>>3AG2:HELIX   81 AI9 PRO N  182  LEU N  215  1                                  34    
PLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNL
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 81 AI9 PRO N 182 LEU N 215 1 34 ATOM 15703 N PRO N 182 123.062 322.961 215.011 1.00 32.77 N ANISOU15703 N PRO N 182 4219 3857 4375 -375 -391 -375 N ATOM 15704 CA PRO N 182 124.111 323.656 214.245 1.00 30.50 C ANISOU15704 CA PRO N 182 3912 3575 4103 -387 -383 -381 C ATOM 15705 C PRO N 182 123.849 323.565 212.735 1.00 31.98 C ANISOU15705 C PRO N 182 4085 3768 4297 -387 -352 -375 C ATOM 15706 O PRO N 182 123.263 322.610 212.239 1.00 30.62 O ANISOU15706 O PRO N 182 3908 3598 4128 -376 -345 -367 O ATOM 15707 CB PRO N 182 125.399 322.912 214.657 1.00 29.84 C ANISOU15707 CB PRO N 182 3804 3487 4044 -382 -421 -383 C ATOM 15708 CG PRO N 182 125.049 322.343 216.130 1.00 29.53 C ANISOU15708 CG PRO N 182 3786 3440 3993 -373 -455 -380 C ATOM 15709 CD PRO N 182 123.596 321.868 215.860 1.00 31.25 C ANISOU15709 CD PRO N 182 4020 3658 4195 -364 -432 -370 C ATOM 15710 N LEU N 183 124.373 324.540 212.004 1.00 26.88 N ANISOU15710 N LEU N 183 3432 3127 3655 -401 -338 -378 N ATOM 15711 CA LEU N 183 124.186 324.581 210.546 1.00 28.64 C ANISOU15711 CA LEU N 183 3642 3357 3883 -403 -313 -370 C ATOM 15712 C LEU N 183 124.725 323.340 209.829 1.00 30.92 C ANISOU15712 C LEU N 183 3900 3651 4198 -389 -322 -368 C ATOM 15713 O LEU N 183 124.161 322.935 208.802 1.00 27.20 O ANISOU15713 O LEU N 183 3423 3185 3727 -383 -304 -361 O ATOM 15714 CB LEU N 183 124.831 325.834 209.985 1.00 27.18 C ANISOU15714 CB LEU N 183 3453 3174 3702 -420 -305 -372 C ATOM 15715 CG LEU N 183 124.133 327.138 210.376 1.00 32.32 C ANISOU15715 CG LEU N 183 4134 3817 4329 -434 -290 -373 C ATOM 15716 CD1 LEU N 183 124.882 328.306 209.712 1.00 30.00 C ANISOU15716 CD1 LEU N 183 3832 3522 4046 -451 -286 -373 C ATOM 15717 CD2 LEU N 183 122.660 327.082 209.899 1.00 30.62 C ANISOU15717 CD2 LEU N 183 3938 3601 4093 -428 -264 -363 C ATOM 15718 N PHE N 184 125.804 322.692 210.331 1.00 27.67 N ANISOU15718 N PHE N 184 3467 3236 3810 -382 -351 -375 N ATOM 15719 CA PHE N 184 126.229 321.483 209.622 1.00 28.01 C ANISOU15719 CA PHE N 184 3480 3282 3882 -367 -357 -376 C ATOM 15720 C PHE N 184 125.164 320.411 209.702 1.00 37.35 C ANISOU15720 C PHE N 184 4674 4461 5057 -352 -354 -369 C ATOM 15721 O PHE N 184 124.978 319.642 208.755 1.00 28.71 O ANISOU15721 O PHE N 184 3563 3370 3976 -341 -343 -369 O ATOM 15722 CB PHE N 184 127.539 320.904 210.164 1.00 27.20 C ANISOU15722 CB PHE N 184 3352 3173 3810 -360 -391 -384 C ATOM 15723 CG PHE N 184 127.955 319.613 209.448 1.00 27.85 C ANISOU15723 CG PHE N 184 3402 3256 3926 -341 -397 -389 C ATOM 15724 CD1 PHE N 184 128.328 319.645 208.105 1.00 27.24 C ANISOU15724 CD1 PHE N 184 3296 3188 3865 -340 -377 -395 C ATOM 15725 CD2 PHE N 184 128.004 318.389 210.105 1.00 26.77 C ANISOU15725 CD2 PHE N 184 3260 3106 3805 -324 -423 -388 C ATOM 15726 CE1 PHE N 184 128.736 318.472 207.397 1.00 34.32 C ANISOU15726 CE1 PHE N 184 4161 4084 4795 -322 -380 -405 C ATOM 15727 CE2 PHE N 184 128.417 317.209 209.387 1.00 31.10 C ANISOU15727 CE2 PHE N 184 3777 3652 4389 -306 -428 -395 C ATOM 15728 CZ PHE N 184 128.764 317.265 208.038 1.00 29.16 C ANISOU15728 CZ PHE N 184 3504 3417 4159 -304 -405 -405 C ATOM 15729 N VAL N 185 124.485 320.321 210.843 1.00 28.41 N ANISOU15729 N VAL N 185 3568 3321 3906 -351 -364 -364 N ATOM 15730 CA VAL N 185 123.409 319.345 211.018 1.00 29.31 C ANISOU15730 CA VAL N 185 3694 3430 4013 -338 -362 -356 C ATOM 15731 C VAL N 185 122.259 319.649 210.047 1.00 27.60 C ANISOU15731 C VAL N 185 3489 3222 3777 -342 -326 -350 C ATOM 15732 O VAL N 185 121.721 318.749 209.400 1.00 29.63 O ANISOU15732 O VAL N 185 3739 3480 4040 -332 -318 -346 O ATOM 15733 CB VAL N 185 122.931 319.317 212.501 1.00 29.22 C ANISOU15733 CB VAL N 185 3709 3409 3985 -338 -384 -352 C ATOM 15734 CG1 VAL N 185 121.668 318.403 212.653 1.00 26.17 C ANISOU15734 CG1 VAL N 185 3337 3018 3589 -327 -380 -341 C ATOM 15735 CG2 VAL N 185 124.077 318.765 213.464 1.00 27.39 C ANISOU15735 CG2 VAL N 185 3465 3168 3775 -332 -428 -355 C ATOM 15736 N TRP N 186 121.841 320.914 209.962 1.00 28.14 N ANISOU15736 N TRP N 186 3576 3294 3821 -356 -305 -349 N ATOM 15737 CA TRP N 186 120.855 321.311 208.928 1.00 26.89 C ANISOU15737 CA TRP N 186 3427 3143 3647 -361 -274 -341 C ATOM 15738 C TRP N 186 121.314 320.886 207.546 1.00 31.38 C ANISOU15738 C TRP N 186 3967 3719 4235 -355 -267 -341 C ATOM 15739 O TRP N 186 120.523 320.419 206.726 1.00 31.31 O ANISOU15739 O TRP N 186 3957 3715 4223 -349 -252 -335 O ATOM 15740 CB TRP N 186 120.674 322.831 208.917 1.00 24.73 C ANISOU15740 CB TRP N 186 3171 2869 3354 -377 -259 -341 C ATOM 15741 CG TRP N 186 119.621 323.330 209.884 1.00 29.64 C ANISOU15741 CG TRP N 186 3824 3486 3952 -379 -250 -342 C ATOM 15742 CD1 TRP N 186 119.819 323.999 211.090 1.00 30.00 C ANISOU15742 CD1 TRP N 186 3882 3524 3991 -384 -261 -353 C ATOM 15743 CD2 TRP N 186 118.219 323.228 209.716 1.00 27.67 C ANISOU15743 CD2 TRP N 186 3592 3237 3686 -376 -230 -335 C ATOM 15744 NE1 TRP N 186 118.597 324.302 211.662 1.00 28.71 N ANISOU15744 NE1 TRP N 186 3742 3358 3811 -381 -248 -355 N ATOM 15745 CE2 TRP N 186 117.603 323.830 210.846 1.00 27.11 C ANISOU15745 CE2 TRP N 186 3540 3159 3601 -376 -227 -344 C ATOM 15746 CE3 TRP N 186 117.410 322.676 208.736 1.00 28.65 C ANISOU15746 CE3 TRP N 186 3714 3367 3806 -371 -215 -324 C ATOM 15747 CZ2 TRP N 186 116.217 323.921 210.992 1.00 33.79 C ANISOU15747 CZ2 TRP N 186 4401 4004 4435 -371 -208 -343 C ATOM 15748 CZ3 TRP N 186 116.026 322.765 208.898 1.00 31.41 C ANISOU15748 CZ3 TRP N 186 4082 3714 4137 -370 -197 -319 C ATOM 15749 CH2 TRP N 186 115.456 323.373 210.011 1.00 30.75 C ANISOU15749 CH2 TRP N 186 4013 3625 4046 -366 -192 -329 C ATOM 15750 N SER N 187 122.593 321.080 207.246 1.00 25.21 N ANISOU15750 N SER N 187 3160 2940 3476 -358 -278 -350 N ATOM 15751 CA SER N 187 123.045 320.857 205.862 1.00 26.66 C ANISOU15751 CA SER N 187 3314 3135 3681 -353 -268 -354 C ATOM 15752 C SER N 187 122.950 319.366 205.504 1.00 24.97 C ANISOU15752 C SER N 187 3081 2920 3485 -334 -272 -359 C ATOM 15753 O SER N 187 122.616 319.021 204.372 1.00 30.30 O ANISOU15753 O SER N 187 3742 3603 4166 -328 -256 -361 O ATOM 15754 CB SER N 187 124.484 321.413 205.676 1.00 32.46 C ANISOU15754 CB SER N 187 4023 3872 4439 -360 -278 -364 C ATOM 15755 OG SER N 187 125.497 320.492 206.113 1.00 29.00 O ANISOU15755 OG SER N 187 3560 3429 4029 -349 -302 -375 O ATOM 15756 N VAL N 188 123.213 318.497 206.478 1.00 31.43 N ANISOU15756 N VAL N 188 3899 3727 4315 -325 -295 -361 N ATOM 15757 CA VAL N 188 123.102 317.059 206.297 1.00 25.99 C ANISOU15757 CA VAL N 188 3195 3032 3647 -307 -304 -366 C ATOM 15758 C VAL N 188 121.661 316.639 206.184 1.00 29.02 C ANISOU15758 C VAL N 188 3602 3416 4009 -305 -289 -355 C ATOM 15759 O VAL N 188 121.318 315.813 205.330 1.00 30.70 O ANISOU15759 O VAL N 188 3800 3631 4233 -295 -280 -358 O ATOM 15760 CB VAL N 188 123.804 316.313 207.457 1.00 27.82 C ANISOU15760 CB VAL N 188 3422 3249 3900 -298 -339 -369 C ATOM 15761 CG1 VAL N 188 123.527 314.781 207.372 1.00 25.66 C ANISOU15761 CG1 VAL N 188 3137 2964 3649 -279 -350 -370 C ATOM 15762 CG2 VAL N 188 125.302 316.556 207.330 1.00 31.36 C ANISOU15762 CG2 VAL N 188 3840 3698 4376 -298 -353 -382 C ATOM 15763 N MET N 189 120.775 317.203 207.034 1.00 24.74 N ANISOU15763 N MET N 189 3092 2871 3437 -314 -286 -343 N ATOM 15764 CA MET N 189 119.355 316.845 206.938 1.00 25.88 C ANISOU15764 CA MET N 189 3257 3016 3562 -313 -271 -333 C ATOM 15765 C MET N 189 118.792 317.170 205.571 1.00 26.73 C ANISOU15765 C MET N 189 3360 3136 3660 -316 -244 -330 C ATOM 15766 O MET N 189 118.077 316.362 204.964 1.00 28.29 O ANISOU15766 O MET N 189 3553 3335 3860 -309 -236 -328 O ATOM 15767 CB MET N 189 118.494 317.599 207.993 1.00 24.90 C ANISOU15767 CB MET N 189 3165 2888 3408 -323 -267 -324 C ATOM 15768 CG MET N 189 116.981 317.133 207.737 1.00 34.00 C ANISOU15768 CG MET N 189 4334 4042 4544 -322 -249 -314 C ATOM 15769 SD MET N 189 116.015 317.105 209.186 1.00 52.59 S ANISOU15769 SD MET N 189 6714 6386 6882 -322 -257 -308 S ATOM 15770 CE MET N 189 116.236 318.800 209.727 1.00 48.38 C ANISOU15770 CE MET N 189 6198 5855 6328 -335 -248 -315 C ATOM 15771 N ILE N 190 119.160 318.336 205.051 1.00 27.61 N ANISOU15771 N ILE N 190 3470 3256 3766 -326 -234 -330 N ATOM 15772 CA ILE N 190 118.633 318.764 203.753 1.00 27.40 C ANISOU15772 CA ILE N 190 3437 3240 3733 -328 -213 -327 C ATOM 15773 C ILE N 190 119.229 317.920 202.631 1.00 28.39 C ANISOU15773 C ILE N 190 3527 3374 3887 -316 -210 -341 C ATOM 15774 O ILE N 190 118.519 317.461 201.715 1.00 26.99 O ANISOU15774 O ILE N 190 3342 3204 3707 -311 -196 -341 O ATOM 15775 CB ILE N 190 118.865 320.282 203.573 1.00 26.30 C ANISOU15775 CB ILE N 190 3305 3104 3584 -341 -205 -322 C ATOM 15776 CG1 ILE N 190 118.022 321.078 204.635 1.00 29.64 C ANISOU15776 CG1 ILE N 190 3767 3518 3978 -351 -205 -311 C ATOM 15777 CG2 ILE N 190 118.533 320.740 202.132 1.00 27.34 C ANISOU15777 CG2 ILE N 190 3421 3248 3718 -341 -186 -320 C ATOM 15778 CD1 ILE N 190 118.401 322.584 204.768 1.00 29.78 C ANISOU15778 CD1 ILE N 190 3794 3531 3988 -365 -203 -309 C ATOM 15779 N THR N 191 120.553 317.679 202.679 1.00 26.25 N ANISOU15779 N THR N 191 3230 3102 3642 -312 -223 -355 N ATOM 15780 CA THR N 191 121.172 316.760 201.717 1.00 27.13 C ANISOU15780 CA THR N 191 3305 3219 3784 -299 -220 -374 C ATOM 15781 C THR N 191 120.416 315.430 201.756 1.00 26.92 C ANISOU15781 C THR N 191 3282 3186 3761 -286 -224 -374 C ATOM 15782 O THR N 191 120.121 314.828 200.730 1.00 26.65 O ANISOU15782 O THR N 191 3231 3160 3735 -278 -211 -384 O ATOM 15783 CB THR N 191 122.676 316.537 202.087 1.00 23.56 C ANISOU15783 CB THR N 191 2827 2762 3363 -294 -240 -389 C ATOM 15784 OG1 THR N 191 123.340 317.785 202.026 1.00 28.55 O ANISOU15784 OG1 THR N 191 3455 3400 3991 -308 -236 -388 O ATOM 15785 CG2 THR N 191 123.382 315.500 201.137 1.00 26.85 C ANISOU15785 CG2 THR N 191 3203 3183 3816 -278 -238 -414 C ATOM 15786 N ALA N 192 120.171 314.919 202.972 1.00 25.67 N ANISOU15786 N ALA N 192 3142 3011 3599 -284 -242 -366 N ATOM 15787 CA ALA N 192 119.469 313.639 203.110 1.00 25.88 C ANISOU15787 CA ALA N 192 3172 3028 3632 -273 -248 -364 C ATOM 15788 C ALA N 192 118.098 313.671 202.442 1.00 28.11 C ANISOU15788 C ALA N 192 3471 3320 3891 -277 -227 -354 C ATOM 15789 O ALA N 192 117.704 312.706 201.796 1.00 29.07 O ANISOU15789 O ALA N 192 3580 3441 4023 -268 -223 -361 O ATOM 15790 CB ALA N 192 119.318 313.285 204.588 1.00 22.69 C ANISOU15790 CB ALA N 192 2788 2607 3225 -272 -271 -353 C ATOM 15791 N VAL N 193 117.320 314.732 202.632 1.00 29.06 N ANISOU15791 N VAL N 193 3616 3446 3979 -291 -215 -339 N ATOM 15792 CA VAL N 193 116.012 314.782 201.968 1.00 27.78 C ANISOU15792 CA VAL N 193 3467 3292 3797 -294 -197 -329 C ATOM 15793 C VAL N 193 116.198 314.770 200.445 1.00 28.35 C ANISOU15793 C VAL N 193 3511 3380 3881 -289 -181 -342 C ATOM 15794 O VAL N 193 115.487 314.071 199.714 1.00 27.04 O ANISOU15794 O VAL N 193 3340 3219 3716 -284 -172 -345 O ATOM 15795 CB VAL N 193 115.195 316.011 202.418 1.00 29.63 C ANISOU15795 CB VAL N 193 3731 3528 4000 -307 -188 -311 C ATOM 15796 CG1 VAL N 193 113.897 316.171 201.549 1.00 29.98 C ANISOU15796 CG1 VAL N 193 3781 3580 4029 -309 -171 -301 C ATOM 15797 CG2 VAL N 193 114.847 315.961 203.964 1.00 25.55 C ANISOU15797 CG2 VAL N 193 3241 2997 3470 -312 -200 -303 C ATOM 15798 N LEU N 194 117.169 315.522 199.945 1.00 26.72 N ANISOU15798 N LEU N 194 3286 3183 3685 -292 -176 -352 N ATOM 15799 CA LEU N 194 117.392 315.500 198.490 1.00 27.66 C ANISOU15799 CA LEU N 194 3375 3319 3815 -288 -157 -369 C ATOM 15800 C LEU N 194 117.759 314.104 198.001 1.00 26.27 C ANISOU15800 C LEU N 194 3174 3142 3665 -274 -161 -391 C ATOM 15801 O LEU N 194 117.236 313.636 196.967 1.00 29.08 O ANISOU15801 O LEU N 194 3517 3510 4022 -270 -146 -401 O ATOM 15802 CB LEU N 194 118.440 316.511 198.075 1.00 24.70 C ANISOU15802 CB LEU N 194 2981 2955 3449 -295 -151 -377 C ATOM 15803 CG ALEU N 194 118.364 317.973 198.547 0.70 44.69 C ANISOU15803 CG ALEU N 194 5533 5485 5962 -309 -150 -359 C ATOM 15804 CG BLEU N 194 117.958 317.817 197.435 0.30 12.08 C ANISOU15804 CG BLEU N 194 1388 1370 1833 -307 -132 -367 C ATOM 15805 CD1ALEU N 194 119.148 318.822 197.557 0.70 32.48 C ANISOU15805 CD1ALEU N 194 3960 3955 4427 -316 -135 -370 C ATOM 15806 CD1BLEU N 194 117.116 318.578 198.427 0.30 30.91 C ANISOU15806 CD1BLEU N 194 3809 3741 4192 -315 -139 -342 C ATOM 15807 CD2ALEU N 194 116.986 318.509 198.813 0.70 26.99 C ANISOU15807 CD2ALEU N 194 3323 3240 3693 -315 -144 -338 C ATOM 15808 CD2BLEU N 194 119.231 318.568 197.138 0.30 18.50 C ANISOU15808 CD2BLEU N 194 2177 2190 2662 -314 -130 -378 C ATOM 15809 N LEU N 195 118.574 313.381 198.771 1.00 26.23 N ANISOU15809 N LEU N 195 3162 3121 3682 -265 -181 -398 N ATOM 15810 CA LEU N 195 118.959 312.034 198.336 1.00 27.32 C ANISOU15810 CA LEU N 195 3275 3254 3852 -249 -187 -421 C ATOM 15811 C LEU N 195 117.752 311.104 198.322 1.00 35.49 C ANISOU15811 C LEU N 195 4325 4282 4878 -245 -187 -413 C ATOM 15812 O LEU N 195 117.579 310.271 197.408 1.00 29.35 O ANISOU15812 O LEU N 195 3528 3509 4113 -237 -179 -432 O ATOM 15813 CB LEU N 195 120.016 311.471 199.307 1.00 27.22 C ANISOU15813 CB LEU N 195 3253 3223 3868 -240 -214 -427 C ATOM 15814 CG LEU N 195 121.455 311.982 199.186 1.00 22.42 C ANISOU15814 CG LEU N 195 2617 2619 3282 -238 -217 -444 C ATOM 15815 CD1 LEU N 195 122.190 311.613 200.599 1.00 31.25 C ANISOU15815 CD1 LEU N 195 3740 3714 4418 -233 -250 -438 C ATOM 15816 CD2 LEU N 195 122.119 311.348 197.887 1.00 27.54 C ANISOU15816 CD2 LEU N 195 3224 3279 3962 -226 -204 -479 C ATOM 15817 N LEU N 196 116.949 311.174 199.393 1.00 26.66 N ANISOU15817 N LEU N 196 3239 3151 3739 -252 -197 -388 N ATOM 15818 CA LEU N 196 115.752 310.321 199.521 1.00 23.69 C ANISOU15818 CA LEU N 196 2879 2768 3354 -252 -198 -378 C ATOM 15819 C LEU N 196 114.836 310.459 198.320 1.00 28.40 C ANISOU15819 C LEU N 196 3474 3382 3936 -256 -176 -380 C ATOM 15820 O LEU N 196 114.169 309.493 197.915 1.00 27.68 O ANISOU15820 O LEU N 196 3380 3288 3850 -251 -175 -384 O ATOM 15821 CB LEU N 196 114.958 310.752 200.768 1.00 25.97 C ANISOU15821 CB LEU N 196 3203 3047 3617 -263 -205 -351 C ATOM 15822 CG LEU N 196 113.806 309.799 201.131 1.00 32.64 C ANISOU15822 CG LEU N 196 4063 3881 4457 -263 -210 -340 C ATOM 15823 CD1 LEU N 196 114.426 308.558 201.770 1.00 27.31 C ANISOU15823 CD1 LEU N 196 3376 3184 3816 -250 -234 -348 C ATOM 15824 CD2 LEU N 196 112.883 310.496 202.107 1.00 27.84 C ANISOU15824 CD2 LEU N 196 3488 3272 3820 -276 -208 -317 C ATOM 15825 N LEU N 197 114.672 311.678 197.838 1.00 27.30 N ANISOU15825 N LEU N 197 3337 3260 3776 -265 -160 -374 N ATOM 15826 CA LEU N 197 113.728 311.920 196.744 1.00 31.02 C ANISOU15826 CA LEU N 197 3807 3749 4232 -269 -140 -373 C ATOM 15827 C LEU N 197 114.331 311.710 195.347 1.00 34.15 C ANISOU15827 C LEU N 197 4167 4163 4644 -264 -124 -403 C ATOM 15828 O LEU N 197 113.612 311.335 194.408 1.00 29.50 O ANISOU15828 O LEU N 197 3572 3588 4051 -264 -111 -411 O ATOM 15829 CB LEU N 197 113.221 313.351 196.833 1.00 23.51 C ANISOU15829 CB LEU N 197 2873 2807 3255 -281 -130 -354 C ATOM 15830 CG LEU N 197 112.484 313.598 198.157 1.00 27.18 C ANISOU15830 CG LEU N 197 3372 3255 3701 -288 -142 -328 C ATOM 15831 CD1 LEU N 197 112.204 315.063 198.204 1.00 33.55 C ANISOU15831 CD1 LEU N 197 4191 4068 4489 -297 -133 -315 C ATOM 15832 CD2 LEU N 197 111.214 312.773 198.258 1.00 27.85 C ANISOU15832 CD2 LEU N 197 3470 3334 3776 -289 -144 -318 C ATOM 15833 N SER N 198 115.609 312.006 195.158 1.00 27.77 N ANISOU15833 N SER N 198 3337 3361 3855 -260 -123 -421 N ATOM 15834 CA SER N 198 116.224 311.988 193.813 1.00 26.02 C ANISOU15834 CA SER N 198 3080 3161 3646 -257 -103 -451 C ATOM 15835 C SER N 198 116.737 310.602 193.430 1.00 33.49 C ANISOU15835 C SER N 198 4001 4100 4622 -242 -109 -482 C ATOM 15836 O SER N 198 116.515 310.153 192.302 1.00 29.67 O ANISOU15836 O SER N 198 3499 3634 4141 -240 -93 -505 O ATOM 15837 CB SER N 198 117.362 313.016 193.715 1.00 23.28 C ANISOU15837 CB SER N 198 2717 2824 3305 -263 -97 -458 C ATOM 15838 OG SER N 198 118.409 312.714 194.631 1.00 30.84 O ANISOU15838 OG SER N 198 3670 3763 4286 -256 -119 -462 O ATOM 15839 N LEU N 199 117.388 309.885 194.347 1.00 30.22 N ANISOU15839 N LEU N 199 3587 3663 4232 -232 -132 -484 N ATOM 15840 CA LEU N 199 117.983 308.605 193.968 1.00 28.29 C ANISOU15840 CA LEU N 199 3315 3410 4023 -215 -138 -515 C ATOM 15841 C LEU N 199 116.962 307.604 193.469 1.00 28.07 C ANISOU15841 C LEU N 199 3292 3380 3993 -211 -136 -521 C ATOM 15842 O LEU N 199 117.334 306.809 192.592 1.00 28.22 O ANISOU15842 O LEU N 199 3282 3404 4035 -201 -129 -555 O ATOM 15843 CB LEU N 199 118.813 307.986 195.114 1.00 26.48 C ANISOU15843 CB LEU N 199 3084 3153 3824 -203 -167 -514 C ATOM 15844 CG LEU N 199 120.243 308.558 195.179 1.00 28.81 C ANISOU15844 CG LEU N 199 3354 3452 4139 -201 -169 -530 C ATOM 15845 CD1 LEU N 199 120.864 308.151 196.499 1.00 32.42 C ANISOU15845 CD1 LEU N 199 3817 3882 4619 -193 -200 -519 C ATOM 15846 CD2 LEU N 199 121.107 308.096 193.925 1.00 29.25 C ANISOU15846 CD2 LEU N 199 3365 3523 4225 -190 -153 -576 C ATOM 15847 N PRO N 200 115.718 307.530 193.991 1.00 31.45 N ANISOU15847 N PRO N 200 3753 3800 4398 -219 -141 -491 N ATOM 15848 CA PRO N 200 114.782 306.543 193.422 1.00 28.93 C ANISOU15848 CA PRO N 200 3434 3478 4078 -217 -139 -498 C ATOM 15849 C PRO N 200 114.448 306.814 191.958 1.00 28.23 C ANISOU15849 C PRO N 200 3329 3421 3977 -222 -113 -519 C ATOM 15850 O PRO N 200 114.153 305.878 191.212 1.00 30.35 O ANISOU15850 O PRO N 200 3584 3691 4256 -216 -109 -542 O ATOM 15851 CB PRO N 200 113.523 306.666 194.309 1.00 26.40 C ANISOU15851 CB PRO N 200 3152 3146 3731 -228 -148 -459 C ATOM 15852 CG PRO N 200 114.105 307.216 195.690 1.00 30.17 C ANISOU15852 CG PRO N 200 3646 3609 4209 -230 -165 -438 C ATOM 15853 CD PRO N 200 115.193 308.150 195.222 1.00 23.97 C ANISOU15853 CD PRO N 200 2839 2840 3427 -229 -153 -453 C ATOM 15854 N VAL N 201 114.467 308.078 191.548 1.00 28.74 N ANISOU15854 N VAL N 201 3393 3508 4018 -233 -94 -512 N ATOM 15855 CA VAL N 201 114.209 308.373 190.150 1.00 30.31 C ANISOU15855 CA VAL N 201 3574 3739 4205 -239 -68 -534 C ATOM 15856 C VAL N 201 115.376 307.917 189.309 1.00 30.91 C ANISOU15856 C VAL N 201 3610 3828 4307 -229 -58 -579 C ATOM 15857 O VAL N 201 115.184 307.317 188.226 1.00 28.42 O ANISOU15857 O VAL N 201 3275 3529 3993 -227 -44 -610 O ATOM 15858 CB VAL N 201 113.884 309.865 189.941 1.00 26.76 C ANISOU15858 CB VAL N 201 3132 3310 3724 -255 -51 -514 C ATOM 15859 CG1 VAL N 201 113.480 310.113 188.397 1.00 27.73 C ANISOU15859 CG1 VAL N 201 3235 3471 3830 -264 -22 -536 C ATOM 15860 CG2 VAL N 201 112.666 310.283 190.840 1.00 23.76 C ANISOU15860 CG2 VAL N 201 2791 2917 3321 -263 -62 -471 C ATOM 15861 N LEU N 202 116.594 308.175 189.771 1.00 26.13 N ANISOU15861 N LEU N 202 2990 3215 3722 -223 -64 -587 N ATOM 15862 CA LEU N 202 117.753 307.605 189.071 1.00 31.50 C ANISOU15862 CA LEU N 202 3631 3904 4435 -211 -57 -633 C ATOM 15863 C LEU N 202 117.636 306.103 188.996 1.00 35.39 C ANISOU15863 C LEU N 202 4114 4378 4954 -195 -70 -655 C ATOM 15864 O LEU N 202 117.831 305.517 187.927 1.00 30.91 O ANISOU15864 O LEU N 202 3519 3828 4399 -190 -56 -696 O ATOM 15865 CB LEU N 202 119.075 307.973 189.746 1.00 31.24 C ANISOU15865 CB LEU N 202 3584 3860 4425 -206 -68 -636 C ATOM 15866 CG LEU N 202 120.294 307.266 189.165 1.00 32.11 C ANISOU15866 CG LEU N 202 3652 3975 4575 -191 -64 -685 C ATOM 15867 CD1 LEU N 202 120.573 307.920 187.757 1.00 24.78 C ANISOU15867 CD1 LEU N 202 2695 3091 3632 -202 -29 -717 C ATOM 15868 CD2 LEU N 202 121.487 307.370 190.083 1.00 30.01 C ANISOU15868 CD2 LEU N 202 3375 3688 4338 -182 -84 -684 C ATOM 15869 N ALA N 203 117.336 305.455 190.133 1.00 28.98 N ANISOU15869 N ALA N 203 3326 3532 4155 -189 -98 -631 N ATOM 15870 CA ALA N 203 117.153 303.996 190.131 1.00 26.94 C ANISOU15870 CA ALA N 203 3060 3251 3924 -174 -113 -648 C ATOM 15871 C ALA N 203 116.132 303.544 189.076 1.00 34.01 C ANISOU15871 C ALA N 203 3956 4163 4803 -180 -98 -661 C ATOM 15872 O ALA N 203 116.312 302.492 188.438 1.00 33.85 O ANISOU15872 O ALA N 203 3913 4139 4808 -169 -98 -697 O ATOM 15873 CB ALA N 203 116.716 303.524 191.553 1.00 26.34 C ANISOU15873 CB ALA N 203 3015 3138 3853 -172 -143 -611 C ATOM 15874 N ALA N 204 114.997 304.256 188.951 1.00 30.30 N ANISOU15874 N ALA N 204 3512 3707 4292 -197 -88 -632 N ATOM 15875 CA ALA N 204 114.001 303.858 187.967 1.00 28.76 C ANISOU15875 CA ALA N 204 3317 3529 4081 -204 -75 -643 C ATOM 15876 C ALA N 204 114.571 303.960 186.559 1.00 30.71 C ANISOU15876 C ALA N 204 3528 3811 4328 -203 -49 -690 C ATOM 15877 O ALA N 204 114.510 303.014 185.786 1.00 27.39 O ANISOU15877 O ALA N 204 3089 3395 3922 -196 -46 -724 O ATOM 15878 CB ALA N 204 112.728 304.724 188.087 1.00 30.43 C ANISOU15878 CB ALA N 204 3560 3751 4251 -222 -69 -604 C ATOM 15879 N GLY N 205 115.190 305.089 186.257 1.00 28.95 N ANISOU15879 N GLY N 205 3293 3614 4093 -210 -30 -693 N ATOM 15880 CA GLY N 205 115.802 305.310 184.946 1.00 28.52 C ANISOU15880 CA GLY N 205 3203 3599 4035 -213 -2 -738 C ATOM 15881 C GLY N 205 116.852 304.282 184.568 1.00 31.38 C ANISOU15881 C GLY N 205 3528 3957 4438 -195 -4 -789 C ATOM 15882 O GLY N 205 116.887 303.812 183.421 1.00 29.99 O ANISOU15882 O GLY N 205 3325 3807 4262 -194 14 -831 O ATOM 15883 N ILE N 206 117.737 303.924 185.476 1.00 29.81 N ANISOU15883 N ILE N 206 3323 3727 4275 -180 -24 -788 N ATOM 15884 CA ILE N 206 118.829 303.044 185.047 1.00 30.69 C ANISOU15884 CA ILE N 206 3394 3838 4430 -162 -24 -840 C ATOM 15885 C ILE N 206 118.327 301.618 185.027 1.00 33.89 C ANISOU15885 C ILE N 206 3801 4218 4859 -149 -42 -853 C ATOM 15886 O ILE N 206 118.912 300.754 184.350 1.00 30.86 O ANISOU15886 O ILE N 206 3382 3839 4505 -135 -38 -903 O ATOM 15887 CB ILE N 206 120.089 303.123 185.943 1.00 34.22 C ANISOU15887 CB ILE N 206 3827 4261 4912 -148 -40 -841 C ATOM 15888 CG1 ILE N 206 119.764 302.756 187.396 1.00 31.14 C ANISOU15888 CG1 ILE N 206 3471 3826 4535 -142 -75 -797 C ATOM 15889 CG2 ILE N 206 120.758 304.510 185.913 1.00 26.54 C ANISOU15889 CG2 ILE N 206 2849 3313 3922 -161 -24 -833 C ATOM 15890 CD1 ILE N 206 120.970 303.070 188.327 1.00 28.93 C ANISOU15890 CD1 ILE N 206 3181 3528 4284 -133 -92 -791 C ATOM 15891 N THR N 207 117.237 301.352 185.745 1.00 30.91 N ANISOU15891 N THR N 207 3462 3815 4468 -154 -61 -811 N ATOM 15892 CA THR N 207 116.614 300.029 185.650 1.00 27.31 C ANISOU15892 CA THR N 207 3011 3337 4031 -146 -76 -821 C ATOM 15893 C THR N 207 115.973 299.855 184.279 1.00 32.60 C ANISOU15893 C THR N 207 3669 4040 4677 -154 -53 -851 C ATOM 15894 O THR N 207 116.008 298.778 183.691 1.00 27.78 O ANISOU15894 O THR N 207 3040 3425 4090 -145 -56 -888 O ATOM 15895 CB THR N 207 115.577 299.872 186.757 1.00 30.28 C ANISOU15895 CB THR N 207 3430 3680 4394 -152 -99 -768 C ATOM 15896 OG1 THR N 207 116.269 299.881 188.021 1.00 31.65 O ANISOU15896 OG1 THR N 207 3610 3823 4591 -143 -122 -747 O ATOM 15897 CG2 THR N 207 114.808 298.572 186.642 1.00 28.91 C ANISOU15897 CG2 THR N 207 3264 3485 4236 -148 -115 -775 C ATOM 15898 N MET N 208 115.364 300.915 183.785 1.00 28.50 N ANISOU15898 N MET N 208 3162 3555 4113 -174 -32 -835 N ATOM 15899 CA MET N 208 114.786 300.875 182.454 1.00 32.42 C ANISOU15899 CA MET N 208 3646 4089 4584 -184 -9 -862 C ATOM 15900 C MET N 208 115.878 300.739 181.418 1.00 35.65 C ANISOU15900 C MET N 208 4008 4530 5008 -177 12 -922 C ATOM 15901 O MET N 208 115.709 300.037 180.409 1.00 32.43 O ANISOU15901 O MET N 208 3580 4140 4600 -177 22 -962 O ATOM 15902 CB MET N 208 113.960 302.133 182.233 1.00 30.04 C ANISOU15902 CB MET N 208 3366 3816 4233 -206 7 -829 C ATOM 15903 CG MET N 208 112.627 302.128 182.995 1.00 31.09 C ANISOU15903 CG MET N 208 3542 3924 4348 -215 -11 -777 C ATOM 15904 SD MET N 208 111.791 303.746 182.719 1.00 42.62 S ANISOU15904 SD MET N 208 5020 5419 5753 -239 10 -741 S ATOM 15905 CE MET N 208 111.739 304.366 184.427 1.00 38.42 C ANISOU15905 CE MET N 208 4523 4849 5226 -238 -13 -684 C ATOM 15906 N LEU N 209 117.049 301.345 181.672 1.00 32.31 N ANISOU15906 N LEU N 209 3564 4113 4599 -172 19 -932 N ATOM 15907 CA LEU N 209 118.134 301.152 180.699 1.00 33.35 C ANISOU15907 CA LEU N 209 3647 4277 4748 -166 40 -993 C ATOM 15908 C LEU N 209 118.609 299.692 180.730 1.00 34.64 C ANISOU15908 C LEU N 209 3788 4412 4962 -142 22 -1031 C ATOM 15909 O LEU N 209 118.841 299.073 179.681 1.00 33.10 O ANISOU15909 O LEU N 209 3560 4241 4775 -139 35 -1083 O ATOM 15910 CB LEU N 209 119.289 302.122 181.016 1.00 31.22 C ANISOU15910 CB LEU N 209 3361 4018 4485 -166 51 -995 C ATOM 15911 CG LEU N 209 120.552 302.016 180.129 1.00 33.36 C ANISOU15911 CG LEU N 209 3577 4323 4777 -160 73 -1059 C ATOM 15912 CD1 LEU N 209 120.199 302.362 178.638 1.00 37.66 C ANISOU15912 CD1 LEU N 209 4101 4930 5279 -179 109 -1093 C ATOM 15913 CD2 LEU N 209 121.666 302.938 180.670 1.00 31.45 C ANISOU15913 CD2 LEU N 209 3324 4081 4545 -160 77 -1053 C ATOM 15914 N LEU N 210 118.710 299.120 181.929 1.00 33.42 N ANISOU15914 N LEU N 210 3651 4206 4842 -128 -10 -1004 N ATOM 15915 CA LEU N 210 119.039 297.704 182.095 1.00 29.43 C ANISOU15915 CA LEU N 210 3130 3666 4387 -106 -33 -1032 C ATOM 15916 C LEU N 210 118.043 296.816 181.349 1.00 32.04 C ANISOU15916 C LEU N 210 3468 3998 4707 -110 -34 -1047 C ATOM 15917 O LEU N 210 118.441 295.847 180.701 1.00 35.81 O ANISOU15917 O LEU N 210 3915 4476 5214 -98 -34 -1096 O ATOM 15918 CB LEU N 210 119.022 297.307 183.582 1.00 29.89 C ANISOU15918 CB LEU N 210 3216 3670 4473 -95 -69 -989 C ATOM 15919 CG LEU N 210 119.483 295.883 183.916 1.00 31.43 C ANISOU15919 CG LEU N 210 3392 3823 4725 -72 -96 -1014 C ATOM 15920 CD1 LEU N 210 121.083 295.840 183.782 1.00 31.73 C ANISOU15920 CD1 LEU N 210 3380 3867 4809 -53 -93 -1060 C ATOM 15921 CD2 LEU N 210 119.032 295.572 185.333 1.00 34.51 C ANISOU15921 CD2 LEU N 210 3820 4166 5127 -70 -130 -961 C ATOM 15922 N THR N 211 116.753 297.095 181.481 1.00 29.24 N ANISOU15922 N THR N 211 3154 3643 4315 -127 -36 -1005 N ATOM 15923 CA THR N 211 115.799 296.216 180.792 1.00 32.42 C ANISOU15923 CA THR N 211 3564 4045 4709 -131 -39 -1020 C ATOM 15924 C THR N 211 115.820 296.456 179.286 1.00 37.30 C ANISOU15924 C THR N 211 4154 4719 5301 -141 -7 -1066 C ATOM 15925 O THR N 211 115.594 295.513 178.514 1.00 35.32 O ANISOU15925 O THR N 211 3890 4471 5060 -138 -8 -1103 O ATOM 15926 CB THR N 211 114.367 296.352 181.340 1.00 36.41 C ANISOU15926 CB THR N 211 4116 4533 5184 -147 -52 -965 C ATOM 15927 OG1 THR N 211 113.851 297.659 181.111 1.00 28.92 O ANISOU15927 OG1 THR N 211 3182 3619 4186 -167 -31 -938 O ATOM 15928 CG2 THR N 211 114.317 296.014 182.820 1.00 32.88 C ANISOU15928 CG2 THR N 211 3696 4034 4762 -139 -83 -922 C ATOM 15929 N ASP N 212 116.101 297.686 178.840 1.00 31.57 N ANISOU15929 N ASP N 212 3418 4037 4541 -155 20 -1065 N ATOM 15930 CA ASP N 212 116.289 297.916 177.400 1.00 38.27 C ANISOU15930 CA ASP N 212 4233 4943 5363 -165 51 -1113 C ATOM 15931 C ASP N 212 117.508 297.154 176.888 1.00 37.79 C ANISOU15931 C ASP N 212 4124 4890 5344 -148 56 -1176 C ATOM 15932 O ASP N 212 117.521 296.684 175.747 1.00 33.17 O ANISOU15932 O ASP N 212 3514 4339 4752 -151 70 -1223 O ATOM 15933 CB ASP N 212 116.475 299.396 177.119 1.00 34.94 C ANISOU15933 CB ASP N 212 3807 4566 4901 -184 79 -1099 C ATOM 15934 CG ASP N 212 115.164 300.126 176.853 1.00 37.45 C ANISOU15934 CG ASP N 212 4158 4905 5166 -207 87 -1061 C ATOM 15935 OD1 ASP N 212 114.089 299.718 177.361 1.00 30.91 O ANISOU15935 OD1 ASP N 212 3366 4044 4335 -208 66 -1025 O ATOM 15936 OD2 ASP N 212 115.248 301.164 176.138 1.00 30.95 O ANISOU15936 OD2 ASP N 212 3323 4133 4305 -225 116 -1066 O ATOM 15937 N ARG N 213 118.503 296.957 177.752 1.00 33.45 N ANISOU15937 N ARG N 213 3562 4308 4840 -129 40 -1177 N ATOM 15938 CA ARG N 213 119.713 296.250 177.351 1.00 33.15 C ANISOU15938 CA ARG N 213 3475 4274 4846 -111 42 -1237 C ATOM 15939 C ARG N 213 119.551 294.731 177.437 1.00 35.75 C ANISOU15939 C ARG N 213 3804 4562 5218 -93 15 -1258 C ATOM 15940 O ARG N 213 120.234 294.013 176.689 1.00 37.30 O ANISOU15940 O ARG N 213 3961 4772 5440 -82 20 -1315 O ATOM 15941 CB ARG N 213 120.897 296.735 178.204 1.00 30.15 C ANISOU15941 CB ARG N 213 3079 3879 4498 -99 37 -1231 C ATOM 15942 CG ARG N 213 121.418 298.148 177.885 1.00 28.32 C ANISOU15942 CG ARG N 213 2831 3694 4233 -116 68 -1231 C ATOM 15943 CD ARG N 213 122.510 298.566 178.940 1.00 28.80 C ANISOU15943 CD ARG N 213 2884 3729 4330 -103 57 -1218 C ATOM 15944 NE ARG N 213 123.493 297.465 179.049 1.00 31.16 N ANISOU15944 NE ARG N 213 3144 4004 4692 -78 39 -1263 N ATOM 15945 CZ ARG N 213 124.488 297.260 178.193 1.00 36.01 C ANISOU15945 CZ ARG N 213 3703 4652 5326 -74 57 -1325 C ATOM 15946 NH1 ARG N 213 124.720 298.133 177.180 1.00 35.51 N ANISOU15946 NH1 ARG N 213 3615 4653 5224 -95 94 -1351 N ATOM 15947 NH2 ARG N 213 125.272 296.199 178.348 1.00 35.59 N ANISOU15947 NH2 ARG N 213 3619 4573 5332 -51 36 -1361 N ATOM 15948 N ASN N 214 118.642 294.214 178.297 1.00 35.77 N ANISOU15948 N ASN N 214 3848 4515 5226 -90 -13 -1213 N ATOM 15949 CA ASN N 214 118.629 292.770 178.570 1.00 32.40 C ANISOU15949 CA ASN N 214 3421 4043 4848 -72 -41 -1230 C ATOM 15950 C ASN N 214 117.288 292.095 178.551 1.00 38.29 C ANISOU15950 C ASN N 214 4203 4765 5579 -80 -56 -1208 C ATOM 15951 O ASN N 214 117.256 290.859 178.533 1.00 39.37 O ANISOU15951 O ASN N 214 4336 4871 5754 -67 -76 -1231 O ATOM 15952 CB ASN N 214 119.291 292.453 179.924 1.00 35.50 C ANISOU15952 CB ASN N 214 3816 4383 5290 -53 -71 -1206 C ATOM 15953 CG ASN N 214 120.712 292.898 179.949 1.00 39.53 C ANISOU15953 CG ASN N 214 4285 4909 5826 -41 -61 -1235 C ATOM 15954 OD1 ASN N 214 121.590 292.231 179.377 1.00 38.27 O ANISOU15954 OD1 ASN N 214 4083 4756 5704 -27 -60 -1291 O ATOM 15955 ND2 ASN N 214 120.972 294.055 180.589 1.00 35.19 N ANISOU15955 ND2 ASN N 214 3746 4367 5258 -49 -55 -1199 N ATOM 15956 N LEU N 215 116.190 292.817 178.499 1.00 33.63 N ATOM 15957 CA LEU N 215 114.885 292.195 178.535 1.00 33.56 C ATOM 15958 C LEU N 215 114.050 292.608 177.330 1.00 29.48 C ATOM 15959 O LEU N 215 112.842 292.369 177.340 1.00 34.23 O ATOM 15960 CB LEU N 215 114.106 292.573 179.830 1.00 34.38 C ATOM 15961 CG LEU N 215 114.669 292.053 181.167 1.00 44.56 C ATOM 15962 CD1 LEU N 215 113.671 292.402 182.257 1.00 44.82 C ATOM 15963 CD2 LEU N 215 114.903 290.544 181.091 1.00 39.89 C