505 C ATOM 7571 C THR C 213 84.170 337.161 206.736 1.00 34.10 C ANISOU 7571 C THR C 213 4569 3671 4717 -233 -79 -543 C ATOM 7572 O THR C 213 84.327 337.759 207.799 1.00 34.31 O ANISOU 7572 O THR C 213 4592 3693 4752 -238 -82 -591 O ATOM 7573 CB THR C 213 82.627 337.932 204.905 1.00 33.93 C ANISOU 7573 CB THR C 213 4563 3593 4737 -213 -53 -472 C ATOM 7574 OG1 THR C 213 82.598 338.708 203.691 1.00 37.09 O ANISOU 7574 OG1 THR C 213 4964 3951 5177 -218 -39 -435 O ATOM 7575 CG2 THR C 213 81.679 338.527 205.912 1.00 31.63 C ANISOU 7575 CG2 THR C 213 4277 3289 4452 -197 -49 -506 C ATOM 7576 N PHE C 214 84.090 335.840 206.666 1.00 28.68 N ANISOU 7576 N PHE C 214 3883 3028 3985 -223 -88 -523 N ATOM 7577 CA PHE C 214 84.197 335.025 207.875 1.00 27.82 C ANISOU 7577 CA PHE C 214 3771 2965 3834 -217 -104 -552 C ATOM 7578 C PHE C 214 85.542 335.261 208.572 1.00 30.62 C ANISOU 7578 C PHE C 214 4112 3331 4194 -239 -115 -592 C ATOM 7579 O PHE C 214 85.611 335.442 209.807 1.00 35.14 O ANISOU 7579 O PHE C 214 4679 3918 4753 -240 -123 -636 O ATOM 7580 CB PHE C 214 84.017 333.566 207.477 1.00 25.41 C ANISOU 7580 CB PHE C 214 3468 2699 3486 -205 -111 -517 C ATOM 7581 CG PHE C 214 83.641 332.636 208.610 1.00 31.06 C ANISOU 7581 CG PHE C 214 4185 3460 4157 -191 -123 -534 C ATOM 7582 CD1 PHE C 214 83.550 333.069 209.914 1.00 33.46 C ANISOU 7582 CD1 PHE C 214 4487 3774 4454 -190 -128 -580 C ATOM 7583 CD2 PHE C 214 83.447 331.276 208.346 1.00 28.86 C ANISOU 7583 CD2 PHE C 214 3909 3215 3841 -180 -130 -504 C ATOM 7584 CE1 PHE C 214 83.260 332.186 210.943 1.00 33.13 C ANISOU 7584 CE1 PHE C 214 4445 3776 4368 -178 -140 -593 C ATOM 7585 CE2 PHE C 214 83.133 330.379 209.387 1.00 28.39 C ANISOU 7585 CE2 PHE C 214 3851 3197 3740 -168 -141 -516 C ATOM 7586 CZ PHE C 214 83.059 330.862 210.704 1.00 32.39 C ANISOU 7586 CZ PHE C 214 4353 3714 4238 -167 -146 -560 C ATOM 7587 N LEU C 215 86.628 335.280 207.806 1.00 27.60 N ANISOU 7587 N LEU C 215 3720 2941 3828 -259 -115 -577 N ATOM 7588 CA LEU C 215 87.924 335.539 208.414 1.00 27.89 C ANISOU 7588 CA LEU C 215 3739 2986 3870 -281 -125 -613 C ATOM 7589 C LEU C 215 87.934 336.919 209.034 1.00 32.42 C ANISOU 7589 C LEU C 215 4312 3524 4482 -294 -119 -656 C ATOM 7590 O LEU C 215 88.549 337.141 210.085 1.00 31.45 O ANISOU 7590 O LEU C 215 4179 3418 4354 -305 -130 -702 O ATOM 7591 CB LEU C 215 89.043 335.423 207.375 1.00 27.95 C ANISOU 7591 CB LEU C 215 3737 2990 3895 -300 -124 -587 C ATOM 7592 CG LEU C 215 89.328 334.003 206.853 1.00 36.30 C ANISOU 7592 CG LEU C 215 4791 4086 4914 -292 -131 -552 C ATOM 7593 CD1 LEU C 215 90.371 334.120 205.729 1.00 37.37 C ANISOU 7593 CD1 LEU C 215 4916 4210 5073 -311 -125 -528 C ATOM 7594 CD2 LEU C 215 89.815 333.107 207.982 1.00 34.15 C ANISOU 7594 CD2 LEU C 215 4510 3863 4601 -288 -150 -578 C ATOM 7595 N ILE C 216 87.271 337.871 208.391 1.00 30.54 N ANISOU 7595 N ILE C 216 4083 3236 4283 -291 -102 -642 N ATOM 7596 CA ILE C 216 87.255 339.224 208.959 1.00 26.28 C ANISOU 7596 CA ILE C 216 3543 2657 3785 -302 -95 -685 C ATOM 7597 C ILE C 216 86.470 339.255 210.282 1.00 33.60 C ANISOU 7597 C ILE C 216 4475 3602 4690 -286 -100 -727 C ATOM 7598 O ILE C 216 86.833 339.982 211.238 1.00 33.96 O ANISOU 7598 O ILE C 216 4514 3641 4748 -299 -104 -780 O ATOM 7599 CB ILE C 216 86.677 340.198 207.921 1.00 35.47 C ANISOU 7599 CB ILE C 216 4716 3762 4998 -301 -75 -655 C ATOM 7600 CG1 ILE C 216 87.712 340.481 206.832 1.00 33.19 C ANISOU 7600 CG1 ILE C 216 4419 3453 4740 -325 -70 -626 C ATOM 7601 CG2 ILE C 216 86.278 341.549 208.600 1.00 30.03 C ANISOU 7601 CG2 ILE C 216 4030 3028 4351 -303 -66 -698 C ATOM 7602 CD1 ILE C 216 87.023 341.118 205.595 1.00 33.20 C ANISOU 7602 CD1 ILE C 216 4429 3407 4778 -318 -51 -579 C ATOM 7603 N VAL C 217 85.373 338.492 210.352 1.00 34.90 N ANISOU 7603 N VAL C 217 4651 3791 4820 -259 -100 -706 N ATOM 7604 CA VAL C 217 84.655 338.347 211.628 1.00 37.01 C ANISOU 7604 CA VAL C 217 4921 4085 5057 -244 -105 -743 C ATOM 7605 C VAL C 217 85.608 337.823 212.703 1.00 34.09 C ANISOU 7605 C VAL C 217 4537 3762 4653 -256 -125 -781 C ATOM 7606 O VAL C 217 85.718 338.404 213.780 1.00 34.26 O ANISOU 7606 O VAL C 217 4555 3788 4675 -262 -128 -833 O ATOM 7607 CB VAL C 217 83.416 337.433 211.475 1.00 32.92 C ANISOU 7607 CB VAL C 217 4415 3590 4504 -214 -103 -708 C ATOM 7608 CG1 VAL C 217 82.804 337.039 212.904 1.00 33.05 C ANISOU 7608 CG1 VAL C 217 4431 3648 4478 -199 -111 -746 C ATOM 7609 CG2 VAL C 217 82.332 338.092 210.560 1.00 38.63 C ANISOU 7609 CG2 VAL C 217 5150 4267 5262 -200 -84 -677 C ATOM 7610 N CYS C 218 86.321 336.713 212.420 1.00 35.42 N ANISOU 7610 N CYS C 218 4700 3969 4791 -260 -137 -755 N ATOM 7611 CA CYS C 218 87.330 336.208 213.365 1.00 30.82 C ANISOU 7611 CA CYS C 218 4102 3432 4178 -272 -156 -786 C ATOM 7612 C CYS C 218 88.380 337.262 213.713 1.00 31.17 C ANISOU 7612 C CYS C 218 4132 3455 4255 -300 -159 -831 C ATOM 7613 O CYS C 218 88.861 337.320 214.847 1.00 33.95 O ANISOU 7613 O CYS C 218 4473 3837 4588 -309 -172 -876 O ATOM 7614 CB CYS C 218 88.020 334.971 212.784 1.00 35.11 C ANISOU 7614 CB CYS C 218 4639 4008 4694 -272 -167 -747 C ATOM 7615 SG CYS C 218 86.841 333.630 212.496 1.00 38.34 S ANISOU 7615 SG CYS C 218 5062 4444 5060 -241 -166 -700 S ATOM 7616 N PHE C 219 88.769 338.091 212.745 1.00 31.96 N ANISOU 7616 N PHE C 219 4231 3506 4405 -317 -147 -817 N ATOM 7617 CA PHE C 219 89.765 339.102 213.048 1.00 35.83 C ANISOU 7617 CA PHE C 219 4708 3974 4931 -346 -148 -859 C ATOM 7618 C PHE C 219 89.246 340.066 214.110 1.00 36.64 C ANISOU 7618 C PHE C 219 4814 4061 5046 -346 -145 -916 C ATOM 7619 O PHE C 219 89.947 340.389 215.074 1.00 32.01 O ANISOU 7619 O PHE C 219 4215 3492 4455 -363 -156 -967 O ATOM 7620 CB PHE C 219 90.131 339.861 211.772 1.00 33.44 C ANISOU 7620 CB PHE C 219 4406 3617 4683 -362 -133 -830 C ATOM 7621 CG PHE C 219 91.261 340.821 211.976 1.00 31.83 C ANISOU 7621 CG PHE C 219 4187 3391 4517 -396 -134 -868 C ATOM 7622 CD1 PHE C 219 92.595 340.368 211.885 1.00 31.67 C ANISOU 7622 CD1 PHE C 219 4147 3399 4487 -417 -147 -868 C ATOM 7623 CD2 PHE C 219 91.024 342.170 212.248 1.00 41.11 C ANISOU 7623 CD2 PHE C 219 5366 4515 5739 -407 -123 -904 C ATOM 7624 CE1 PHE C 219 93.679 341.240 212.097 1.00 37.91 C ANISOU 7624 CE1 PHE C 219 4920 4171 5311 -450 -150 -904 C ATOM 7625 CE2 PHE C 219 92.101 343.051 212.426 1.00 51.73 C ANISOU 7625 CE2 PHE C 219 6695 5838 7121 -440 -124 -940 C ATOM 7626 CZ PHE C 219 93.434 342.581 212.353 1.00 39.31 C ANISOU 7626 CZ PHE C 219 5102 4298 5537 -463 -138 -940 C ATOM 7627 N PHE C 220 88.005 340.524 213.966 1.00 35.25 N ANISOU 7627 N PHE C 220 4654 3853 4885 -326 -129 -909 N ATOM 7628 CA PHE C 220 87.506 341.448 214.982 1.00 38.28 C ANISOU 7628 CA PHE C 220 5041 4221 5283 -325 -124 -965 C ATOM 7629 C PHE C 220 87.172 340.745 216.300 1.00 36.46 C ANISOU 7629 C PHE C 220 4808 4051 4994 -311 -138 -998 C ATOM 7630 O PHE C 220 87.378 341.330 217.370 1.00 34.82 O ANISOU 7630 O PHE C 220 4593 3851 4786 -321 -143 -1057 O ATOM 7631 CB PHE C 220 86.297 342.226 214.441 1.00 30.84 C ANISOU 7631 CB PHE C 220 4115 3224 4378 -307 -103 -949 C ATOM 7632 CG PHE C 220 86.694 343.312 213.504 1.00 47.92 C ANISOU 7632 CG PHE C 220 6279 5322 6607 -325 -88 -938 C ATOM 7633 CD1 PHE C 220 87.230 344.482 213.994 1.00 43.60 C ANISOU 7633 CD1 PHE C 220 5725 4740 6102 -348 -85 -990 C ATOM 7634 CD2 PHE C 220 86.576 343.148 212.135 1.00 40.39 C ANISOU 7634 CD2 PHE C 220 5331 4344 5672 -321 -79 -876 C ATOM 7635 CE1 PHE C 220 87.628 345.510 213.131 1.00 58.73 C ANISOU 7635 CE1 PHE C 220 7640 6592 8081 -367 -71 -978 C ATOM 7636 CE2 PHE C 220 86.963 344.163 211.249 1.00 45.98 C ANISOU 7636 CE2 PHE C 220 6038 4991 6440 -339 -65 -861 C ATOM 7637 CZ PHE C 220 87.492 345.347 211.749 1.00 55.49 C ANISOU 7637 CZ PHE C 220 7236 6158 7689 -362 -61 -912 C ATOM 7638 N ARG C 221 86.695 339.502 216.268 1.00 34.84 N ANISOU 7638 N ARG C 221 4607 3890 4740 -289 -145 -961 N ATOM 7639 CA ARG C 221 86.555 338.781 217.529 1.00 35.73 C ANISOU 7639 CA ARG C 221 4715 4064 4797 -280 -160 -988 C ATOM 7640 C ARG C 221 87.901 338.647 218.227 1.00 37.55 C ANISOU 7640 C ARG C 221 4926 4331 5011 -304 -180 -1023 C ATOM 7641 O ARG C 221 87.993 338.799 219.445 1.00 38.53 O ANISOU 7641 O ARG C 221 5042 4487 5109 -307 -189 -1073 O ATOM 7642 CB ARG C 221 85.879 337.419 217.290 1.00 31.25 C ANISOU 7642 CB ARG C 221 4156 3535 4184 -255 -164 -938 C ATOM 7643 CG ARG C 221 84.383 337.562 216.763 1.00 28.08 C ANISOU 7643 CG ARG C 221 3772 3104 3793 -229 -145 -909 C ATOM 7644 CD ARG C 221 83.788 336.148 216.737 1.00 29.57 C ANISOU 7644 CD ARG C 221 3966 3338 3931 -207 -152 -867 C ATOM 7645 NE ARG C 221 83.655 335.681 218.125 1.00 28.59 N ANISOU 7645 NE ARG C 221 3837 3268 3758 -201 -164 -901 N ATOM 7646 CZ ARG C 221 83.622 334.394 218.441 1.00 33.85 C ANISOU 7646 CZ ARG C 221 4501 3986 4374 -190 -176 -877 C ATOM 7647 NH1 ARG C 221 83.739 333.470 217.461 1.00 28.34 N ANISOU 7647 NH1 ARG C 221 3807 3289 3671 -186 -178 -822 N ATOM 7648 NH2 ARG C 221 83.453 334.031 219.715 1.00 27.33 N ANISOU 7648 NH2 ARG C 221 3670 3210 3505 -184 -186 -906 N ATOM 7649 N GLN C 222 88.972 338.411 217.469 1.00 35.24 N ANISOU 7649 N GLN C 222 4624 4034 4733 -322 -186 -998 N ATOM 7650 CA GLN C 222 90.294 338.261 218.080 1.00 31.33 C ANISOU 7650 CA GLN C 222 4108 3575 4222 -345 -205 -1028 C ATOM 7651 C GLN C 222 90.739 339.580 218.702 1.00 33.91 C ANISOU 7651 C GLN C 222 4426 3876 4584 -369 -203 -1092 C ATOM 7652 O GLN C 222 91.226 339.607 219.839 1.00 35.55 O ANISOU 7652 O GLN C 222 4619 4123 4764 -380 -219 -1140 O ATOM 7653 CB GLN C 222 91.316 337.775 217.016 1.00 33.56 C ANISOU 7653 CB GLN C 222 4380 3854 4517 -358 -209 -986 C ATOM 7654 CG GLN C 222 92.760 337.806 217.501 1.00 33.98 C ANISOU 7654 CG GLN C 222 4408 3936 4566 -385 -227 -1017 C ATOM 7655 CD GLN C 222 93.081 336.871 218.704 1.00 30.53 C ANISOU 7655 CD GLN C 222 3959 3573 4068 -378 -250 -1036 C ATOM 7656 OE1 GLN C 222 92.313 336.009 219.088 1.00 35.74 O ANISOU 7656 OE1 GLN C 222 4629 4266 4686 -352 -254 -1018 O ATOM 7657 NE2 GLN C 222 94.294 337.041 219.259 1.00 31.86 N ANISOU 7657 NE2 GLN C 222 4104 3767 4233 -402 -267 -1070 N ATOM 7658 N LEU C 223 90.555 340.695 217.970 1.00 36.62 N ANISOU 7658 N LEU C 223 4776 4151 4987 -379 -185 -1093 N ATOM 7659 CA LEU C 223 90.885 342.006 218.525 1.00 40.93 C ANISOU 7659 CA LEU C 223 5316 4664 5571 -402 -180 -1155 C ATOM 7660 C LEU C 223 90.174 342.258 219.841 1.00 38.54 C ANISOU 7660 C LEU C 223 5016 4385 5242 -391 -182 -1209 C ATOM 7661 O LEU C 223 90.731 342.897 220.732 1.00 36.97 O ANISOU 7661 O LEU C 223 4805 4195 5047 -411 -190 -1270 O ATOM 7662 CB LEU C 223 90.479 343.117 217.587 1.00 37.29 C ANISOU 7662 CB LEU C 223 4867 4124 5177 -407 -157 -1142 C ATOM 7663 CG LEU C 223 91.397 343.421 216.461 1.00 50.14 C ANISOU 7663 CG LEU C 223 6488 5716 6848 -430 -153 -1112 C ATOM 7664 CD1 LEU C 223 90.665 344.506 215.772 1.00 46.14 C ANISOU 7664 CD1 LEU C 223 5995 5135 6399 -427 -129 -1102 C ATOM 7665 CD2 LEU C 223 92.751 343.908 217.026 1.00 41.05 C ANISOU 7665 CD2 LEU C 223 5313 4574 5708 -467 -166 -1161 C ATOM 7666 N LYS C 224 88.925 341.792 219.965 1.00 34.10 N ATOM 7667 CA LYS C 224 88.137 341.908 221.198 1.00 33.03 C ATOM 7668 C LYS C 224 88.376 340.786 222.201 1.00 36.55 C ATOM 7669 O LYS C 224 87.599 340.682 223.158 1.00 38.84 O ATOM 7670 CB LYS C 224 86.628 341.943 220.860 1.00 40.64 C ATOM 7671 CG LYS C 224 86.203 343.108 220.009 1.00 45.27 C ATOM 7672 CD LYS C 224 84.699 343.034 219.792 1.00 95.46 C ATOM 7673 CE LYS C 224 84.226 343.793 218.564 1.00 60.94 C ATOM 7674 NZ LYS C 224 84.268 345.265 218.741 1.00176.45 N