>>3AG2:HELIX   83 AJ2 ASP N  227  SER N  262  1                                  36    
DPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 83 AJ2 ASP N 227 SER N 262 1 36 ATOM 16040 N ASP N 227 112.011 306.663 173.629 1.00 31.76 N ANISOU16040 N ASP N 227 3474 4438 4155 -347 210 -951 N ATOM 16041 CA ASP N 227 112.592 307.971 173.410 1.00 31.63 C ANISOU16041 CA ASP N 227 3450 4458 4110 -365 233 -943 C ATOM 16042 C ASP N 227 113.872 308.137 174.220 1.00 36.34 C ANISOU16042 C ASP N 227 4038 5025 4744 -350 229 -948 C ATOM 16043 O ASP N 227 113.816 308.156 175.463 1.00 34.55 O ANISOU16043 O ASP N 227 3838 4742 4546 -336 205 -911 O ATOM 16044 CB ASP N 227 111.571 309.026 173.810 1.00 32.43 C ANISOU16044 CB ASP N 227 3587 4555 4181 -381 228 -884 C ATOM 16045 CG ASP N 227 112.050 310.425 173.555 1.00 31.61 C ANISOU16045 CG ASP N 227 3481 4485 4044 -401 248 -870 C ATOM 16046 OD1 ASP N 227 113.175 310.619 173.033 1.00 32.09 O ANISOU16046 OD1 ASP N 227 3514 4578 4101 -405 267 -905 O ATOM 16047 OD2 ASP N 227 111.264 311.334 173.845 1.00 37.14 O ANISOU16047 OD2 ASP N 227 4208 5182 4722 -414 244 -822 O ATOM 16048 N PRO N 228 115.027 308.310 173.572 1.00 31.64 N ANISOU16048 N PRO N 228 3407 4469 4147 -354 252 -992 N ATOM 16049 CA PRO N 228 116.274 308.542 174.332 1.00 28.14 C ANISOU16049 CA PRO N 228 2956 3997 3738 -341 248 -996 C ATOM 16050 C PRO N 228 116.157 309.750 175.242 1.00 28.08 C ANISOU16050 C PRO N 228 2982 3964 3723 -349 238 -937 C ATOM 16051 O PRO N 228 116.837 309.828 176.276 1.00 28.81 O ANISOU16051 O PRO N 228 3081 4013 3852 -335 222 -921 O ATOM 16052 CB PRO N 228 117.334 308.781 173.250 1.00 26.81 C ANISOU16052 CB PRO N 228 2747 3889 3550 -352 279 -1051 C ATOM 16053 CG PRO N 228 116.746 308.029 171.995 1.00 37.26 C ANISOU16053 CG PRO N 228 4044 5264 4850 -360 295 -1091 C ATOM 16054 CD PRO N 228 115.240 308.305 172.100 1.00 33.80 C ANISOU16054 CD PRO N 228 3644 4816 4382 -371 283 -1040 C ATOM 16055 N ILE N 229 115.343 310.740 174.859 1.00 30.51 N ANISOU16055 N ILE N 229 3309 4299 3985 -373 247 -903 N ATOM 16056 CA ILE N 229 115.298 311.959 175.677 1.00 30.74 C ANISOU16056 CA ILE N 229 3365 4304 4009 -381 238 -846 C ATOM 16057 C ILE N 229 114.597 311.666 177.013 1.00 33.02 C ANISOU16057 C ILE N 229 3688 4531 4328 -364 208 -805 C ATOM 16058 O ILE N 229 114.881 312.320 178.037 1.00 30.48 O ANISOU16058 O ILE N 229 3384 4175 4023 -361 195 -768 O ATOM 16059 CB ILE N 229 114.600 313.097 174.917 1.00 32.14 C ANISOU16059 CB ILE N 229 3553 4525 4133 -410 253 -817 C ATOM 16060 CG1 ILE N 229 115.344 313.467 173.635 1.00 38.83 C ANISOU16060 CG1 ILE N 229 4372 5435 4946 -429 276 -849 C ATOM 16061 CG2 ILE N 229 114.449 314.341 175.816 1.00 31.71 C ANISOU16061 CG2 ILE N 229 3527 4442 4081 -416 242 -755 C ATOM 16062 CD1 ILE N 229 116.842 313.665 173.911 1.00 46.62 C ANISOU16062 CD1 ILE N 229 5339 6413 5962 -423 279 -864 C ATOM 16063 N LEU N 230 113.702 310.662 177.044 1.00 31.59 N ANISOU16063 N LEU N 230 3515 4334 4153 -354 196 -809 N ATOM 16064 CA LEU N 230 113.092 310.292 178.331 1.00 24.99 C ANISOU16064 CA LEU N 230 2712 3440 3343 -338 166 -770 C ATOM 16065 C LEU N 230 114.181 309.914 179.350 1.00 28.49 C ANISOU16065 C LEU N 230 3151 3841 3832 -318 148 -774 C ATOM 16066 O LEU N 230 114.151 310.376 180.500 1.00 30.34 O ANISOU16066 O LEU N 230 3411 4039 4079 -313 130 -734 O ATOM 16067 CB LEU N 230 112.094 309.140 178.149 1.00 28.61 C ANISOU16067 CB LEU N 230 3178 3887 3805 -331 153 -778 C ATOM 16068 CG LEU N 230 111.600 308.533 179.484 1.00 33.18 C ANISOU16068 CG LEU N 230 3787 4405 4412 -314 120 -744 C ATOM 16069 CD1 LEU N 230 110.735 309.545 180.279 1.00 29.21 C ANISOU16069 CD1 LEU N 230 3319 3887 3892 -323 112 -687 C ATOM 16070 CD2 LEU N 230 110.728 307.283 179.127 1.00 31.82 C ANISOU16070 CD2 LEU N 230 3619 4226 4245 -308 109 -758 C ATOM 16071 N TYR N 231 115.164 309.071 178.944 1.00 26.61 N ANISOU16071 N TYR N 231 2882 3610 3620 -305 153 -824 N ATOM 16072 CA TYR N 231 116.298 308.781 179.853 1.00 28.99 C ANISOU16072 CA TYR N 231 3175 3876 3965 -287 137 -829 C ATOM 16073 C TYR N 231 116.923 310.058 180.408 1.00 31.74 C ANISOU16073 C TYR N 231 3530 4221 4308 -296 139 -800 C ATOM 16074 O TYR N 231 117.235 310.154 181.612 1.00 30.02 O ANISOU16074 O TYR N 231 3329 3962 4114 -286 116 -772 O ATOM 16075 CB TYR N 231 117.395 307.930 179.138 1.00 26.00 C ANISOU16075 CB TYR N 231 2753 3516 3612 -275 149 -893 C ATOM 16076 CG TYR N 231 118.545 307.673 180.059 1.00 30.45 C ANISOU16076 CG TYR N 231 3307 4044 4220 -256 131 -898 C ATOM 16077 CD1 TYR N 231 119.581 308.575 180.156 1.00 29.54 C ANISOU16077 CD1 TYR N 231 3177 3939 4106 -263 141 -899 C ATOM 16078 CD2 TYR N 231 118.560 306.563 180.907 1.00 27.90 C ANISOU16078 CD2 TYR N 231 2991 3673 3937 -234 102 -895 C ATOM 16079 CE1 TYR N 231 120.609 308.378 181.062 1.00 30.96 C ANISOU16079 CE1 TYR N 231 3350 4086 4328 -247 123 -900 C ATOM 16080 CE2 TYR N 231 119.617 306.341 181.800 1.00 33.76 C ANISOU16080 CE2 TYR N 231 3724 4383 4720 -217 84 -897 C ATOM 16081 CZ TYR N 231 120.620 307.267 181.872 1.00 32.17 C ANISOU16081 CZ TYR N 231 3509 4195 4520 -224 94 -900 C ATOM 16082 OH TYR N 231 121.703 307.085 182.691 1.00 31.13 O ANISOU16082 OH TYR N 231 3365 4035 4428 -209 77 -903 O ATOM 16083 N GLN N 232 117.138 311.053 179.566 1.00 30.27 N ANISOU16083 N GLN N 232 3332 4079 4091 -317 165 -805 N ATOM 16084 CA GLN N 232 117.824 312.259 180.025 1.00 29.61 C ANISOU16084 CA GLN N 232 3252 3992 4006 -328 166 -778 C ATOM 16085 C GLN N 232 117.032 312.988 181.090 1.00 30.55 C ANISOU16085 C GLN N 232 3411 4078 4119 -330 147 -719 C ATOM 16086 O GLN N 232 117.622 313.511 182.045 1.00 30.44 O ANISOU16086 O GLN N 232 3406 4036 4123 -327 133 -696 O ATOM 16087 CB GLN N 232 118.105 313.209 178.859 1.00 31.17 C ANISOU16087 CB GLN N 232 3432 4245 4167 -353 196 -788 C ATOM 16088 CG GLN N 232 119.023 312.562 177.781 1.00 30.40 C ANISOU16088 CG GLN N 232 3292 4186 4072 -351 216 -851 C ATOM 16089 CD GLN N 232 119.406 313.503 176.657 1.00 36.40 C ANISOU16089 CD GLN N 232 4035 5002 4792 -377 242 -855 C ATOM 16090 OE1 GLN N 232 119.373 314.720 176.814 1.00 33.23 O ANISOU16090 OE1 GLN N 232 3648 4603 4374 -393 244 -809 O ATOM 16091 NE2 GLN N 232 119.835 312.935 175.529 1.00 33.07 N ANISOU16091 NE2 GLN N 232 3582 4625 4356 -381 262 -909 N ATOM 16092 N HIS N 233 115.715 313.116 180.898 1.00 31.21 N ANISOU16092 N HIS N 233 3516 4167 4175 -339 148 -697 N ATOM 16093 CA HIS N 233 114.873 313.723 181.918 1.00 33.06 C ANISOU16093 CA HIS N 233 3787 4370 4404 -340 131 -645 C ATOM 16094 C HIS N 233 114.995 312.969 183.239 1.00 30.99 C ANISOU16094 C HIS N 233 3543 4057 4176 -318 100 -632 C ATOM 16095 O HIS N 233 115.194 313.576 184.299 1.00 28.57 O ANISOU16095 O HIS N 233 3254 3723 3878 -317 85 -601 O ATOM 16096 CB HIS N 233 113.395 313.753 181.486 1.00 29.29 C ANISOU16096 CB HIS N 233 3327 3905 3895 -349 135 -628 C ATOM 16097 CG HIS N 233 113.073 314.858 180.530 1.00 28.47 C ANISOU16097 CG HIS N 233 3219 3845 3754 -374 159 -618 C ATOM 16098 ND1 HIS N 233 113.367 316.177 180.811 1.00 28.63 N ANISOU16098 ND1 HIS N 233 3245 3865 3767 -386 163 -587 N ATOM 16099 CD2 HIS N 233 112.570 314.838 179.262 1.00 28.62 C ANISOU16099 CD2 HIS N 233 3224 3911 3739 -389 179 -636 C ATOM 16100 CE1 HIS N 233 112.980 316.934 179.793 1.00 30.67 C ANISOU16100 CE1 HIS N 233 3497 4165 3990 -407 183 -580 C ATOM 16101 NE2 HIS N 233 112.522 316.144 178.826 1.00 33.35 N ANISOU16101 NE2 HIS N 233 3825 4536 4311 -409 194 -610 N ATOM 16102 N LEU N 234 114.862 311.639 183.196 1.00 27.79 N ANISOU16102 N LEU N 234 3131 3639 3788 -303 90 -656 N ATOM 16103 CA LEU N 234 114.983 310.870 184.450 1.00 28.69 C ANISOU16103 CA LEU N 234 3262 3707 3932 -284 60 -642 C ATOM 16104 C LEU N 234 116.349 311.027 185.089 1.00 34.95 C ANISOU16104 C LEU N 234 4042 4484 4754 -276 51 -649 C ATOM 16105 O LEU N 234 116.471 311.190 186.326 1.00 30.08 O ANISOU16105 O LEU N 234 3447 3834 4149 -270 28 -619 O ATOM 16106 CB LEU N 234 114.691 309.397 184.193 1.00 26.16 C ANISOU16106 CB LEU N 234 2934 3376 3628 -270 51 -668 C ATOM 16107 CG LEU N 234 113.268 309.195 183.675 1.00 33.29 C ANISOU16107 CG LEU N 234 3853 4291 4504 -279 55 -657 C ATOM 16108 CD1 LEU N 234 113.128 307.815 183.151 1.00 36.32 C ANISOU16108 CD1 LEU N 234 4222 4672 4904 -268 51 -691 C ATOM 16109 CD2 LEU N 234 112.164 309.558 184.747 1.00 29.18 C ANISOU16109 CD2 LEU N 234 3372 3743 3972 -282 37 -605 C ATOM 16110 N PHE N 235 117.407 310.921 184.274 1.00 30.08 N ANISOU16110 N PHE N 235 3389 3892 4149 -275 68 -691 N ATOM 16111 CA PHE N 235 118.752 311.059 184.795 1.00 33.42 C ANISOU16111 CA PHE N 235 3795 4302 4601 -268 60 -701 C ATOM 16112 C PHE N 235 118.942 312.420 185.428 1.00 29.98 C ANISOU16112 C PHE N 235 3376 3862 4153 -281 57 -663 C ATOM 16113 O PHE N 235 119.454 312.531 186.555 1.00 27.14 O ANISOU16113 O PHE N 235 3027 3471 3812 -274 35 -643 O ATOM 16114 CB PHE N 235 119.820 310.840 183.694 1.00 23.10 C ANISOU16114 CB PHE N 235 2443 3029 3305 -268 83 -754 C ATOM 16115 CG PHE N 235 121.207 310.968 184.244 1.00 27.22 C ANISOU16115 CG PHE N 235 2945 3537 3860 -260 74 -764 C ATOM 16116 CD1 PHE N 235 121.823 309.874 184.821 1.00 30.30 C ANISOU16116 CD1 PHE N 235 3323 3898 4291 -237 53 -784 C ATOM 16117 CD2 PHE N 235 121.810 312.238 184.382 1.00 29.77 C ANISOU16117 CD2 PHE N 235 3268 3870 4173 -276 80 -744 C ATOM 16118 CE1 PHE N 235 123.111 310.032 185.442 1.00 29.44 C ANISOU16118 CE1 PHE N 235 3197 3774 4214 -230 41 -790 C ATOM 16119 CE2 PHE N 235 123.111 312.418 184.991 1.00 30.64 C ANISOU16119 CE2 PHE N 235 3361 3966 4315 -270 69 -749 C ATOM 16120 CZ PHE N 235 123.758 311.300 185.514 1.00 37.16 C ANISOU16120 CZ PHE N 235 4173 4766 5182 -247 49 -773 C ATOM 16121 N TRP N 236 118.560 313.491 184.699 1.00 30.09 N ANISOU16121 N TRP N 236 3392 3907 4135 -302 80 -652 N ATOM 16122 CA TRP N 236 118.863 314.817 185.237 1.00 28.91 C ANISOU16122 CA TRP N 236 3254 3752 3979 -315 78 -618 C ATOM 16123 C TRP N 236 117.905 315.236 186.359 1.00 30.11 C ANISOU16123 C TRP N 236 3447 3873 4121 -314 57 -572 C ATOM 16124 O TRP N 236 118.266 316.078 187.190 1.00 26.40 O ANISOU16124 O TRP N 236 2990 3386 3654 -319 46 -546 O ATOM 16125 CB TRP N 236 118.879 315.872 184.141 1.00 29.49 C ANISOU16125 CB TRP N 236 3313 3867 4024 -338 106 -619 C ATOM 16126 CG TRP N 236 120.205 315.740 183.343 1.00 26.39 C ANISOU16126 CG TRP N 236 2880 3502 3645 -340 123 -659 C ATOM 16127 CD1 TRP N 236 120.372 315.364 182.042 1.00 31.24 C ANISOU16127 CD1 TRP N 236 3466 4158 4246 -346 148 -698 C ATOM 16128 CD2 TRP N 236 121.509 315.913 183.893 1.00 26.86 C ANISOU16128 CD2 TRP N 236 2924 3548 3735 -335 113 -664 C ATOM 16129 NE1 TRP N 236 121.749 315.292 181.752 1.00 27.86 N ANISOU16129 NE1 TRP N 236 3004 3744 3840 -344 155 -728 N ATOM 16130 CE2 TRP N 236 122.446 315.645 182.872 1.00 28.48 C ANISOU16130 CE2 TRP N 236 3089 3787 3945 -338 133 -706 C ATOM 16131 CE3 TRP N 236 121.977 316.246 185.174 1.00 27.94 C ANISOU16131 CE3 TRP N 236 3076 3647 3893 -330 87 -638 C ATOM 16132 CZ2 TRP N 236 123.855 315.732 183.095 1.00 28.08 C ANISOU16132 CZ2 TRP N 236 3011 3733 3924 -335 130 -721 C ATOM 16133 CZ3 TRP N 236 123.378 316.327 185.384 1.00 33.62 C ANISOU16133 CZ3 TRP N 236 3769 4364 4641 -327 82 -653 C ATOM 16134 CH2 TRP N 236 124.276 316.100 184.349 1.00 34.63 C ANISOU16134 CH2 TRP N 236 3857 4526 4776 -330 104 -692 C ATOM 16135 N PHE N 237 116.721 314.646 186.425 1.00 31.61 N ANISOU16135 N PHE N 237 3656 4056 4298 -310 52 -562 N ATOM 16136 CA PHE N 237 115.851 314.935 187.560 1.00 27.70 C ANISOU16136 CA PHE N 237 3199 3531 3795 -308 32 -522 C ATOM 16137 C PHE N 237 116.534 314.542 188.859 1.00 32.39 C ANISOU16137 C PHE N 237 3803 4091 4414 -295 4 -513 C ATOM 16138 O PHE N 237 116.332 315.183 189.883 1.00 30.40 O ANISOU16138 O PHE N 237 3577 3819 4157 -298 -11 -482 O ATOM 16139 CB PHE N 237 114.527 314.201 187.412 1.00 23.87 C ANISOU16139 CB PHE N 237 2729 3044 3297 -304 30 -516 C ATOM 16140 CG PHE N 237 113.526 314.614 188.458 1.00 27.95 C ANISOU16140 CG PHE N 237 3282 3537 3801 -306 14 -475 C ATOM 16141 CD1 PHE N 237 113.425 313.919 189.635 1.00 28.57 C ANISOU16141 CD1 PHE N 237 3381 3583 3892 -294 -12 -461 C ATOM 16142 CD2 PHE N 237 112.768 315.725 188.255 1.00 28.96 C ANISOU16142 CD2 PHE N 237 3422 3678 3905 -320 27 -453 C ATOM 16143 CE1 PHE N 237 112.525 314.348 190.634 1.00 27.03 C ANISOU16143 CE1 PHE N 237 3219 3369 3684 -297 -25 -426 C ATOM 16144 CE2 PHE N 237 111.847 316.161 189.208 1.00 32.31 C ANISOU16144 CE2 PHE N 237 3876 4080 4318 -320 15 -419 C ATOM 16145 CZ PHE N 237 111.737 315.460 190.401 1.00 27.65 C ANISOU16145 CZ PHE N 237 3307 3459 3740 -309 -11 -407 C ATOM 16146 N PHE N 238 117.339 313.483 188.818 1.00 27.24 N ANISOU16146 N PHE N 238 3129 3431 3788 -281 -3 -543 N ATOM 16147 CA PHE N 238 118.250 313.135 189.915 1.00 28.79 C ANISOU16147 CA PHE N 238 3328 3600 4012 -270 -28 -540 C ATOM 16148 C PHE N 238 119.533 313.983 189.882 1.00 25.48 C ANISOU16148 C PHE N 238 2888 3189 3605 -276 -23 -548 C ATOM 16149 O PHE N 238 120.042 314.420 190.931 1.00 29.63 O ANISOU16149 O PHE N 238 3426 3695 4138 -276 -42 -529 O ATOM 16150 CB PHE N 238 118.678 311.666 189.796 1.00 25.66 C ANISOU16150 CB PHE N 238 2912 3193 3644 -251 -37 -572 C ATOM 16151 CG PHE N 238 120.060 311.413 190.373 1.00 34.30 C ANISOU16151 CG PHE N 238 3987 4273 4773 -241 -53 -587 C ATOM 16152 CD1 PHE N 238 120.223 311.335 191.777 1.00 32.48 C ANISOU16152 CD1 PHE N 238 3778 4011 4550 -236 -81 -561 C ATOM 16153 CD2 PHE N 238 121.179 311.348 189.542 1.00 30.77 C ANISOU16153 CD2 PHE N 238 3499 3845 4347 -238 -38 -626 C ATOM 16154 CE1 PHE N 238 121.484 311.130 192.342 1.00 30.38 C ANISOU16154 CE1 PHE N 238 3494 3731 4316 -227 -98 -573 C ATOM 16155 CE2 PHE N 238 122.484 311.154 190.087 1.00 32.07 C ANISOU16155 CE2 PHE N 238 3643 3995 4546 -229 -53 -640 C ATOM 16156 CZ PHE N 238 122.645 311.030 191.473 1.00 29.32 C ANISOU16156 CZ PHE N 238 3317 3615 4208 -223 -84 -613 C ATOM 16157 N GLY N 239 120.075 314.186 188.678 1.00 29.80 N ANISOU16157 N GLY N 239 3402 3767 4153 -283 2 -578 N ATOM 16158 CA GLY N 239 121.418 314.733 188.530 1.00 23.12 C ANISOU16158 CA GLY N 239 2530 2931 3324 -288 7 -593 C ATOM 16159 C GLY N 239 121.545 316.189 188.937 1.00 26.99 C ANISOU16159 C GLY N 239 3034 3421 3801 -305 7 -560 C ATOM 16160 O GLY N 239 122.592 316.591 189.438 1.00 28.16 O ANISOU16160 O GLY N 239 3173 3561 3967 -307 -4 -559 O ATOM 16161 N HIS N 240 120.510 317.034 188.720 1.00 25.89 N ANISOU16161 N HIS N 240 2917 3290 3631 -319 17 -534 N ATOM 16162 CA HIS N 240 120.719 318.360 189.307 1.00 26.49 C ANISOU16162 CA HIS N 240 3007 3357 3700 -333 12 -504 C ATOM 16163 C HIS N 240 120.653 318.296 190.840 1.00 27.94 C ANISOU16163 C HIS N 240 3221 3504 3890 -324 -20 -481 C ATOM 16164 O HIS N 240 121.569 318.844 191.490 1.00 28.23 O ANISOU16164 O HIS N 240 3256 3530 3940 -329 -33 -474 O ATOM 16165 CB HIS N 240 119.773 319.460 188.784 1.00 25.47 C ANISOU16165 CB HIS N 240 2891 3243 3542 -350 30 -481 C ATOM 16166 CG HIS N 240 120.217 320.754 189.350 1.00 31.40 C ANISOU16166 CG HIS N 240 3652 3984 4296 -364 23 -456 C ATOM 16167 ND1 HIS N 240 121.242 321.472 188.753 1.00 23.28 N ANISOU16167 ND1 HIS N 240 2596 2973 3275 -378 36 -463 N ATOM 16168 CD2 HIS N 240 120.090 321.234 190.613 1.00 25.74 C ANISOU16168 CD2 HIS N 240 2963 3236 3579 -362 0 -431 C ATOM 16169 CE1 HIS N 240 121.652 322.406 189.612 1.00 25.92 C ANISOU16169 CE1 HIS N 240 2944 3288 3617 -385 20 -440 C ATOM 16170 NE2 HIS N 240 120.970 322.271 190.746 1.00 27.05 N ANISOU16170 NE2 HIS N 240 3122 3402 3755 -376 -1 -423 N ATOM 16171 N PRO N 241 119.620 317.745 191.468 1.00 31.84 N ANISOU16171 N PRO N 241 3744 3981 4374 -315 -32 -466 N ATOM 16172 CA PRO N 241 119.690 317.599 192.952 1.00 26.66 C ANISOU16172 CA PRO N 241 3115 3294 3722 -309 -62 -446 C ATOM 16173 C PRO N 241 121.026 317.057 193.412 1.00 32.31 C ANISOU16173 C PRO N 241 3810 3999 4467 -300 -78 -464 C ATOM 16174 O PRO N 241 121.571 317.512 194.405 1.00 28.20 O ANISOU16174 O PRO N 241 3301 3462 3950 -303 -97 -451 O ATOM 16175 CB PRO N 241 118.586 316.599 193.293 1.00 25.52 C ANISOU16175 CB PRO N 241 2991 3137 3568 -298 -71 -439 C ATOM 16176 CG PRO N 241 117.477 316.996 192.210 1.00 24.98 C ANISOU16176 CG PRO N 241 2923 3091 3476 -306 -45 -436 C ATOM 16177 CD PRO N 241 118.326 317.288 190.907 1.00 27.69 C ANISOU16177 CD PRO N 241 3228 3464 3828 -313 -21 -464 C ATOM 16178 N GLU N 242 121.563 316.079 192.693 1.00 25.83 N ANISOU16178 N GLU N 242 2959 3188 3668 -289 -71 -496 N ATOM 16179 CA GLU N 242 122.855 315.494 193.038 1.00 26.61 C ANISOU16179 CA GLU N 242 3033 3278 3800 -279 -86 -517 C ATOM 16180 C GLU N 242 123.946 316.546 193.209 1.00 28.34 C ANISOU16180 C GLU N 242 3239 3502 4028 -291 -88 -514 C ATOM 16181 O GLU N 242 124.780 316.422 194.128 1.00 29.47 O ANISOU16181 O GLU N 242 3380 3627 4190 -287 -111 -513 O ATOM 16182 CB GLU N 242 123.274 314.447 191.971 1.00 29.28 C ANISOU16182 CB GLU N 242 3334 3632 4161 -266 -72 -559 C ATOM 16183 CG GLU N 242 124.663 313.842 192.229 1.00 27.42 C ANISOU16183 CG GLU N 242 3066 3386 3965 -254 -86 -585 C ATOM 16184 CD GLU N 242 124.861 313.107 193.564 1.00 39.54 C ANISOU16184 CD GLU N 242 4616 4888 5518 -240 -120 -574 C ATOM 16185 OE1 GLU N 242 126.038 312.886 193.889 1.00 37.47 O ANISOU16185 OE1 GLU N 242 4331 4618 5288 -233 -134 -589 O ATOM 16186 OE2 GLU N 242 123.890 312.721 194.281 1.00 29.56 O ANISOU16186 OE2 GLU N 242 3386 3606 4239 -237 -134 -551 O ATOM 16187 N VAL N 243 123.991 317.587 192.350 1.00 27.32 N ANISOU16187 N VAL N 243 3100 3396 3886 -308 -65 -512 N ATOM 16188 CA VAL N 243 125.130 318.503 192.583 1.00 29.55 C ANISOU16188 CA VAL N 243 3368 3680 4182 -321 -70 -509 C ATOM 16189 C VAL N 243 124.889 319.350 193.845 1.00 29.92 C ANISOU16189 C VAL N 243 3452 3703 4215 -329 -91 -475 C ATOM 16190 O VAL N 243 125.850 319.808 194.502 1.00 30.92 O ANISOU16190 O VAL N 243 3573 3820 4355 -335 -108 -471 O ATOM 16191 CB VAL N 243 125.455 319.421 191.377 1.00 26.81 C ANISOU16191 CB VAL N 243 2996 3363 3828 -339 -41 -515 C ATOM 16192 CG1 VAL N 243 125.737 318.595 190.075 1.00 27.01 C ANISOU16192 CG1 VAL N 243 2984 3417 3863 -332 -16 -553 C ATOM 16193 CG2 VAL N 243 124.346 320.494 191.155 1.00 30.70 C ANISOU16193 CG2 VAL N 243 3515 3860 4289 -354 -28 -486 C ATOM 16194 N TYR N 244 123.612 319.591 194.211 1.00 27.36 N ANISOU16194 N TYR N 244 3164 3370 3863 -331 -92 -452 N ATOM 16195 CA TYR N 244 123.338 320.274 195.496 1.00 30.61 C ANISOU16195 CA TYR N 244 3611 3759 4261 -337 -113 -424 C ATOM 16196 C TYR N 244 123.641 319.342 196.663 1.00 24.79 C ANISOU16196 C TYR N 244 2885 3001 3534 -324 -141 -426 C ATOM 16197 O TYR N 244 124.114 319.773 197.726 1.00 29.70 O ANISOU16197 O TYR N 244 3521 3607 4155 -329 -161 -415 O ATOM 16198 CB TYR N 244 121.874 320.822 195.527 1.00 31.56 C ANISOU16198 CB TYR N 244 3764 3876 4349 -342 -105 -401 C ATOM 16199 CG TYR N 244 121.814 321.910 194.421 1.00 26.62 C ANISOU16199 CG TYR N 244 3124 3272 3720 -357 -79 -399 C ATOM 16200 CD1 TYR N 244 122.444 323.146 194.615 1.00 29.42 C ANISOU16200 CD1 TYR N 244 3478 3623 4078 -374 -82 -388 C ATOM 16201 CD2 TYR N 244 121.275 321.636 193.169 1.00 23.07 C ANISOU16201 CD2 TYR N 244 2657 2846 3264 -357 -54 -409 C ATOM 16202 CE1 TYR N 244 122.554 324.088 193.557 1.00 29.27 C ANISOU16202 CE1 TYR N 244 3440 3624 4059 -390 -59 -386 C ATOM 16203 CE2 TYR N 244 121.290 322.592 192.131 1.00 25.13 C ANISOU16203 CE2 TYR N 244 2902 3128 3519 -373 -29 -407 C ATOM 16204 CZ TYR N 244 121.943 323.802 192.346 1.00 34.10 C ANISOU16204 CZ TYR N 244 4036 4260 4661 -390 -32 -394 C ATOM 16205 OH TYR N 244 122.057 324.747 191.351 1.00 28.10 O ANISOU16205 OH TYR N 244 3258 3520 3898 -407 -10 -389 O ATOM 16206 N ILE N 245 123.373 318.046 196.480 1.00 26.15 N ANISOU16206 N ILE N 245 3050 3172 3716 -307 -142 -440 N ATOM 16207 CA ILE N 245 123.804 317.043 197.448 1.00 30.50 C ANISOU16207 CA ILE N 245 3602 3703 4283 -294 -167 -445 C ATOM 16208 C ILE N 245 125.322 317.097 197.653 1.00 32.05 C ANISOU16208 C ILE N 245 3769 3898 4510 -293 -180 -461 C ATOM 16209 O ILE N 245 125.830 316.931 198.781 1.00 28.33 O ANISOU16209 O ILE N 245 3306 3410 4048 -290 -206 -455 O ATOM 16210 CB ILE N 245 123.330 315.654 196.959 1.00 31.79 C ANISOU16210 CB ILE N 245 3755 3865 4457 -276 -164 -461 C ATOM 16211 CG1 ILE N 245 121.825 315.432 197.228 1.00 24.93 C ANISOU16211 CG1 ILE N 245 2921 2991 3559 -276 -161 -440 C ATOM 16212 CG2 ILE N 245 124.189 314.552 197.589 1.00 24.03 C ANISOU16212 CG2 ILE N 245 2756 2866 3508 -260 -187 -477 C ATOM 16213 CD1 ILE N 245 121.118 314.327 196.267 1.00 23.08 C ANISOU16213 CD1 ILE N 245 2676 2765 3330 -265 -148 -456 C ATOM 16214 N LEU N 246 126.084 317.291 196.567 1.00 27.99 N ANISOU16214 N LEU N 246 3218 3403 4014 -295 -162 -482 N ATOM 16215 CA LEU N 246 127.538 317.339 196.698 1.00 28.96 C ANISOU16215 CA LEU N 246 3310 3526 4168 -295 -174 -498 C ATOM 16216 C LEU N 246 128.017 318.587 197.431 1.00 29.08 C ANISOU16216 C LEU N 246 3339 3537 4175 -314 -185 -478 C ATOM 16217 O LEU N 246 129.049 318.547 198.103 1.00 31.47 O ANISOU16217 O LEU N 246 3628 3830 4498 -313 -206 -482 O ATOM 16218 CB LEU N 246 128.174 317.269 195.288 1.00 25.19 C ANISOU16218 CB LEU N 246 2788 3074 3709 -295 -148 -527 C ATOM 16219 CG LEU N 246 127.986 315.916 194.565 1.00 26.98 C ANISOU16219 CG LEU N 246 2993 3304 3953 -275 -138 -557 C ATOM 16220 CD1 LEU N 246 128.343 315.946 192.991 1.00 26.70 C ANISOU16220 CD1 LEU N 246 2919 3302 3925 -278 -104 -588 C ATOM 16221 CD2 LEU N 246 128.892 314.837 195.250 1.00 30.58 C ANISOU16221 CD2 LEU N 246 3431 3741 4449 -255 -165 -575 C ATOM 16222 N ILE N 247 127.324 319.721 197.321 1.00 30.35 N ANISOU16222 N ILE N 247 3524 3703 4307 -331 -173 -456 N ATOM 16223 CA ILE N 247 127.894 320.939 197.887 1.00 29.52 C ANISOU16223 CA ILE N 247 3426 3592 4197 -350 -183 -442 C ATOM 16224 C ILE N 247 127.288 321.305 199.266 1.00 32.03 C ANISOU16224 C ILE N 247 3790 3890 4491 -354 -204 -420 C ATOM 16225 O ILE N 247 127.959 321.959 200.078 1.00 30.30 O ANISOU16225 O ILE N 247 3576 3662 4273 -365 -221 -414 O ATOM 16226 CB ILE N 247 127.737 322.110 196.892 1.00 28.59 C ANISOU16226 CB ILE N 247 3302 3492 4069 -368 -158 -435 C ATOM 16227 CG1 ILE N 247 128.779 323.230 197.170 1.00 32.18 C ANISOU16227 CG1 ILE N 247 3747 3946 4534 -388 -167 -428 C ATOM 16228 CG2 ILE N 247 126.263 322.658 196.967 1.00 27.43 C ANISOU16228 CG2 ILE N 247 3194 3340 3888 -373 -149 -412 C ATOM 16229 CD1 ILE N 247 130.209 322.830 196.955 1.00 29.45 C ANISOU16229 CD1 ILE N 247 3358 3608 4223 -386 -173 -449 C ATOM 16230 N LEU N 248 126.064 320.858 199.567 1.00 26.83 N ANISOU16230 N LEU N 248 3161 3224 3810 -346 -202 -409 N ATOM 16231 CA LEU N 248 125.380 321.305 200.790 1.00 23.61 C ANISOU16231 CA LEU N 248 2796 2801 3375 -352 -216 -390 C ATOM 16232 C LEU N 248 126.108 320.926 202.093 1.00 27.04 C ANISOU16232 C LEU N 248 3236 3221 3819 -349 -244 -392 C ATOM 16233 O LEU N 248 126.267 321.793 202.983 1.00 29.69 O ANISOU16233 O LEU N 248 3592 3548 4141 -363 -255 -384 O ATOM 16234 CB LEU N 248 123.938 320.742 200.778 1.00 28.89 C ANISOU16234 CB LEU N 248 3490 3466 4020 -343 -207 -380 C ATOM 16235 CG LEU N 248 122.936 321.627 200.053 1.00 33.70 C ANISOU16235 CG LEU N 248 4113 4083 4609 -352 -185 -367 C ATOM 16236 CD1 LEU N 248 121.628 320.826 199.777 1.00 35.14 C ANISOU16236 CD1 LEU N 248 4308 4266 4775 -341 -175 -362 C ATOM 16237 CD2 LEU N 248 122.604 322.886 200.819 1.00 28.74 C ANISOU16237 CD2 LEU N 248 3516 3444 3959 -367 -190 -350 C ATOM 16238 N PRO N 249 126.571 319.693 202.282 1.00 29.89 N ANISOU16238 N PRO N 249 3577 3576 4203 -333 -258 -405 N ATOM 16239 CA PRO N 249 127.410 319.422 203.463 1.00 29.22 C ANISOU16239 CA PRO N 249 3491 3478 4131 -331 -288 -408 C ATOM 16240 C PRO N 249 128.665 320.280 203.488 1.00 35.43 C ANISOU16240 C PRO N 249 4257 4269 4934 -344 -296 -414 C ATOM 16241 O PRO N 249 129.156 320.646 204.570 1.00 32.15 O ANISOU16241 O PRO N 249 3853 3845 4517 -351 -317 -411 O ATOM 16242 CB PRO N 249 127.739 317.925 203.321 1.00 31.92 C ANISOU16242 CB PRO N 249 3808 3815 4505 -308 -299 -424 C ATOM 16243 CG PRO N 249 126.694 317.374 202.308 1.00 26.93 C ANISOU16243 CG PRO N 249 3177 3190 3863 -299 -274 -425 C ATOM 16244 CD PRO N 249 126.423 318.505 201.415 1.00 36.07 C ANISOU16244 CD PRO N 249 4336 4364 5004 -315 -249 -420 C ATOM 16245 N GLY N 250 129.197 320.605 202.306 1.00 29.85 N ANISOU16245 N GLY N 250 3520 3577 4243 -348 -278 -424 N ATOM 16246 CA GLY N 250 130.291 321.560 202.222 1.00 27.05 C ANISOU16246 CA GLY N 250 3147 3229 3903 -365 -282 -427 C ATOM 16247 C GLY N 250 129.882 322.916 202.774 1.00 28.85 C ANISOU16247 C GLY N 250 3409 3451 4101 -386 -281 -409 C ATOM 16248 O GLY N 250 130.598 323.501 203.556 1.00 29.48 O ANISOU16248 O GLY N 250 3492 3525 4184 -398 -299 -408 O ATOM 16249 N PHE N 251 128.740 323.445 202.325 1.00 26.06 N ANISOU16249 N PHE N 251 3080 3101 3722 -391 -260 -396 N ATOM 16250 CA PHE N 251 128.244 324.695 202.912 1.00 32.87 C ANISOU16250 CA PHE N 251 3977 3955 4557 -409 -260 -381 C ATOM 16251 C PHE N 251 128.187 324.572 204.433 1.00 32.68 C ANISOU16251 C PHE N 251 3981 3916 4519 -409 -283 -380 C ATOM 16252 O PHE N 251 128.527 325.495 205.173 1.00 29.51 O ANISOU16252 O PHE N 251 3595 3507 4110 -424 -293 -378 O ATOM 16253 CB PHE N 251 126.821 325.001 202.416 1.00 30.46 C ANISOU16253 CB PHE N 251 3697 3650 4225 -408 -239 -368 C ATOM 16254 CG PHE N 251 126.720 325.463 200.993 1.00 32.23 C ANISOU16254 CG PHE N 251 3899 3889 4458 -413 -215 -366 C ATOM 16255 CD1 PHE N 251 127.848 325.787 200.246 1.00 28.53 C ANISOU16255 CD1 PHE N 251 3393 3432 4016 -422 -211 -375 C ATOM 16256 CD2 PHE N 251 125.456 325.625 200.422 1.00 33.03 C ANISOU16256 CD2 PHE N 251 4016 3992 4540 -410 -196 -356 C ATOM 16257 CE1 PHE N 251 127.779 326.249 198.930 1.00 26.40 C ANISOU16257 CE1 PHE N 251 3100 3178 3752 -429 -187 -374 C ATOM 16258 CE2 PHE N 251 125.327 326.067 199.033 1.00 32.82 C ANISOU16258 CE2 PHE N 251 3967 3983 4522 -415 -172 -355 C ATOM 16259 CZ PHE N 251 126.479 326.425 198.305 1.00 28.87 C ANISOU16259 CZ PHE N 251 3429 3495 4046 -426 -166 -364 C ATOM 16260 N GLY N 252 127.704 323.462 204.940 1.00 29.48 N ANISOU16260 N GLY N 252 3585 3506 4111 -392 -291 -382 N ATOM 16261 CA GLY N 252 127.574 323.386 206.392 1.00 23.94 C ANISOU16261 CA GLY N 252 2910 2793 3395 -392 -311 -380 C ATOM 16262 C GLY N 252 128.944 323.417 207.073 1.00 28.62 C ANISOU16262 C GLY N 252 3482 3381 4010 -396 -338 -390 C ATOM 16263 O GLY N 252 129.133 324.108 208.069 1.00 29.13 O ANISOU16263 O GLY N 252 3565 3439 4063 -408 -351 -391 O ATOM 16264 N MET N 253 129.936 322.707 206.517 1.00 31.42 N ANISOU16264 N MET N 253 3797 3741 4399 -387 -346 -401 N ATOM 16265 CA MET N 253 131.276 322.716 207.141 1.00 36.25 C ANISOU16265 CA MET N 253 4387 4350 5036 -390 -374 -410 C ATOM 16266 C MET N 253 131.913 324.092 207.054 1.00 35.97 C ANISOU16266 C MET N 253 4350 4319 4999 -414 -371 -409 C ATOM 16267 O MET N 253 132.577 324.542 207.991 1.00 32.90 O ANISOU16267 O MET N 253 3965 3924 4612 -424 -393 -412 O ATOM 16268 CB MET N 253 132.186 321.688 206.479 1.00 30.43 C ANISOU16268 CB MET N 253 3604 3617 4340 -374 -381 -423 C ATOM 16269 CG MET N 253 131.757 320.231 206.777 1.00 33.67 C ANISOU16269 CG MET N 253 4015 4018 4760 -349 -392 -425 C ATOM 16270 SD MET N 253 133.020 319.009 206.306 1.00 40.58 S ANISOU16270 SD MET N 253 4837 4892 5690 -328 -409 -445 S ATOM 16271 CE MET N 253 132.970 319.268 204.508 1.00 38.57 C ANISOU16271 CE MET N 253 4555 4657 5443 -331 -369 -455 C ATOM 16272 N ILE N 254 131.766 324.742 205.899 1.00 31.54 N ANISOU16272 N ILE N 254 3780 3768 4438 -424 -346 -406 N ATOM 16273 CA ILE N 254 132.274 326.105 205.725 1.00 29.57 C ANISOU16273 CA ILE N 254 3529 3519 4187 -448 -342 -402 C ATOM 16274 C ILE N 254 131.666 327.034 206.768 1.00 35.91 C ANISOU16274 C ILE N 254 4375 4310 4959 -462 -346 -396 C ATOM 16275 O ILE N 254 132.360 327.874 207.318 1.00 32.74 O ANISOU16275 O ILE N 254 3975 3904 4560 -479 -359 -400 O ATOM 16276 CB ILE N 254 132.010 326.589 204.278 1.00 37.24 C ANISOU16276 CB ILE N 254 4485 4502 5161 -454 -313 -397 C ATOM 16277 CG1 ILE N 254 132.895 325.773 203.282 1.00 29.42 C ANISOU16277 CG1 ILE N 254 3444 3526 4206 -444 -308 -409 C ATOM 16278 CG2 ILE N 254 132.234 328.098 204.135 1.00 27.73 C ANISOU16278 CG2 ILE N 254 3289 3296 3952 -481 -307 -389 C ATOM 16279 CD1 ILE N 254 134.452 326.047 203.388 1.00 26.85 C ANISOU16279 CD1 ILE N 254 3083 3206 3913 -455 -325 -418 C ATOM 16280 N SER N 255 130.360 326.919 207.040 1.00 27.38 N ANISOU16280 N SER N 255 3329 3224 3849 -454 -335 -389 N ATOM 16281 CA SER N 255 129.768 327.742 208.104 1.00 30.63 C ANISOU16281 CA SER N 255 3781 3624 4233 -465 -337 -388 C ATOM 16282 C SER N 255 130.476 327.519 209.437 1.00 31.45 C ANISOU16282 C SER N 255 3886 3722 4341 -465 -367 -399 C ATOM 16283 O SER N 255 130.789 328.477 210.159 1.00 31.30 O ANISOU16283 O SER N 255 3881 3696 4315 -481 -376 -404 O ATOM 16284 CB SER N 255 128.255 327.451 208.239 1.00 31.17 C ANISOU16284 CB SER N 255 3882 3689 4272 -454 -321 -380 C ATOM 16285 OG SER N 255 127.615 328.049 207.105 1.00 29.83 O ANISOU16285 OG SER N 255 3715 3522 4096 -459 -296 -369 O ATOM 16286 N HIS N 256 130.715 326.256 209.809 1.00 31.58 N ANISOU16286 N HIS N 256 3889 3740 4370 -447 -385 -402 N ATOM 16287 CA HIS N 256 131.392 326.032 211.085 1.00 28.59 C ANISOU16287 CA HIS N 256 3511 3355 3998 -446 -419 -410 C ATOM 16288 C HIS N 256 132.834 326.521 211.050 1.00 31.09 C ANISOU16288 C HIS N 256 3799 3674 4340 -459 -436 -417 C ATOM 16289 O HIS N 256 133.310 327.130 212.014 1.00 29.59 O ANISOU16289 O HIS N 256 3618 3479 4145 -471 -456 -424 O ATOM 16290 CB HIS N 256 131.354 324.552 211.452 1.00 30.46 C ANISOU16290 CB HIS N 256 3738 3590 4246 -423 -438 -409 C ATOM 16291 CG HIS N 256 130.015 324.095 211.901 1.00 39.87 C ANISOU16291 CG HIS N 256 4961 4777 5411 -412 -429 -402 C ATOM 16292 ND1 HIS N 256 129.798 323.519 213.140 1.00 28.62 N ANISOU16292 ND1 HIS N 256 3551 3344 3978 -403 -455 -402 N ATOM 16293 CD2 HIS N 256 128.810 324.102 211.265 1.00 34.82 C ANISOU16293 CD2 HIS N 256 4339 4140 4752 -408 -399 -395 C ATOM 16294 CE1 HIS N 256 128.520 323.179 213.241 1.00 41.78 C ANISOU16294 CE1 HIS N 256 5242 5009 5623 -394 -440 -395 C ATOM 16295 NE2 HIS N 256 127.901 323.538 212.129 1.00 31.32 N ANISOU16295 NE2 HIS N 256 3919 3690 4290 -398 -405 -391 N ATOM 16296 N ILE N 257 133.554 326.295 209.953 1.00 31.92 N ANISOU16296 N ILE N 257 3867 3788 4473 -458 -430 -417 N ATOM 16297 CA ILE N 257 134.960 326.702 209.916 1.00 30.94 C ANISOU16297 CA ILE N 257 3712 3668 4377 -471 -447 -424 C ATOM 16298 C ILE N 257 135.099 328.224 209.983 1.00 33.48 C ANISOU16298 C ILE N 257 4047 3987 4686 -499 -440 -424 C ATOM 16299 O ILE N 257 135.917 328.757 210.756 1.00 33.50 O ANISOU16299 O ILE N 257 4048 3986 4695 -513 -462 -431 O ATOM 16300 CB ILE N 257 135.649 326.105 208.676 1.00 36.51 C ANISOU16300 CB ILE N 257 4372 4385 5117 -463 -438 -427 C ATOM 16301 CG1 ILE N 257 135.730 324.593 208.871 1.00 35.01 C ANISOU16301 CG1 ILE N 257 4166 4192 4945 -436 -453 -431 C ATOM 16302 CG2 ILE N 257 137.104 326.706 208.473 1.00 34.08 C ANISOU16302 CG2 ILE N 257 4028 4083 4838 -481 -450 -433 C ATOM 16303 CD1 ILE N 257 135.898 323.878 207.537 1.00 33.78 C ANISOU16303 CD1 ILE N 257 3974 4046 4813 -423 -434 -436 C ATOM 16304 N VAL N 258 134.331 328.945 209.153 1.00 31.37 N ANISOU16304 N VAL N 258 3795 3720 4404 -507 -409 -416 N ATOM 16305 CA VAL N 258 134.428 330.410 209.128 1.00 31.26 C ANISOU16305 CA VAL N 258 3794 3701 4383 -533 -402 -415 C ATOM 16306 C VAL N 258 134.052 330.977 210.502 1.00 32.59 C ANISOU16306 C VAL N 258 4000 3856 4526 -540 -415 -423 C ATOM 16307 O VAL N 258 134.693 331.933 211.009 1.00 34.52 O ANISOU16307 O VAL N 258 4246 4094 4774 -560 -427 -430 O ATOM 16308 CB VAL N 258 133.530 330.976 208.000 1.00 34.40 C ANISOU16308 CB VAL N 258 4202 4100 4769 -538 -369 -402 C ATOM 16309 CG1 VAL N 258 133.385 332.489 208.092 1.00 36.85 C ANISOU16309 CG1 VAL N 258 4534 4399 5068 -562 -362 -400 C ATOM 16310 CG2 VAL N 258 134.117 330.560 206.609 1.00 27.60 C ANISOU16310 CG2 VAL N 258 3297 3255 3936 -535 -358 -398 C ATOM 16311 N THR N 259 133.020 330.410 211.129 1.00 31.90 N ANISOU16311 N THR N 259 3940 3765 4415 -524 -412 -422 N ATOM 16312 CA THR N 259 132.639 330.876 212.473 1.00 24.45 C ANISOU16312 CA THR N 259 3030 2811 3449 -527 -424 -433 C ATOM 16313 C THR N 259 133.779 330.646 213.477 1.00 32.80 C ANISOU16313 C THR N 259 4073 3869 4522 -530 -462 -443 C ATOM 16314 O THR N 259 134.162 331.546 214.210 1.00 33.13 O ANISOU16314 O THR N 259 4125 3903 4559 -547 -475 -454 O ATOM 16315 CB THR N 259 131.374 330.155 212.946 1.00 32.89 C ANISOU16315 CB THR N 259 4125 3878 4493 -508 -416 -430 C ATOM 16316 OG1 THR N 259 130.311 330.430 212.022 1.00 32.06 O ANISOU16316 OG1 THR N 259 4034 3773 4374 -506 -383 -419 O ATOM 16317 CG2 THR N 259 130.968 330.597 214.366 1.00 29.46 C ANISOU16317 CG2 THR N 259 3722 3434 4037 -510 -430 -442 C ATOM 16318 N TYR N 260 134.302 329.427 213.525 1.00 33.14 N ANISOU16318 N TYR N 260 4091 3918 4583 -514 -482 -441 N ATOM 16319 CA TYR N 260 135.322 329.054 214.492 1.00 36.42 C ANISOU16319 CA TYR N 260 4491 4333 5012 -513 -521 -449 C ATOM 16320 C TYR N 260 136.578 329.940 214.397 1.00 37.86 C ANISOU16320 C TYR N 260 4652 4517 5216 -536 -534 -456 C ATOM 16321 O TYR N 260 137.007 330.548 215.393 1.00 35.39 O ANISOU16321 O TYR N 260 4350 4200 4898 -549 -556 -466 O ATOM 16322 CB TYR N 260 135.646 327.578 214.277 1.00 34.75 C ANISOU16322 CB TYR N 260 4253 4126 4823 -490 -536 -443 C ATOM 16323 CG TYR N 260 136.489 327.049 215.369 1.00 35.79 C ANISOU16323 CG TYR N 260 4376 4257 4968 -486 -579 -448 C ATOM 16324 CD1 TYR N 260 137.878 327.184 215.306 1.00 31.84 C ANISOU16324 CD1 TYR N 260 3840 3760 4498 -496 -601 -453 C ATOM 16325 CD2 TYR N 260 135.915 326.428 216.478 1.00 30.82 C ANISOU16325 CD2 TYR N 260 3770 3621 4320 -473 -600 -447 C ATOM 16326 CE1 TYR N 260 138.672 326.700 216.321 1.00 36.80 C ANISOU16326 CE1 TYR N 260 4458 4386 5138 -492 -644 -456 C ATOM 16327 CE2 TYR N 260 136.703 325.932 217.494 1.00 38.07 C ANISOU16327 CE2 TYR N 260 4679 4537 5249 -469 -644 -449 C ATOM 16328 CZ TYR N 260 138.096 326.079 217.420 1.00 36.89 C ANISOU16328 CZ TYR N 260 4494 4391 5130 -479 -666 -454 C ATOM 16329 OH TYR N 260 138.953 325.626 218.441 1.00 36.27 O ANISOU16329 OH TYR N 260 4406 4312 5064 -476 -713 -455 O ATOM 16330 N TYR N 261 137.176 330.043 213.199 1.00 33.49 N ANISOU16330 N TYR N 261 4066 3971 4687 -543 -519 -451 N ATOM 16331 CA TYR N 261 138.413 330.796 213.019 1.00 33.25 C ANISOU16331 CA TYR N 261 4009 3943 4681 -565 -531 -455 C ATOM 16332 C TYR N 261 138.189 332.297 212.903 1.00 34.36 C ANISOU16332 C TYR N 261 4170 4076 4808 -591 -514 -458 C ATOM 16333 O TYR N 261 139.156 333.069 212.929 1.00 38.34 O ANISOU16333 O TYR N 261 4657 4580 5329 -612 -526 -462 O ATOM 16334 CB TYR N 261 139.172 330.227 211.798 1.00 32.22 C ANISOU16334 CB TYR N 261 3832 3826 4585 -560 -523 -450 C ATOM 16335 CG TYR N 261 139.602 328.812 212.101 1.00 39.89 C ANISOU16335 CG TYR N 261 4780 4800 5575 -535 -547 -451 C ATOM 16336 CD1 TYR N 261 140.640 328.555 213.045 1.00 35.13 C ANISOU16336 CD1 TYR N 261 4161 4197 4989 -537 -586 -458 C ATOM 16337 CD2 TYR N 261 138.951 327.736 211.527 1.00 31.98 C ANISOU16337 CD2 TYR N 261 3775 3802 4575 -511 -532 -447 C ATOM 16338 CE1 TYR N 261 141.041 327.240 213.343 1.00 35.69 C ANISOU16338 CE1 TYR N 261 4211 4269 5082 -513 -610 -459 C ATOM 16339 CE2 TYR N 261 139.342 326.423 211.823 1.00 34.37 C ANISOU16339 CE2 TYR N 261 4057 4104 4899 -488 -555 -449 C ATOM 16340 CZ TYR N 261 140.400 326.186 212.740 1.00 38.12 C ANISOU16340 CZ TYR N 261 4514 4576 5392 -489 -595 -454 C ATOM 16341 OH TYR N 261 140.746 324.864 213.019 1.00 34.21 O ANISOU16341 OH TYR N 261 3999 4078 4921 -464 -619 -455 O ATOM 16342 N SER N 262 136.940 332.751 212.806 1.00 34.87 N ATOM 16343 CA SER N 262 136.657 334.161 213.039 1.00 32.25 C ATOM 16344 C SER N 262 136.562 334.463 214.528 1.00 42.24 C ATOM 16345 O SER N 262 136.321 335.604 214.896 1.00 32.37 O ATOM 16346 CB SER N 262 135.344 334.574 212.335 1.00 29.31 C ATOM 16347 OG SER N 262 135.424 334.402 210.940 1.00 40.26 O