>>3AG2:HELIX  108 AL9 ASP P  155  ALA P  184  1                                  30    
DRKHMLQALFITITLGVYFTLLQASEYYEA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 108 AL9 ASP P 155 ALA P 184 1 30 ATOM 21444 N ASP P 155 91.533 291.930 220.938 1.00 35.37 N ANISOU21444 N ASP P 155 4669 3946 4824 -534 -531 592 N ATOM 21445 CA ASP P 155 90.748 290.777 220.473 1.00 40.33 C ANISOU21445 CA ASP P 155 5272 4560 5490 -541 -532 601 C ATOM 21446 C ASP P 155 91.648 289.904 219.608 1.00 39.23 C ANISOU21446 C ASP P 155 5115 4378 5414 -527 -561 560 C ATOM 21447 O ASP P 155 91.855 290.178 218.421 1.00 37.35 O ANISOU21447 O ASP P 155 4865 4135 5193 -515 -548 507 O ATOM 21448 CB ASP P 155 89.527 291.280 219.701 1.00 37.87 C ANISOU21448 CB ASP P 155 4950 4277 5162 -547 -490 590 C ATOM 21449 CG ASP P 155 88.557 290.166 219.290 1.00 33.72 C ANISOU21449 CG ASP P 155 4402 3742 4669 -558 -489 604 C ATOM 21450 OD1 ASP P 155 88.943 288.954 219.174 1.00 36.59 O ANISOU21450 OD1 ASP P 155 4753 4069 5081 -556 -521 605 O ATOM 21451 OD2 ASP P 155 87.372 290.533 219.072 1.00 38.26 O ANISOU21451 OD2 ASP P 155 4970 4347 5220 -567 -456 615 O ATOM 21452 N ARG P 156 92.180 288.842 220.187 1.00 29.11 N ANISOU21452 N ARG P 156 3829 3066 4163 -527 -599 585 N ATOM 21453 CA ARG P 156 93.129 288.003 219.474 1.00 42.55 C ANISOU21453 CA ARG P 156 5516 4728 5924 -510 -628 547 C ATOM 21454 C ARG P 156 92.471 287.300 218.305 1.00 36.84 C ANISOU21454 C ARG P 156 4769 3993 5236 -510 -615 520 C ATOM 21455 O ARG P 156 93.026 287.238 217.190 1.00 37.04 O ANISOU21455 O ARG P 156 4781 4004 5289 -493 -613 464 O ATOM 21456 CB ARG P 156 93.704 286.985 220.453 1.00 37.41 C ANISOU21456 CB ARG P 156 4865 4049 5299 -512 -671 587 C ATOM 21457 CG ARG P 156 94.372 285.803 219.819 1.00 32.02 C ANISOU21457 CG ARG P 156 4162 3323 4682 -499 -701 562 C ATOM 21458 CD ARG P 156 95.059 284.956 220.962 1.00 34.80 C ANISOU21458 CD ARG P 156 4518 3650 5055 -500 -746 607 C ATOM 21459 NE ARG P 156 95.736 283.794 220.393 1.00 32.03 N ANISOU21459 NE ARG P 156 4146 3255 4770 -486 -776 583 N ATOM 21460 CZ ARG P 156 96.950 283.846 219.865 1.00 41.96 C ANISOU21460 CZ ARG P 156 5396 4492 6056 -463 -792 537 C ATOM 21461 NH1 ARG P 156 97.645 284.974 219.839 1.00 31.72 N ANISOU21461 NH1 ARG P 156 4110 3212 4730 -452 -783 511 N ATOM 21462 NH2 ARG P 156 97.467 282.754 219.363 1.00 34.76 N ANISOU21462 NH2 ARG P 156 4463 3542 5203 -450 -816 518 N ATOM 21463 N LYS P 157 91.307 286.706 218.561 1.00 33.13 N ANISOU21463 N LYS P 157 4293 3529 4765 -528 -608 559 N ATOM 21464 CA LYS P 157 90.680 285.864 217.554 1.00 36.95 C ANISOU21464 CA LYS P 157 4756 3998 5286 -530 -603 538 C ATOM 21465 C LYS P 157 90.329 286.681 216.310 1.00 37.61 C ANISOU21465 C LYS P 157 4833 4102 5355 -524 -567 487 C ATOM 21466 O LYS P 157 90.635 286.293 215.184 1.00 34.69 O ANISOU21466 O LYS P 157 4449 3715 5018 -512 -567 439 O ATOM 21467 CB LYS P 157 89.436 285.202 218.155 1.00 34.94 C ANISOU21467 CB LYS P 157 4497 3751 5028 -553 -600 593 C ATOM 21468 CG LYS P 157 88.700 284.250 217.200 1.00 54.07 C ANISOU21468 CG LYS P 157 6899 6155 7489 -559 -598 578 C ATOM 21469 CD LYS P 157 87.497 283.555 217.857 1.00 87.36 C ANISOU21469 CD LYS P 157 11109 10378 11704 -583 -598 635 C ATOM 21470 CE LYS P 157 86.252 284.422 217.826 1.00 66.15 C ANISOU21470 CE LYS P 157 8424 7738 8971 -596 -556 649 C ATOM 21471 NZ LYS P 157 84.984 283.604 217.691 1.00 76.72 N ANISOU21471 NZ LYS P 157 9746 9077 10325 -616 -551 676 N ATOM 21472 N HIS P 158 89.708 287.828 216.504 1.00 31.91 N ANISOU21472 N HIS P 158 4121 3419 4583 -532 -535 497 N ATOM 21473 CA HIS P 158 89.306 288.602 215.352 1.00 38.01 C ANISOU21473 CA HIS P 158 4886 4212 5342 -527 -502 453 C ATOM 21474 C HIS P 158 90.481 289.314 214.715 1.00 46.00 C ANISOU21474 C HIS P 158 5901 5221 6354 -506 -500 398 C ATOM 21475 O HIS P 158 90.435 289.545 213.517 1.00 31.80 O ANISOU21475 O HIS P 158 4092 3429 4562 -498 -481 351 O ATOM 21476 CB HIS P 158 88.202 289.574 215.720 1.00 33.22 C ANISOU21476 CB HIS P 158 4288 3649 4685 -542 -468 481 C ATOM 21477 CG HIS P 158 86.891 288.894 216.000 1.00 35.98 C ANISOU21477 CG HIS P 158 4628 4007 5036 -561 -461 524 C ATOM 21478 ND1 HIS P 158 86.182 289.087 217.177 1.00 35.56 N ANISOU21478 ND1 HIS P 158 4585 3979 4948 -575 -452 581 N ATOM 21479 CD2 HIS P 158 86.174 288.007 215.264 1.00 41.07 C ANISOU21479 CD2 HIS P 158 5254 4639 5713 -568 -462 517 C ATOM 21480 CE1 HIS P 158 85.085 288.334 217.148 1.00 36.49 C ANISOU21480 CE1 HIS P 158 4688 4099 5078 -590 -448 608 C ATOM 21481 NE2 HIS P 158 85.044 287.692 215.993 1.00 43.14 N ANISOU21481 NE2 HIS P 158 5513 4918 5961 -587 -454 571 N ATOM 21482 N MET P 159 91.550 289.654 215.456 1.00 34.83 N ANISOU21482 N MET P 159 4502 3800 4933 -497 -519 402 N ATOM 21483 CA MET P 159 92.735 290.186 214.772 1.00 31.05 C ANISOU21483 CA MET P 159 4021 3315 4461 -475 -520 347 C ATOM 21484 C MET P 159 93.258 289.137 213.790 1.00 31.68 C ANISOU21484 C MET P 159 4081 3366 4592 -461 -533 307 C ATOM 21485 O MET P 159 93.562 289.430 212.618 1.00 31.83 O ANISOU21485 O MET P 159 4088 3391 4615 -448 -515 254 O ATOM 21486 CB MET P 159 93.816 290.575 215.817 1.00 27.19 C ANISOU21486 CB MET P 159 3550 2819 3961 -469 -544 362 C ATOM 21487 CG MET P 159 95.074 291.348 215.284 1.00 33.77 C ANISOU21487 CG MET P 159 4383 3653 4794 -448 -543 309 C ATOM 21488 SD MET P 159 96.063 290.382 214.089 1.00 38.93 S ANISOU21488 SD MET P 159 5011 4278 5505 -423 -556 253 S ATOM 21489 CE MET P 159 97.666 291.197 214.307 1.00 32.47 C ANISOU21489 CE MET P 159 4199 3459 4681 -403 -568 222 C ATOM 21490 N LEU P 160 93.278 287.893 214.240 1.00 31.47 N ANISOU21490 N LEU P 160 4047 3308 4601 -465 -564 335 N ATOM 21491 CA LEU P 160 93.805 286.811 213.424 1.00 31.92 C ANISOU21491 CA LEU P 160 4087 3334 4708 -451 -580 301 C ATOM 21492 C LEU P 160 92.911 286.573 212.230 1.00 36.11 C ANISOU21492 C LEU P 160 4603 3872 5244 -457 -555 273 C ATOM 21493 O LEU P 160 93.409 286.357 211.124 1.00 31.44 O ANISOU21493 O LEU P 160 3999 3274 4672 -442 -549 222 O ATOM 21494 CB LEU P 160 93.926 285.522 214.246 1.00 31.82 C ANISOU21494 CB LEU P 160 4072 3286 4734 -457 -620 343 C ATOM 21495 CG LEU P 160 95.186 285.535 215.156 1.00 34.43 C ANISOU21495 CG LEU P 160 4410 3599 5074 -444 -653 355 C ATOM 21496 CD1 LEU P 160 95.071 284.458 216.271 1.00 38.66 C ANISOU21496 CD1 LEU P 160 4947 4108 5634 -456 -690 414 C ATOM 21497 CD2 LEU P 160 96.483 285.344 214.308 1.00 35.28 C ANISOU21497 CD2 LEU P 160 4503 3686 5214 -417 -662 298 C ATOM 21498 N GLN P 161 91.591 286.579 212.437 1.00 28.35 N ANISOU21498 N GLN P 161 3622 2905 4243 -478 -540 308 N ATOM 21499 CA GLN P 161 90.696 286.365 211.305 1.00 29.16 C ANISOU21499 CA GLN P 161 3712 3017 4351 -485 -518 283 C ATOM 21500 C GLN P 161 90.816 287.493 210.272 1.00 30.18 C ANISOU21500 C GLN P 161 3839 3177 4451 -476 -484 233 C ATOM 21501 O GLN P 161 90.914 287.251 209.052 1.00 31.33 O ANISOU21501 O GLN P 161 3972 3321 4610 -469 -474 186 O ATOM 21502 CB GLN P 161 89.263 286.226 211.810 1.00 29.77 C ANISOU21502 CB GLN P 161 3790 3109 4413 -510 -509 332 C ATOM 21503 CG GLN P 161 88.315 286.098 210.631 1.00 46.55 C ANISOU21503 CG GLN P 161 5900 5245 6540 -519 -487 306 C ATOM 21504 CD GLN P 161 86.898 285.884 211.060 1.00147.11 C ANISOU21504 CD GLN P 161 18633 17995 19266 -543 -479 353 C ATOM 21505 OE1 GLN P 161 86.137 285.219 210.373 1.00 60.56 O ANISOU21505 OE1 GLN P 161 7659 7027 8324 -553 -477 346 O ATOM 21506 NE2 GLN P 161 86.526 286.454 212.193 1.00 40.55 N ANISOU21506 NE2 GLN P 161 5150 4520 5739 -552 -474 402 N ATOM 21507 N ALA P 162 90.839 288.733 210.740 1.00 32.20 N ANISOU21507 N ALA P 162 4108 3462 4666 -477 -467 243 N ATOM 21508 CA ALA P 162 90.940 289.849 209.806 1.00 30.84 C ANISOU21508 CA ALA P 162 3933 3318 4465 -469 -435 199 C ATOM 21509 C ALA P 162 92.266 289.847 209.058 1.00 39.15 C ANISOU21509 C ALA P 162 4979 4360 5534 -446 -439 146 C ATOM 21510 O ALA P 162 92.333 290.202 207.863 1.00 31.36 O ANISOU21510 O ALA P 162 3984 3391 4541 -440 -416 100 O ATOM 21511 CB ALA P 162 90.736 291.165 210.576 1.00 30.71 C ANISOU21511 CB ALA P 162 3933 3331 4404 -474 -419 224 C ATOM 21512 N LEU P 163 93.352 289.496 209.757 1.00 29.90 N ANISOU21512 N LEU P 163 3813 3165 4382 -433 -467 152 N ATOM 21513 CA LEU P 163 94.663 289.489 209.118 1.00 31.89 C ANISOU21513 CA LEU P 163 4058 3409 4650 -411 -471 104 C ATOM 21514 C LEU P 163 94.746 288.347 208.116 1.00 28.39 C ANISOU21514 C LEU P 163 3598 2945 4245 -405 -478 73 C ATOM 21515 O LEU P 163 95.275 288.510 207.006 1.00 30.58 O ANISOU21515 O LEU P 163 3865 3232 4522 -393 -462 24 O ATOM 21516 CB LEU P 163 95.766 289.390 210.186 1.00 29.66 C ANISOU21516 CB LEU P 163 3783 3105 4380 -400 -503 122 C ATOM 21517 CG LEU P 163 97.230 289.412 209.725 1.00 31.77 C ANISOU21517 CG LEU P 163 4041 3364 4666 -375 -511 79 C ATOM 21518 CD1 LEU P 163 97.519 290.636 208.768 1.00 31.18 C ANISOU21518 CD1 LEU P 163 3964 3325 4557 -367 -474 33 C ATOM 21519 CD2 LEU P 163 98.106 289.535 210.987 1.00 27.79 C ANISOU21519 CD2 LEU P 163 3548 2844 4165 -369 -542 107 C ATOM 21520 N PHE P 164 94.177 287.195 208.477 1.00 32.38 N ANISOU21520 N PHE P 164 4100 3423 4781 -416 -500 102 N ATOM 21521 CA PHE P 164 94.118 286.073 207.539 1.00 36.03 C ANISOU21521 CA PHE P 164 4547 3863 5279 -413 -506 75 C ATOM 21522 C PHE P 164 93.351 286.426 206.249 1.00 37.00 C ANISOU21522 C PHE P 164 4663 4013 5381 -421 -473 40 C ATOM 21523 O PHE P 164 93.773 286.070 205.132 1.00 31.49 O ANISOU21523 O PHE P 164 3954 3313 4696 -412 -467 -6 O ATOM 21524 CB PHE P 164 93.476 284.866 208.230 1.00 33.88 C ANISOU21524 CB PHE P 164 4273 3559 5040 -427 -534 118 C ATOM 21525 CG PHE P 164 93.367 283.678 207.343 1.00 38.06 C ANISOU21525 CG PHE P 164 4788 4062 5609 -426 -544 92 C ATOM 21526 CD1 PHE P 164 94.424 282.816 207.218 1.00 51.39 C ANISOU21526 CD1 PHE P 164 6469 5717 7342 -408 -570 72 C ATOM 21527 CD2 PHE P 164 92.239 283.454 206.601 1.00 40.42 C ANISOU21527 CD2 PHE P 164 5082 4371 5903 -443 -527 85 C ATOM 21528 CE1 PHE P 164 94.334 281.738 206.380 1.00 61.97 C ANISOU21528 CE1 PHE P 164 7796 7032 8719 -407 -578 45 C ATOM 21529 CE2 PHE P 164 92.136 282.367 205.767 1.00 50.49 C ANISOU21529 CE2 PHE P 164 6347 5623 7215 -443 -537 59 C ATOM 21530 CZ PHE P 164 93.185 281.520 205.655 1.00 47.61 C ANISOU21530 CZ PHE P 164 5974 5224 6892 -425 -562 38 C ATOM 21531 N ILE P 165 92.226 287.113 206.381 1.00 32.59 N ANISOU21531 N ILE P 165 4110 3483 4790 -439 -452 63 N ATOM 21532 CA ILE P 165 91.455 287.544 205.212 1.00 35.33 C ANISOU21532 CA ILE P 165 4451 3859 5115 -448 -422 34 C ATOM 21533 C ILE P 165 92.277 288.525 204.377 1.00 36.91 C ANISOU21533 C ILE P 165 4649 4085 5289 -433 -399 -12 C ATOM 21534 O ILE P 165 92.311 288.436 203.157 1.00 31.26 O ANISOU21534 O ILE P 165 3925 3380 4572 -432 -385 -53 O ATOM 21535 CB ILE P 165 90.123 288.177 205.658 1.00 35.56 C ANISOU21535 CB ILE P 165 4485 3913 5115 -469 -405 73 C ATOM 21536 CG1 ILE P 165 89.168 287.064 206.112 1.00 30.69 C ANISOU21536 CG1 ILE P 165 3864 3274 4524 -487 -424 112 C ATOM 21537 CG2 ILE P 165 89.547 289.074 204.534 1.00 26.73 C ANISOU21537 CG2 ILE P 165 3360 2833 3964 -474 -371 42 C ATOM 21538 CD1 ILE P 165 88.035 287.556 207.049 1.00 31.04 C ANISOU21538 CD1 ILE P 165 3914 3336 4543 -505 -416 168 C ATOM 21539 N THR P 166 93.007 289.436 205.032 1.00 28.66 N ANISOU21539 N THR P 166 3614 3050 4225 -423 -396 -6 N ATOM 21540 CA THR P 166 93.855 290.378 204.295 1.00 30.13 C ANISOU21540 CA THR P 166 3798 3261 4389 -409 -376 -47 C ATOM 21541 C THR P 166 94.901 289.643 203.457 1.00 36.61 C ANISOU21541 C THR P 166 4608 4066 5236 -392 -385 -90 C ATOM 21542 O THR P 166 95.123 289.960 202.280 1.00 32.33 O ANISOU21542 O THR P 166 4060 3545 4681 -389 -366 -129 O ATOM 21543 CB THR P 166 94.551 291.324 205.274 1.00 31.45 C ANISOU21543 CB THR P 166 3977 3434 4537 -400 -378 -31 C ATOM 21544 OG1 THR P 166 93.584 291.933 206.146 1.00 27.34 O ANISOU21544 OG1 THR P 166 3468 2927 3994 -415 -372 11 O ATOM 21545 CG2 THR P 166 95.276 292.422 204.496 1.00 23.46 C ANISOU21545 CG2 THR P 166 2963 2452 3498 -389 -353 -71 C ATOM 21546 N ILE P 167 95.552 288.652 204.054 1.00 36.10 N ANISOU21546 N ILE P 167 4541 3964 5211 -382 -417 -80 N ATOM 21547 CA ILE P 167 96.597 287.899 203.364 1.00 31.40 C ANISOU21547 CA ILE P 167 3933 3349 4648 -364 -429 -117 C ATOM 21548 C ILE P 167 95.997 287.115 202.193 1.00 31.03 C ANISOU21548 C ILE P 167 3877 3300 4614 -372 -423 -144 C ATOM 21549 O ILE P 167 96.571 287.057 201.091 1.00 35.86 O ANISOU21549 O ILE P 167 4479 3919 5226 -362 -413 -187 O ATOM 21550 CB ILE P 167 97.315 286.974 204.372 1.00 31.89 C ANISOU21550 CB ILE P 167 3994 3369 4753 -353 -467 -95 C ATOM 21551 CG1 ILE P 167 98.151 287.840 205.342 1.00 28.27 C ANISOU21551 CG1 ILE P 167 3544 2917 4280 -342 -473 -79 C ATOM 21552 CG2 ILE P 167 98.199 285.929 203.607 1.00 33.76 C ANISOU21552 CG2 ILE P 167 4215 3579 5034 -335 -483 -133 C ATOM 21553 CD1 ILE P 167 98.653 287.061 206.632 1.00 26.57 C ANISOU21553 CD1 ILE P 167 3332 2663 4101 -337 -515 -41 C ATOM 21554 N THR P 168 94.884 286.443 202.449 1.00 28.94 N ANISOU21554 N THR P 168 3614 3022 4361 -390 -431 -117 N ATOM 21555 CA THR P 168 94.156 285.736 201.398 1.00 28.77 C ANISOU21555 CA THR P 168 3584 2998 4349 -402 -427 -139 C ATOM 21556 C THR P 168 93.882 286.638 200.204 1.00 32.44 C ANISOU21556 C THR P 168 4047 3505 4772 -408 -394 -172 C ATOM 21557 O THR P 168 94.070 286.229 199.045 1.00 34.99 O ANISOU21557 O THR P 168 4363 3831 5101 -406 -390 -211 O ATOM 21558 CB THR P 168 92.868 285.168 202.015 1.00 32.70 C ANISOU21558 CB THR P 168 4085 3482 4857 -424 -437 -96 C ATOM 21559 OG1 THR P 168 93.277 284.248 203.053 1.00 37.01 O ANISOU21559 OG1 THR P 168 4631 3986 5444 -418 -471 -66 O ATOM 21560 CG2 THR P 168 92.059 284.412 200.991 1.00 36.12 C ANISOU21560 CG2 THR P 168 4511 3913 5302 -439 -434 -117 C ATOM 21561 N LEU P 169 93.410 287.858 200.458 1.00 34.01 N ANISOU21561 N LEU P 169 4253 3738 4929 -416 -371 -156 N ATOM 21562 CA LEU P 169 93.133 288.769 199.347 1.00 34.36 C ANISOU21562 CA LEU P 169 4296 3824 4935 -423 -342 -183 C ATOM 21563 C LEU P 169 94.424 289.162 198.614 1.00 36.90 C ANISOU21563 C LEU P 169 4614 4156 5248 -403 -335 -223 C ATOM 21564 O LEU P 169 94.446 289.220 197.378 1.00 31.29 O ANISOU21564 O LEU P 169 3898 3465 4525 -406 -324 -256 O ATOM 21565 CB LEU P 169 92.401 290.016 199.886 1.00 27.87 C ANISOU21565 CB LEU P 169 3483 3033 4075 -433 -321 -155 C ATOM 21566 CG LEU P 169 90.984 289.645 200.319 1.00 28.99 C ANISOU21566 CG LEU P 169 3623 3170 4222 -454 -324 -120 C ATOM 21567 CD1 LEU P 169 90.476 290.800 201.165 1.00 26.21 C ANISOU21567 CD1 LEU P 169 3279 2839 3841 -459 -310 -86 C ATOM 21568 CD2 LEU P 169 90.055 289.454 199.050 1.00 26.95 C ANISOU21568 CD2 LEU P 169 3356 2931 3953 -472 -311 -142 C ATOM 21569 N GLY P 170 95.525 289.378 199.346 1.00 29.45 N ANISOU21569 N GLY P 170 3673 3201 4315 -384 -345 -219 N ATOM 21570 CA GLY P 170 96.809 289.668 198.689 1.00 29.61 C ANISOU21570 CA GLY P 170 3687 3229 4334 -365 -340 -255 C ATOM 21571 C GLY P 170 97.274 288.513 197.810 1.00 31.14 C ANISOU21571 C GLY P 170 3868 3402 4563 -356 -354 -289 C ATOM 21572 O GLY P 170 97.785 288.712 196.705 1.00 32.93 O ANISOU21572 O GLY P 170 4086 3646 4779 -348 -342 -325 O ATOM 21573 N VAL P 171 97.069 287.286 198.275 1.00 33.25 N ANISOU21573 N VAL P 171 4132 3630 4872 -356 -379 -278 N ATOM 21574 CA VAL P 171 97.415 286.110 197.489 1.00 32.23 C ANISOU21574 CA VAL P 171 3990 3476 4781 -348 -394 -310 C ATOM 21575 C VAL P 171 96.520 285.991 196.262 1.00 38.72 C ANISOU21575 C VAL P 171 4811 4317 5584 -365 -379 -332 C ATOM 21576 O VAL P 171 96.989 285.662 195.167 1.00 41.98 O ANISOU21576 O VAL P 171 5213 4733 6004 -357 -377 -373 O ATOM 21577 CB VAL P 171 97.349 284.836 198.356 1.00 36.62 C ANISOU21577 CB VAL P 171 4544 3982 5387 -346 -426 -288 C ATOM 21578 CG1 VAL P 171 97.433 283.590 197.480 1.00 40.98 C ANISOU21578 CG1 VAL P 171 5084 4508 5978 -342 -440 -321 C ATOM 21579 CG2 VAL P 171 98.493 284.862 199.338 1.00 36.81 C ANISOU21579 CG2 VAL P 171 4566 3986 5434 -325 -445 -275 C ATOM 21580 N TYR P 172 95.219 286.217 196.441 1.00 33.81 N ANISOU21580 N TYR P 172 4196 3708 4940 -389 -371 -306 N ATOM 21581 CA TYR P 172 94.266 286.223 195.345 1.00 30.56 C ANISOU21581 CA TYR P 172 3785 3320 4508 -409 -358 -322 C ATOM 21582 C TYR P 172 94.677 287.218 194.266 1.00 39.43 C ANISOU21582 C TYR P 172 4905 4484 5592 -405 -336 -351 C ATOM 21583 O TYR P 172 94.613 286.908 193.069 1.00 34.27 O ANISOU21583 O TYR P 172 4245 3840 4936 -408 -333 -384 O ATOM 21584 CB TYR P 172 92.877 286.559 195.904 1.00 31.22 C ANISOU21584 CB TYR P 172 3874 3415 4571 -434 -351 -283 C ATOM 21585 CG TYR P 172 91.702 286.378 194.972 1.00 38.10 C ANISOU21585 CG TYR P 172 4743 4304 5428 -458 -343 -292 C ATOM 21586 CD1 TYR P 172 91.750 285.478 193.908 1.00 57.21 C ANISOU21586 CD1 TYR P 172 7156 6713 7866 -460 -353 -328 C ATOM 21587 CD2 TYR P 172 90.523 287.104 195.168 1.00 40.81 C ANISOU21587 CD2 TYR P 172 5089 4675 5741 -479 -328 -265 C ATOM 21588 CE1 TYR P 172 90.634 285.302 193.080 1.00 40.43 C ANISOU21588 CE1 TYR P 172 5028 4605 5728 -484 -348 -334 C ATOM 21589 CE2 TYR P 172 89.402 286.937 194.346 1.00 40.65 C ANISOU21589 CE2 TYR P 172 5063 4672 5708 -502 -322 -271 C ATOM 21590 CZ TYR P 172 89.463 286.038 193.313 1.00 44.53 C ANISOU21590 CZ TYR P 172 5550 5153 6216 -506 -334 -305 C ATOM 21591 OH TYR P 172 88.344 285.865 192.525 1.00 41.82 O ANISOU21591 OH TYR P 172 5202 4827 5861 -531 -331 -310 O ATOM 21592 N PHE P 173 95.109 288.413 194.675 1.00 33.80 N ANISOU21592 N PHE P 173 4198 3795 4850 -398 -321 -339 N ATOM 21593 CA PHE P 173 95.564 289.420 193.722 1.00 37.84 C ANISOU21593 CA PHE P 173 4708 4344 5326 -394 -301 -362 C ATOM 21594 C PHE P 173 96.737 288.881 192.910 1.00 36.76 C ANISOU21594 C PHE P 173 4558 4197 5213 -372 -308 -404 C ATOM 21595 O PHE P 173 96.779 289.007 191.693 1.00 33.70 O ANISOU21595 O PHE P 173 4162 3829 4811 -372 -299 -434 O ATOM 21596 CB PHE P 173 95.953 290.727 194.455 1.00 26.71 C ANISOU21596 CB PHE P 173 3306 2955 3888 -388 -287 -341 C ATOM 21597 CG PHE P 173 96.582 291.751 193.529 1.00 31.21 C ANISOU21597 CG PHE P 173 3872 3559 4427 -380 -270 -362 C ATOM 21598 CD1 PHE P 173 97.940 291.668 193.214 1.00 34.16 C ANISOU21598 CD1 PHE P 173 4236 3927 4818 -356 -273 -390 C ATOM 21599 CD2 PHE P 173 95.805 292.758 192.933 1.00 30.39 C ANISOU21599 CD2 PHE P 173 3772 3492 4282 -396 -253 -354 C ATOM 21600 CE1 PHE P 173 98.537 292.569 192.270 1.00 27.86 C ANISOU21600 CE1 PHE P 173 3431 3160 3996 -348 -257 -412 C ATOM 21601 CE2 PHE P 173 96.392 293.706 192.051 1.00 35.15 C ANISOU21601 CE2 PHE P 173 4370 4124 4860 -387 -240 -372 C ATOM 21602 CZ PHE P 173 97.754 293.603 191.725 1.00 28.20 C ANISOU21602 CZ PHE P 173 3479 3238 3997 -363 -241 -401 C ATOM 21603 N THR P 174 97.696 288.257 193.604 1.00 31.64 N ANISOU21603 N THR P 174 3904 3515 4603 -352 -324 -407 N ATOM 21604 CA THR P 174 98.898 287.750 192.968 1.00 34.17 C ANISOU21604 CA THR P 174 4207 3823 4951 -328 -331 -447 C ATOM 21605 C THR P 174 98.536 286.651 191.980 1.00 36.42 C ANISOU21605 C THR P 174 4483 4094 5259 -333 -339 -478 C ATOM 21606 O THR P 174 98.986 286.668 190.834 1.00 40.27 O ANISOU21606 O THR P 174 4960 4598 5744 -324 -331 -517 O ATOM 21607 CB THR P 174 99.880 287.251 194.047 1.00 37.25 C ANISOU21607 CB THR P 174 4593 4178 5382 -308 -351 -438 C ATOM 21608 OG1 THR P 174 100.162 288.328 194.930 1.00 36.80 O ANISOU21608 OG1 THR P 174 4546 4136 5301 -306 -343 -410 O ATOM 21609 CG2 THR P 174 101.221 286.794 193.447 1.00 36.60 C ANISOU21609 CG2 THR P 174 4490 4084 5332 -282 -357 -480 C ATOM 21610 N LEU P 175 97.686 285.721 192.389 1.00 35.80 N ANISOU21610 N LEU P 175 4410 3988 5204 -346 -356 -462 N ATOM 21611 CA LEU P 175 97.284 284.663 191.471 1.00 37.53 C ANISOU21611 CA LEU P 175 4622 4192 5445 -353 -365 -492 C ATOM 21612 C LEU P 175 96.544 285.240 190.288 1.00 45.73 C ANISOU21612 C LEU P 175 5662 5271 6441 -370 -347 -507 C ATOM 21613 O LEU P 175 96.788 284.835 189.147 1.00 41.68 O ANISOU21613 O LEU P 175 5139 4763 5935 -365 -346 -549 O ATOM 21614 CB LEU P 175 96.414 283.621 192.180 1.00 36.97 C ANISOU21614 CB LEU P 175 4557 4085 5405 -367 -386 -466 C ATOM 21615 CG LEU P 175 97.223 282.929 193.285 1.00 42.17 C ANISOU21615 CG LEU P 175 5211 4700 6112 -348 -409 -452 C ATOM 21616 CD1 LEU P 175 96.360 281.914 194.009 1.00 44.69 C ANISOU21616 CD1 LEU P 175 5536 4982 6464 -362 -431 -423 C ATOM 21617 CD2 LEU P 175 98.406 282.245 192.671 1.00 50.79 C ANISOU21617 CD2 LEU P 175 6286 5772 7242 -322 -419 -497 C ATOM 21618 N LEU P 176 95.656 286.203 190.530 1.00 32.29 N ANISOU21618 N LEU P 176 3973 3600 4698 -390 -333 -475 N ATOM 21619 CA LEU P 176 94.926 286.774 189.401 1.00 32.14 C ANISOU21619 CA LEU P 176 3954 3618 4639 -407 -319 -487 C ATOM 21620 C LEU P 176 95.892 287.446 188.472 1.00 40.84 C ANISOU21620 C LEU P 176 5045 4747 5724 -389 -305 -519 C ATOM 21621 O LEU P 176 95.780 287.324 187.251 1.00 33.51 O ANISOU21621 O LEU P 176 4109 3836 4788 -391 -302 -552 O ATOM 21622 CB LEU P 176 93.872 287.787 189.863 1.00 36.05 C ANISOU21622 CB LEU P 176 4461 4142 5094 -429 -306 -445 C ATOM 21623 CG LEU P 176 92.684 287.128 190.557 1.00 35.35 C ANISOU21623 CG LEU P 176 4379 4035 5019 -451 -317 -416 C ATOM 21624 CD1 LEU P 176 91.981 288.134 191.426 1.00 36.42 C ANISOU21624 CD1 LEU P 176 4523 4190 5124 -464 -303 -374 C ATOM 21625 CD2 LEU P 176 91.704 286.513 189.496 1.00 32.04 C ANISOU21625 CD2 LEU P 176 3955 3621 4596 -473 -322 -434 C ATOM 21626 N GLN P 177 96.889 288.109 189.045 1.00 31.12 N ANISOU21626 N GLN P 177 3814 3519 4493 -370 -298 -513 N ATOM 21627 CA GLN P 177 97.795 288.879 188.222 1.00 34.37 C ANISOU21627 CA GLN P 177 4213 3959 4887 -353 -283 -541 C ATOM 21628 C GLN P 177 98.697 287.948 187.425 1.00 39.52 C ANISOU21628 C GLN P 177 4846 4596 5574 -334 -289 -591 C ATOM 21629 O GLN P 177 98.986 288.214 186.254 1.00 38.73 O ANISOU21629 O GLN P 177 4733 4522 5460 -329 -277 -626 O ATOM 21630 CB GLN P 177 98.591 289.840 189.108 1.00 36.51 C ANISOU21630 CB GLN P 177 4488 4237 5148 -340 -274 -519 C ATOM 21631 CG GLN P 177 99.226 290.985 188.407 1.00 49.12 C ANISOU21631 CG GLN P 177 6076 5870 6716 -331 -254 -534 C ATOM 21632 CD GLN P 177 98.250 291.982 187.754 1.00 75.89 C ANISOU21632 CD GLN P 177 9473 9299 10061 -350 -240 -520 C ATOM 21633 OE1 GLN P 177 97.189 291.629 187.190 1.00 44.23 O ANISOU21633 OE1 GLN P 177 5466 5296 6043 -368 -244 -520 O ATOM 21634 NE2 GLN P 177 98.660 293.235 187.772 1.00 34.69 N ANISOU21634 NE2 GLN P 177 4255 4108 4817 -344 -224 -510 N ATOM 21635 N ALA P 178 99.070 286.811 188.014 1.00 36.85 N ANISOU21635 N ALA P 178 4505 4215 5283 -324 -309 -597 N ATOM 21636 CA ALA P 178 99.912 285.858 187.297 1.00 46.34 C ANISOU21636 CA ALA P 178 5686 5398 6523 -305 -316 -646 C ATOM 21637 C ALA P 178 99.143 285.237 186.151 1.00 45.16 C ANISOU21637 C ALA P 178 5534 5255 6371 -319 -318 -675 C ATOM 21638 O ALA P 178 99.672 285.061 185.051 1.00 37.62 O ANISOU21638 O ALA P 178 4562 4313 5419 -307 -311 -722 O ATOM 21639 CB ALA P 178 100.408 284.765 188.239 1.00 44.77 C ANISOU21639 CB ALA P 178 5484 5148 6379 -291 -341 -641 C ATOM 21640 N SER P 179 97.882 284.928 186.378 1.00 34.82 N ANISOU21640 N SER P 179 4239 3937 5053 -344 -327 -649 N ATOM 21641 CA SER P 179 97.078 284.400 185.290 1.00 40.40 C ANISOU21641 CA SER P 179 4944 4651 5753 -360 -330 -675 C ATOM 21642 C SER P 179 96.894 285.437 184.186 1.00 40.47 C ANISOU21642 C SER P 179 4950 4713 5715 -366 -309 -689 C ATOM 21643 O SER P 179 96.947 285.097 183.001 1.00 37.38 O ANISOU21643 O SER P 179 4546 4333 5322 -365 -306 -732 O ATOM 21644 CB SER P 179 95.745 283.920 185.864 1.00 36.37 C ANISOU21644 CB SER P 179 4450 4123 5244 -388 -343 -639 C ATOM 21645 OG SER P 179 94.717 283.881 184.897 1.00 48.65 O ANISOU21645 OG SER P 179 6008 5701 6776 -411 -342 -650 O ATOM 21646 N GLU P 180 96.673 286.707 184.549 1.00 33.31 N ANISOU21646 N GLU P 180 4052 3836 4769 -372 -294 -654 N ATOM 21647 CA GLU P 180 96.553 287.759 183.542 1.00 35.45 C ANISOU21647 CA GLU P 180 4317 4155 4998 -376 -275 -665 C ATOM 21648 C GLU P 180 97.829 287.876 182.735 1.00 39.24 C ANISOU21648 C GLU P 180 4775 4649 5485 -351 -262 -712 C ATOM 21649 O GLU P 180 97.781 288.126 181.522 1.00 38.31 O ANISOU21649 O GLU P 180 4645 4564 5347 -352 -250 -744 O ATOM 21650 CB GLU P 180 96.289 289.133 184.188 1.00 39.96 C ANISOU21650 CB GLU P 180 4899 4751 5533 -382 -262 -620 C ATOM 21651 CG GLU P 180 94.935 289.344 184.702 1.00 71.77 C ANISOU21651 CG GLU P 180 8944 8782 9543 -408 -269 -576 C ATOM 21652 CD GLU P 180 94.178 290.278 183.829 1.00129.80 C ANISOU21652 CD GLU P 180 16291 16174 16853 -422 -258 -571 C ATOM 21653 OE1 GLU P 180 94.335 291.524 183.986 1.00 52.32 O ANISOU21653 OE1 GLU P 180 6479 6388 7013 -417 -243 -552 O ATOM 21654 OE2 GLU P 180 93.451 289.740 182.971 1.00 49.60 O ANISOU21654 OE2 GLU P 180 6129 6023 6692 -436 -266 -589 O ATOM 21655 N TYR P 181 98.986 287.765 183.410 1.00 32.62 N ANISOU21655 N TYR P 181 3930 3791 4674 -328 -262 -717 N ATOM 21656 CA TYR P 181 100.263 287.820 182.696 1.00 35.53 C ANISOU21656 CA TYR P 181 4273 4172 5054 -304 -250 -763 C ATOM 21657 C TYR P 181 100.310 286.731 181.630 1.00 37.66 C ANISOU21657 C TYR P 181 4529 4435 5346 -300 -256 -816 C ATOM 21658 O TYR P 181 100.717 286.976 180.499 1.00 32.55 O ANISOU21658 O TYR P 181 3862 3820 4685 -294 -239 -857 O ATOM 21659 CB TYR P 181 101.454 287.653 183.658 1.00 34.90 C ANISOU21659 CB TYR P 181 4187 4064 5009 -281 -255 -760 C ATOM 21660 CG TYR P 181 101.946 288.956 184.284 1.00 36.75 C ANISOU21660 CG TYR P 181 4425 4320 5219 -276 -241 -729 C ATOM 21661 CD1 TYR P 181 101.116 290.083 184.324 1.00 33.35 C ANISOU21661 CD1 TYR P 181 4010 3920 4742 -294 -229 -694 C ATOM 21662 CD2 TYR P 181 103.255 289.057 184.819 1.00 36.17 C ANISOU21662 CD2 TYR P 181 4337 4234 5170 -252 -240 -737 C ATOM 21663 CE1 TYR P 181 101.595 291.302 184.887 1.00 36.67 C ANISOU21663 CE1 TYR P 181 4434 4358 5141 -289 -216 -669 C ATOM 21664 CE2 TYR P 181 103.721 290.229 185.386 1.00 37.04 C ANISOU21664 CE2 TYR P 181 4451 4362 5258 -249 -229 -712 C ATOM 21665 CZ TYR P 181 102.899 291.341 185.403 1.00 37.32 C ANISOU21665 CZ TYR P 181 4504 4427 5248 -267 -216 -678 C ATOM 21666 OH TYR P 181 103.359 292.532 185.919 1.00 37.25 O ANISOU21666 OH TYR P 181 4499 4437 5219 -264 -204 -655 O ATOM 21667 N TYR P 182 99.932 285.515 182.007 1.00 38.82 N ANISOU21667 N TYR P 182 4682 4540 5529 -304 -278 -817 N ATOM 21668 CA TYR P 182 99.939 284.407 181.068 1.00 54.82 C ANISOU21668 CA TYR P 182 6695 6553 7579 -302 -287 -867 C ATOM 21669 C TYR P 182 98.946 284.621 179.938 1.00 50.99 C ANISOU21669 C TYR P 182 6213 6103 7057 -323 -280 -881 C ATOM 21670 O TYR P 182 99.259 284.320 178.789 1.00 40.84 O ANISOU21670 O TYR P 182 4911 4835 5771 -317 -273 -932 O ATOM 21671 CB TYR P 182 99.644 283.092 181.778 1.00 42.22 C ANISOU21671 CB TYR P 182 5108 4902 6031 -304 -314 -860 C ATOM 21672 CG TYR P 182 99.810 281.910 180.834 1.00 50.97 C ANISOU21672 CG TYR P 182 6201 5994 7170 -298 -324 -917 C ATOM 21673 CD1 TYR P 182 101.072 281.574 180.311 1.00 45.78 C ANISOU21673 CD1 TYR P 182 5518 5336 6542 -270 -318 -969 C ATOM 21674 CD2 TYR P 182 98.706 281.161 180.428 1.00 48.48 C ANISOU21674 CD2 TYR P 182 5897 5667 6857 -320 -338 -922 C ATOM 21675 CE1 TYR P 182 101.224 280.511 179.417 1.00 46.65 C ANISOU21675 CE1 TYR P 182 5613 5431 6679 -264 -326 -1024 C ATOM 21676 CE2 TYR P 182 98.852 280.085 179.545 1.00 62.46 C ANISOU21676 CE2 TYR P 182 7655 7422 8656 -315 -347 -977 C ATOM 21677 CZ TYR P 182 100.111 279.761 179.055 1.00 49.81 C ANISOU21677 CZ TYR P 182 6028 5818 7081 -286 -341 -1028 C ATOM 21678 OH TYR P 182 100.246 278.694 178.190 1.00 67.19 O ANISOU21678 OH TYR P 182 8215 8003 9310 -280 -350 -1084 O ATOM 21679 N GLU P 183 97.768 285.170 180.223 1.00 34.33 N ANISOU21679 N GLU P 183 4123 4005 4915 -349 -282 -837 N ATOM 21680 CA GLU P 183 96.761 285.374 179.181 1.00 35.69 C ANISOU21680 CA GLU P 183 4298 4210 5053 -370 -279 -846 C ATOM 21681 C GLU P 183 96.981 286.594 178.326 1.00 41.44 C ANISOU21681 C GLU P 183 5014 4994 5737 -368 -254 -857 C ATOM 21682 O GLU P 183 96.350 286.700 177.261 1.00 41.70 O ANISOU21682 O GLU P 183 5043 5058 5744 -381 -250 -877 O ATOM 21683 CB GLU P 183 95.356 285.511 179.791 1.00 38.56 C ANISOU21683 CB GLU P 183 4683 4568 5400 -399 -291 -795 C ATOM 21684 CG GLU P 183 94.942 284.323 180.582 1.00 41.78 C ANISOU21684 CG GLU P 183 5102 4925 5847 -408 -315 -782 C ATOM 21685 CD GLU P 183 94.742 283.097 179.730 1.00 76.92 C ANISOU21685 CD GLU P 183 9546 9358 10323 -412 -329 -827 C ATOM 21686 OE1 GLU P 183 94.931 281.997 180.275 1.00 45.17 O ANISOU21686 OE1 GLU P 183 5527 5291 6347 -407 -347 -833 O ATOM 21687 OE2 GLU P 183 94.380 283.221 178.542 1.00 54.35 O ANISOU21687 OE2 GLU P 183 6681 6531 7440 -421 -324 -857 O ATOM 21688 N ALA P 184 97.818 287.522 178.757 1.00 31.45 N ATOM 21689 CA ALA P 184 97.972 288.754 178.010 1.00 31.75 C ATOM 21690 C ALA P 184 98.436 288.446 176.588 1.00 33.30 C ATOM 21691 O ALA P 184 99.435 287.741 176.422 1.00 37.55 O ATOM 21692 CB ALA P 184 98.983 289.693 178.677 1.00 32.69 C