>>3AG2:HELIX   97 AK7 SER O   14  THR O   47  1                                  34    
SPIMEELLHFHDHTLMIVFLISSLVLYIISLMLT
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 97 AK7 SER O 14 THR O 47 1 34 ATOM 18502 N SER O 14 126.910 335.020 161.990 1.00 41.23 N ANISOU18502 N SER O 14 4415 6179 5072 -720 554 -34 N ATOM 18503 CA SER O 14 125.481 335.228 161.829 1.00 50.75 C ANISOU18503 CA SER O 14 5653 7379 6252 -717 542 -14 C ATOM 18504 C SER O 14 125.035 336.378 162.731 1.00 41.30 C ANISOU18504 C SER O 14 4478 6118 5098 -721 528 33 C ATOM 18505 O SER O 14 125.767 336.766 163.657 1.00 46.18 O ANISOU18505 O SER O 14 5089 6691 5766 -723 523 38 O ATOM 18506 CB SER O 14 124.696 333.946 162.169 1.00 38.95 C ANISOU18506 CB SER O 14 4176 5884 4737 -698 526 -67 C ATOM 18507 OG SER O 14 124.876 333.604 163.560 1.00 45.55 O ANISOU18507 OG SER O 14 5023 6665 5620 -687 508 -91 O ATOM 18508 N PRO O 15 123.894 337.007 162.437 1.00 48.19 N ANISOU18508 N PRO O 15 5375 6984 5953 -723 523 70 N ATOM 18509 CA PRO O 15 123.404 338.079 163.313 1.00 59.63 C ANISOU18509 CA PRO O 15 6845 8370 7443 -726 510 111 C ATOM 18510 C PRO O 15 123.106 337.594 164.712 1.00 49.46 C ANISOU18510 C PRO O 15 5576 7027 6188 -710 488 82 C ATOM 18511 O PRO O 15 123.325 338.347 165.655 1.00 44.58 O ANISOU18511 O PRO O 15 4964 6355 5617 -713 479 102 O ATOM 18512 CB PRO O 15 122.130 338.570 162.607 1.00 53.01 C ANISOU18512 CB PRO O 15 6027 7545 6569 -727 509 146 C ATOM 18513 CG PRO O 15 122.350 338.200 161.150 1.00 58.95 C ANISOU18513 CG PRO O 15 6759 8373 7267 -735 526 141 C ATOM 18514 CD PRO O 15 123.095 336.899 161.196 1.00 54.49 C ANISOU18514 CD PRO O 15 6176 7836 6693 -727 530 81 C ATOM 18515 N ILE O 16 122.652 336.348 164.870 1.00 45.77 N ANISOU18515 N ILE O 16 5118 6574 5698 -695 478 35 N ATOM 18516 CA ILE O 16 122.319 335.858 166.210 1.00 53.30 C ANISOU18516 CA ILE O 16 6092 7477 6681 -680 456 8 C ATOM 18517 C ILE O 16 123.585 335.666 167.027 1.00 43.26 C ANISOU18517 C ILE O 16 4802 6182 5452 -681 453 -15 C ATOM 18518 O ILE O 16 123.636 336.048 168.201 1.00 46.79 O ANISOU18518 O ILE O 16 5261 6575 5942 -679 437 -9 O ATOM 18519 CB ILE O 16 121.487 334.566 166.129 1.00 49.61 C ANISOU18519 CB ILE O 16 5639 7030 6179 -665 447 -37 C ATOM 18520 CG1 ILE O 16 120.001 334.936 166.064 1.00 63.61 C ANISOU18520 CG1 ILE O 16 7441 8792 7934 -661 437 -9 C ATOM 18521 CG2 ILE O 16 121.667 333.700 167.384 1.00 61.26 C ANISOU18521 CG2 ILE O 16 7123 8468 7684 -651 429 -82 C ATOM 18522 CD1 ILE O 16 119.542 335.667 167.302 1.00 60.54 C ANISOU18522 CD1 ILE O 16 7076 8337 7589 -657 421 16 C ATOM 18523 N MET O 17 124.631 335.097 166.423 1.00 39.61 N ANISOU18523 N MET O 17 4309 5762 4979 -684 468 -42 N ATOM 18524 CA MET O 17 125.903 334.976 167.135 1.00 45.93 C ANISOU18524 CA MET O 17 5088 6543 5821 -685 466 -60 C ATOM 18525 C MET O 17 126.443 336.344 167.545 1.00 52.72 C ANISOU18525 C MET O 17 5942 7366 6725 -701 466 -11 C ATOM 18526 O MET O 17 127.032 336.479 168.615 1.00 41.81 O ANISOU18526 O MET O 17 4557 5941 5387 -701 451 -18 O ATOM 18527 CB MET O 17 126.929 334.209 166.280 1.00 40.40 C ANISOU18527 CB MET O 17 4353 5898 5100 -686 485 -94 C ATOM 18528 CG MET O 17 128.216 333.828 167.004 1.00 54.95 C ANISOU18528 CG MET O 17 6171 7725 6982 -684 481 -123 C ATOM 18529 SD MET O 17 127.956 332.831 168.523 1.00 46.06 S ANISOU18529 SD MET O 17 5067 6549 5885 -663 451 -172 S ATOM 18530 CE MET O 17 128.772 333.867 169.732 1.00 50.22 C ANISOU18530 CE MET O 17 5590 7018 6476 -674 435 -140 C ATOM 18531 N GLU O 18 126.242 337.382 166.735 1.00 41.62 N ANISOU18531 N GLU O 18 4534 5973 5308 -716 481 37 N ATOM 18532 CA GLU O 18 126.680 338.703 167.176 1.00 53.08 C ANISOU18532 CA GLU O 18 5980 7382 6805 -732 480 81 C ATOM 18533 C GLU O 18 125.945 339.142 168.441 1.00 37.23 C ANISOU18533 C GLU O 18 4005 5310 4832 -726 455 91 C ATOM 18534 O GLU O 18 126.569 339.659 169.376 1.00 42.57 O ANISOU18534 O GLU O 18 4676 5941 5557 -732 443 97 O ATOM 18535 CB GLU O 18 126.497 339.744 166.084 1.00 46.24 C ANISOU18535 CB GLU O 18 5109 6539 5920 -748 500 130 C ATOM 18536 CG GLU O 18 127.511 340.888 166.251 1.00 75.72 C ANISOU18536 CG GLU O 18 8822 10247 9700 -769 508 164 C ATOM 18537 CD GLU O 18 127.158 342.129 165.473 1.00207.68 C ANISOU18537 CD GLU O 18 25539 26963 26406 -787 523 218 C ATOM 18538 OE1 GLU O 18 126.878 342.005 164.242 1.00 47.10 O ANISOU18538 OE1 GLU O 18 5197 6681 6019 -790 540 228 O ATOM 18539 OE2 GLU O 18 127.179 343.211 166.126 1.00 51.59 O ANISOU18539 OE2 GLU O 18 5779 7141 6681 -798 517 247 O ATOM 18540 N GLU O 19 124.610 338.964 168.461 1.00 44.85 N ANISOU18540 N GLU O 19 5000 6269 5772 -714 447 92 N ATOM 18541 CA GLU O 19 123.807 339.266 169.653 1.00 43.41 C ANISOU18541 CA GLU O 19 4849 6028 5617 -706 425 97 C ATOM 18542 C GLU O 19 124.355 338.550 170.870 1.00 38.82 C ANISOU18542 C GLU O 19 4268 5417 5065 -697 404 58 C ATOM 18543 O GLU O 19 124.365 339.092 171.991 1.00 41.97 O ANISOU18543 O GLU O 19 4680 5763 5505 -699 385 67 O ATOM 18544 CB GLU O 19 122.358 338.810 169.442 1.00 42.68 C ANISOU18544 CB GLU O 19 4784 5945 5486 -692 420 93 C ATOM 18545 CG GLU O 19 121.585 339.604 168.434 1.00 56.32 C ANISOU18545 CG GLU O 19 6519 7692 7188 -699 433 136 C ATOM 18546 CD GLU O 19 121.075 340.900 169.000 1.00 74.32 C ANISOU18546 CD GLU O 19 8817 9918 9501 -705 428 178 C ATOM 18547 OE1 GLU O 19 120.321 341.567 168.280 1.00 59.22 O ANISOU18547 OE1 GLU O 19 6915 8017 7570 -709 437 212 O ATOM 18548 OE2 GLU O 19 121.397 341.257 170.158 1.00 54.32 O ANISOU18548 OE2 GLU O 19 6290 7334 7014 -705 414 175 O ATOM 18549 N LEU O 20 124.724 337.281 170.690 1.00 39.10 N ANISOU18549 N LEU O 20 4292 5487 5078 -687 405 11 N ATOM 18550 CA LEU O 20 125.256 336.531 171.809 1.00 38.47 C ANISOU18550 CA LEU O 20 4213 5381 5024 -678 385 -29 C ATOM 18551 C LEU O 20 126.585 337.095 172.251 1.00 47.46 C ANISOU18551 C LEU O 20 5326 6501 6206 -691 382 -20 C ATOM 18552 O LEU O 20 126.879 337.085 173.445 1.00 41.23 O ANISOU18552 O LEU O 20 4545 5669 5452 -689 359 -32 O ATOM 18553 CB LEU O 20 125.391 335.052 171.460 1.00 34.93 C ANISOU18553 CB LEU O 20 3755 4971 4545 -664 389 -83 C ATOM 18554 CG LEU O 20 124.067 334.311 171.299 1.00 44.48 C ANISOU18554 CG LEU O 20 4992 6191 5718 -649 385 -101 C ATOM 18555 CD1 LEU O 20 124.413 332.987 170.688 1.00 40.68 C ANISOU18555 CD1 LEU O 20 4494 5755 5208 -640 395 -152 C ATOM 18556 CD2 LEU O 20 123.285 334.095 172.614 1.00 39.06 C ANISOU18556 CD2 LEU O 20 4339 5453 5051 -637 360 -113 C ATOM 18557 N LEU O 21 127.417 337.592 171.321 1.00 38.32 N ANISOU18557 N LEU O 21 4137 5374 5047 -706 404 2 N ATOM 18558 CA LEU O 21 128.658 338.216 171.773 1.00 39.90 C ANISOU18558 CA LEU O 21 4313 5554 5294 -720 400 14 C ATOM 18559 C LEU O 21 128.355 339.402 172.665 1.00 42.76 C ANISOU18559 C LEU O 21 4694 5857 5697 -730 383 50 C ATOM 18560 O LEU O 21 128.963 339.573 173.729 1.00 43.20 O ANISOU18560 O LEU O 21 4749 5874 5793 -734 361 43 O ATOM 18561 CB LEU O 21 129.526 338.673 170.596 1.00 50.35 C ANISOU18561 CB LEU O 21 5600 6919 6610 -736 429 37 C ATOM 18562 CG LEU O 21 130.071 337.580 169.706 1.00 49.47 C ANISOU18562 CG LEU O 21 5464 6869 6464 -729 447 1 C ATOM 18563 CD1 LEU O 21 130.869 338.233 168.550 1.00 50.89 C ANISOU18563 CD1 LEU O 21 5611 7089 6637 -747 477 31 C ATOM 18564 CD2 LEU O 21 130.969 336.753 170.530 1.00 54.32 C ANISOU18564 CD2 LEU O 21 6064 7474 7103 -720 432 -41 C ATOM 18565 N HIS O 22 127.405 340.248 172.256 1.00 40.01 N ANISOU18565 N HIS O 22 4365 5499 5339 -735 392 87 N ATOM 18566 CA HIS O 22 127.169 341.415 173.100 1.00 51.68 C ANISOU18566 CA HIS O 22 5859 6917 6859 -744 377 117 C ATOM 18567 C HIS O 22 126.535 341.000 174.410 1.00 40.49 C ANISOU18567 C HIS O 22 4473 5458 5452 -730 347 94 C ATOM 18568 O HIS O 22 126.826 341.588 175.460 1.00 42.97 O ANISOU18568 O HIS O 22 4795 5724 5808 -737 325 100 O ATOM 18569 CB HIS O 22 126.290 342.439 172.389 1.00 37.86 C ANISOU18569 CB HIS O 22 4123 5163 5098 -752 395 159 C ATOM 18570 CG HIS O 22 126.896 342.933 171.129 1.00 77.65 C ANISOU18570 CG HIS O 22 9136 10242 10126 -768 424 184 C ATOM 18571 ND1 HIS O 22 128.069 343.655 171.112 1.00 85.47 N ANISOU18571 ND1 HIS O 22 10098 11222 11153 -788 431 200 N ATOM 18572 CD2 HIS O 22 126.532 342.765 169.838 1.00 68.70 C ANISOU18572 CD2 HIS O 22 7997 9161 8944 -768 447 195 C ATOM 18573 CE1 HIS O 22 128.390 343.932 169.863 1.00 65.31 C ANISOU18573 CE1 HIS O 22 7525 8713 8576 -801 459 220 C ATOM 18574 NE2 HIS O 22 127.472 343.407 169.071 1.00 79.90 N ANISOU18574 NE2 HIS O 22 9387 10600 10371 -789 468 218 N ATOM 18575 N PHE O 23 125.646 340.013 174.356 1.00 37.18 N ANISOU18575 N PHE O 23 4074 5058 4995 -711 344 67 N ATOM 18576 CA PHE O 23 125.045 339.535 175.593 1.00 36.91 C ANISOU18576 CA PHE O 23 4069 4987 4968 -697 317 43 C ATOM 18577 C PHE O 23 126.106 338.944 176.509 1.00 39.75 C ANISOU18577 C PHE O 23 4418 5333 5352 -696 297 8 C ATOM 18578 O PHE O 23 126.092 339.181 177.726 1.00 43.91 O ANISOU18578 O PHE O 23 4964 5813 5906 -696 270 4 O ATOM 18579 CB PHE O 23 123.969 338.513 175.316 1.00 36.19 C ANISOU18579 CB PHE O 23 3997 4919 4833 -678 320 18 C ATOM 18580 CG PHE O 23 123.446 337.849 176.582 1.00 42.94 C ANISOU18580 CG PHE O 23 4881 5740 5695 -663 295 -14 C ATOM 18581 CD1 PHE O 23 122.707 338.571 177.492 1.00 39.42 C ANISOU18581 CD1 PHE O 23 4464 5245 5267 -663 278 5 C ATOM 18582 CD2 PHE O 23 123.767 336.535 176.883 1.00 44.62 C ANISOU18582 CD2 PHE O 23 5091 5966 5896 -650 287 -63 C ATOM 18583 CE1 PHE O 23 122.232 337.951 178.671 1.00 38.73 C ANISOU18583 CE1 PHE O 23 4405 5128 5184 -649 255 -24 C ATOM 18584 CE2 PHE O 23 123.307 335.927 178.062 1.00 50.56 C ANISOU18584 CE2 PHE O 23 5870 6684 6655 -636 264 -91 C ATOM 18585 CZ PHE O 23 122.550 336.642 178.935 1.00 44.83 C ANISOU18585 CZ PHE O 23 5174 5914 5945 -636 249 -71 C ATOM 18586 N HIS O 24 127.040 338.165 175.948 1.00 38.36 N ANISOU18586 N HIS O 24 4212 5197 5166 -696 308 -17 N ATOM 18587 CA HIS O 24 128.066 337.629 176.834 1.00 45.02 C ANISOU18587 CA HIS O 24 5045 6026 6035 -694 288 -49 C ATOM 18588 C HIS O 24 128.939 338.754 177.395 1.00 54.60 C ANISOU18588 C HIS O 24 6246 7205 7294 -714 275 -19 C ATOM 18589 O HIS O 24 129.287 338.732 178.576 1.00 41.72 O ANISOU18589 O HIS O 24 4626 5537 5688 -714 246 -34 O ATOM 18590 CB HIS O 24 128.885 336.557 176.113 1.00 41.99 C ANISOU18590 CB HIS O 24 4630 5691 5634 -687 305 -83 C ATOM 18591 CG HIS O 24 130.059 336.051 176.898 1.00 42.81 C ANISOU18591 CG HIS O 24 4717 5784 5767 -686 287 -113 C ATOM 18592 ND1 HIS O 24 131.362 336.417 176.626 1.00 40.82 N ANISOU18592 ND1 HIS O 24 4426 5544 5538 -701 293 -103 N ATOM 18593 CD2 HIS O 24 130.126 335.217 177.958 1.00 31.45 C ANISOU18593 CD2 HIS O 24 3292 4319 4337 -671 264 -152 C ATOM 18594 CE1 HIS O 24 132.180 335.816 177.462 1.00 40.47 C ANISOU18594 CE1 HIS O 24 4374 5487 5516 -695 274 -135 C ATOM 18595 NE2 HIS O 24 131.455 335.088 178.292 1.00 36.10 N ANISOU18595 NE2 HIS O 24 3852 4908 4954 -677 255 -165 N ATOM 18596 N ASP O 25 129.260 339.780 176.593 1.00 45.30 N ANISOU18596 N ASP O 25 5048 6037 6128 -732 294 22 N ATOM 18597 CA ASP O 25 130.043 340.896 177.139 1.00 52.99 C ANISOU18597 CA ASP O 25 6011 6974 7149 -753 279 50 C ATOM 18598 C ASP O 25 129.347 341.499 178.353 1.00 47.02 C ANISOU18598 C ASP O 25 5291 6159 6413 -753 250 58 C ATOM 18599 O ASP O 25 129.987 341.805 179.366 1.00 45.94 O ANISOU18599 O ASP O 25 5158 5989 6308 -763 221 55 O ATOM 18600 CB ASP O 25 130.251 342.002 176.091 1.00 38.92 C ANISOU18600 CB ASP O 25 4207 5203 5379 -771 308 95 C ATOM 18601 CG ASP O 25 131.245 341.620 174.992 1.00 53.33 C ANISOU18601 CG ASP O 25 5990 7081 7191 -777 335 91 C ATOM 18602 OD1 ASP O 25 132.026 340.667 175.153 1.00 39.71 O ANISOU18602 OD1 ASP O 25 4247 5379 5462 -770 329 57 O ATOM 18603 OD2 ASP O 25 131.256 342.307 173.949 1.00 48.94 O ANISOU18603 OD2 ASP O 25 5420 6545 6630 -789 364 121 O ATOM 18604 N HIS O 26 128.039 341.723 178.227 1.00 39.91 N ANISOU18604 N HIS O 26 4420 5249 5494 -744 256 71 N ATOM 18605 CA HIS O 26 127.220 342.266 179.305 1.00 44.47 C ANISOU18605 CA HIS O 26 5035 5774 6085 -742 231 77 C ATOM 18606 C HIS O 26 127.288 341.382 180.550 1.00 62.00 C ANISOU18606 C HIS O 26 7278 7977 8302 -730 200 35 C ATOM 18607 O HIS O 26 127.475 341.861 181.668 1.00 40.41 O ANISOU18607 O HIS O 26 4562 5200 5591 -737 170 35 O ATOM 18608 CB HIS O 26 125.780 342.389 178.788 1.00 41.52 C ANISOU18608 CB HIS O 26 4685 5406 5685 -730 249 92 C ATOM 18609 CG HIS O 26 124.747 342.600 179.847 1.00113.67 C ANISOU18609 CG HIS O 26 13864 14500 14826 -721 227 90 C ATOM 18610 ND1 HIS O 26 124.500 343.832 180.411 1.00 52.49 N ANISOU18610 ND1 HIS O 26 6130 6703 7110 -732 215 118 N ATOM 18611 CD2 HIS O 26 123.845 341.751 180.396 1.00 53.63 C ANISOU18611 CD2 HIS O 26 6289 6893 7195 -702 217 62 C ATOM 18612 CE1 HIS O 26 123.519 343.728 181.289 1.00 73.18 C ANISOU18612 CE1 HIS O 26 8788 9295 9721 -721 197 108 C ATOM 18613 NE2 HIS O 26 123.092 342.478 181.288 1.00 62.13 N ANISOU18613 NE2 HIS O 26 7398 7923 8287 -702 199 75 N ATOM 18614 N THR O 27 127.151 340.083 180.372 1.00 43.82 N ANISOU18614 N THR O 27 4975 5705 5969 -711 207 -2 N ATOM 18615 CA THR O 27 127.100 339.202 181.533 1.00 36.78 C ANISOU18615 CA THR O 27 4107 4793 5076 -696 181 -43 C ATOM 18616 C THR O 27 128.480 339.006 182.122 1.00 42.03 C ANISOU18616 C THR O 27 4753 5452 5766 -703 162 -61 C ATOM 18617 O THR O 27 128.639 338.914 183.339 1.00 42.60 O ANISOU18617 O THR O 27 4846 5489 5851 -700 133 -79 O ATOM 18618 CB THR O 27 126.506 337.869 181.097 1.00 40.52 C ANISOU18618 CB THR O 27 4584 5298 5513 -674 195 -77 C ATOM 18619 OG1 THR O 27 125.231 338.097 180.487 1.00 42.61 O ANISOU18619 OG1 THR O 27 4865 5572 5753 -668 212 -57 O ATOM 18620 CG2 THR O 27 126.412 336.908 182.288 1.00 43.54 C ANISOU18620 CG2 THR O 27 4990 5657 5896 -655 170 -119 C ATOM 18621 N LEU O 28 129.509 338.968 181.268 1.00 37.90 N ANISOU18621 N LEU O 28 4188 4964 5250 -714 179 -56 N ATOM 18622 CA LEU O 28 130.854 338.764 181.786 1.00 38.33 C ANISOU18622 CA LEU O 28 4220 5015 5328 -721 163 -72 C ATOM 18623 C LEU O 28 131.269 339.934 182.661 1.00 40.57 C ANISOU18623 C LEU O 28 4514 5256 5644 -743 135 -47 C ATOM 18624 O LEU O 28 131.979 339.771 183.668 1.00 39.79 O ANISOU18624 O LEU O 28 4421 5137 5561 -745 107 -67 O ATOM 18625 CB LEU O 28 131.846 338.572 180.634 1.00 40.89 C ANISOU18625 CB LEU O 28 4496 5387 5653 -729 189 -68 C ATOM 18626 CG LEU O 28 133.306 338.459 181.095 1.00 55.89 C ANISOU18626 CG LEU O 28 6367 7286 7581 -739 173 -80 C ATOM 18627 CD1 LEU O 28 133.532 337.299 182.094 1.00 45.68 C ANISOU18627 CD1 LEU O 28 5087 5981 6287 -718 151 -129 C ATOM 18628 CD2 LEU O 28 134.245 338.320 179.915 1.00 55.20 C ANISOU18628 CD2 LEU O 28 6231 7248 7495 -746 202 -74 C ATOM 18629 N MET O 29 130.806 341.127 182.300 1.00 40.08 N ANISOU18629 N MET O 29 4457 5180 5592 -759 141 -5 N ATOM 18630 CA MET O 29 131.111 342.273 183.139 1.00 40.68 C ANISOU18630 CA MET O 29 4547 5214 5696 -781 113 18 C ATOM 18631 C MET O 29 130.512 342.107 184.522 1.00 37.04 C ANISOU18631 C MET O 29 4134 4711 5227 -770 82 -7 C ATOM 18632 O MET O 29 131.177 342.404 185.522 1.00 40.49 O ANISOU18632 O MET O 29 4583 5123 5678 -782 53 -16 O ATOM 18633 CB MET O 29 130.578 343.550 182.536 1.00 42.09 C ANISOU18633 CB MET O 29 4724 5378 5888 -796 126 67 C ATOM 18634 CG MET O 29 131.122 344.748 183.301 1.00 56.90 C ANISOU18634 CG MET O 29 6615 7217 7789 -820 97 87 C ATOM 18635 SD MET O 29 130.192 346.215 182.880 1.00 61.70 S ANISOU18635 SD MET O 29 7243 7795 8406 -823 108 133 S ATOM 18636 CE MET O 29 128.798 345.969 184.009 1.00 51.25 C ANISOU18636 CE MET O 29 5980 6439 7054 -808 87 109 C ATOM 18637 N ILE O 30 129.265 341.634 184.588 1.00 39.63 N ANISOU18637 N ILE O 30 4491 5036 5531 -748 90 -19 N ATOM 18638 CA ILE O 30 128.612 341.393 185.880 1.00 35.86 C ANISOU18638 CA ILE O 30 4058 4520 5045 -734 65 -44 C ATOM 18639 C ILE O 30 129.373 340.349 186.682 1.00 41.42 C ANISOU18639 C ILE O 30 4762 5225 5749 -721 46 -85 C ATOM 18640 O ILE O 30 129.644 340.531 187.875 1.00 42.11 O ANISOU18640 O ILE O 30 4875 5279 5844 -723 17 -98 O ATOM 18641 CB ILE O 30 127.151 340.973 185.670 1.00 40.43 C ANISOU18641 CB ILE O 30 4662 5101 5599 -712 80 -48 C ATOM 18642 CG1 ILE O 30 126.387 342.110 185.000 1.00 38.16 C ANISOU18642 CG1 ILE O 30 4377 4807 5314 -724 96 -4 C ATOM 18643 CG2 ILE O 30 126.495 340.580 187.010 1.00 39.07 C ANISOU18643 CG2 ILE O 30 4535 4893 5418 -693 56 -75 C ATOM 18644 CD1 ILE O 30 125.030 341.722 184.486 1.00 51.97 C ANISOU18644 CD1 ILE O 30 6140 6568 7036 -705 117 -2 C ATOM 18645 N VAL O 31 129.669 339.205 186.053 1.00 35.50 N ANISOU18645 N VAL O 31 3987 4513 4989 -706 63 -108 N ATOM 18646 CA VAL O 31 130.488 338.168 186.675 1.00 34.73 C ANISOU18646 CA VAL O 31 3882 4419 4896 -693 48 -145 C ATOM 18647 C VAL O 31 131.807 338.717 187.200 1.00 51.79 C ANISOU18647 C VAL O 31 6026 6568 7083 -714 27 -140 C ATOM 18648 O VAL O 31 132.246 338.363 188.312 1.00 39.15 O ANISOU18648 O VAL O 31 4441 4946 5488 -708 -1 -163 O ATOM 18649 CB VAL O 31 130.763 337.056 185.654 1.00 46.34 C ANISOU18649 CB VAL O 31 5317 5935 6354 -680 75 -165 C ATOM 18650 CG1 VAL O 31 131.927 336.152 186.133 1.00 39.03 C ANISOU18650 CG1 VAL O 31 4372 5017 5443 -672 61 -198 C ATOM 18651 CG2 VAL O 31 129.465 336.301 185.385 1.00 49.63 C ANISOU18651 CG2 VAL O 31 5755 6360 6741 -657 89 -179 C ATOM 18652 N PHE O 32 132.532 339.486 186.362 1.00 44.74 N ANISOU18652 N PHE O 32 5099 5695 6206 -739 39 -111 N ATOM 18653 CA PHE O 32 133.807 340.042 186.816 1.00 40.63 C ANISOU18653 CA PHE O 32 4561 5167 5710 -763 19 -105 C ATOM 18654 C PHE O 32 133.580 340.954 188.020 1.00 38.80 C ANISOU18654 C PHE O 32 4372 4889 5483 -776 -12 -99 C ATOM 18655 O PHE O 32 134.308 340.877 189.009 1.00 40.89 O ANISOU18655 O PHE O 32 4646 5137 5756 -780 -38 -118 O ATOM 18656 CB PHE O 32 134.563 340.852 185.723 1.00 38.44 C ANISOU18656 CB PHE O 32 4240 4916 5449 -790 37 -68 C ATOM 18657 CG APHE O 32 135.363 340.032 184.720 0.70 59.47 C ANISOU18657 CG APHE O 32 6853 7628 8114 -783 63 -78 C ATOM 18658 CG BPHE O 32 135.976 341.239 186.154 0.30 26.40 C ANISOU18658 CG BPHE O 32 2692 3390 3949 -815 17 -66 C ATOM 18659 CD1APHE O 32 135.965 338.838 185.075 0.70 65.91 C ANISOU18659 CD1APHE O 32 7657 8456 8929 -764 57 -119 C ATOM 18660 CD1BPHE O 32 136.992 340.297 186.179 0.30 40.69 C ANISOU18660 CD1BPHE O 32 4471 5224 5767 -805 17 -93 C ATOM 18661 CD2APHE O 32 135.558 340.516 183.415 0.70 78.43 C ANISOU18661 CD2APHE O 32 9219 10062 10520 -796 94 -45 C ATOM 18662 CD2BPHE O 32 136.271 342.529 186.563 0.30 25.96 C ANISOU18662 CD2BPHE O 32 2648 3310 3905 -848 -1 -39 C ATOM 18663 CE1APHE O 32 136.721 338.113 184.140 0.70 59.23 C ANISOU18663 CE1APHE O 32 6765 7655 8084 -758 82 -131 C ATOM 18664 CE1BPHE O 32 138.268 340.649 186.580 0.30 38.31 C ANISOU18664 CE1BPHE O 32 4147 4923 5487 -828 -1 -91 C ATOM 18665 CE2APHE O 32 136.315 339.796 182.458 0.70 35.07 C ANISOU18665 CE2APHE O 32 3682 4617 5027 -790 120 -56 C ATOM 18666 CE2BPHE O 32 137.550 342.871 186.982 0.30 29.59 C ANISOU18666 CE2BPHE O 32 3089 3772 4382 -873 -19 -40 C ATOM 18667 CZ APHE O 32 136.907 338.600 182.839 0.70 53.26 C ANISOU18667 CZ APHE O 32 5975 6933 7328 -772 114 -100 C ATOM 18668 CZ BPHE O 32 138.538 341.934 186.982 0.30 18.45 C ANISOU18668 CZ BPHE O 32 1643 2384 2981 -862 -19 -64 C ATOM 18669 N LEU O 33 132.581 341.833 187.938 1.00 39.27 N ANISOU18669 N LEU O 33 4459 4928 5535 -783 -8 -75 N ATOM 18670 CA LEU O 33 132.277 342.726 189.060 1.00 44.96 C ANISOU18670 CA LEU O 33 5224 5603 6255 -795 -34 -74 C ATOM 18671 C LEU O 33 131.946 341.956 190.339 1.00 40.14 C ANISOU18671 C LEU O 33 4651 4968 5633 -769 -56 -111 C ATOM 18672 O LEU O 33 132.440 342.303 191.409 1.00 42.74 O ANISOU18672 O LEU O 33 5001 5272 5965 -779 -82 -124 O ATOM 18673 CB LEU O 33 131.114 343.628 188.718 1.00 43.32 C ANISOU18673 CB LEU O 33 5039 5378 6040 -801 -24 -45 C ATOM 18674 CG LEU O 33 131.287 345.123 188.619 1.00 67.00 C ANISOU18674 CG LEU O 33 8048 8362 9048 -835 -26 -14 C ATOM 18675 CD1 LEU O 33 132.712 345.542 188.843 1.00 65.32 C ANISOU18675 CD1 LEU O 33 7815 8154 8848 -863 -38 -17 C ATOM 18676 CD2 LEU O 33 130.783 345.541 187.273 1.00 46.31 C ANISOU18676 CD2 LEU O 33 5404 5764 6428 -836 3 25 C ATOM 18677 N ILE O 34 131.115 340.908 190.255 1.00 39.99 N ANISOU18677 N ILE O 34 4640 4958 5597 -738 -46 -129 N ATOM 18678 CA ILE O 34 130.677 340.269 191.511 1.00 35.61 C ANISOU18678 CA ILE O 34 4123 4377 5028 -715 -67 -158 C ATOM 18679 C ILE O 34 131.806 339.457 192.077 1.00 47.39 C ANISOU18679 C ILE O 34 5599 5877 6528 -709 -84 -184 C ATOM 18680 O ILE O 34 132.063 339.482 193.278 1.00 41.26 O ANISOU18680 O ILE O 34 4850 5077 5751 -708 -110 -199 O ATOM 18681 CB ILE O 34 129.424 339.386 191.306 1.00 34.26 C ANISOU18681 CB ILE O 34 3968 4213 4836 -684 -52 -168 C ATOM 18682 CG1 ILE O 34 128.247 340.274 190.959 1.00 34.46 C ANISOU18682 CG1 ILE O 34 4015 4225 4855 -689 -39 -143 C ATOM 18683 CG2 ILE O 34 129.140 338.536 192.572 1.00 35.50 C ANISOU18683 CG2 ILE O 34 4158 4350 4980 -660 -75 -197 C ATOM 18684 CD1 ILE O 34 127.049 339.505 190.331 1.00 32.65 C ANISOU18684 CD1 ILE O 34 3788 4013 4605 -665 -16 -146 C ATOM 18685 N SER O 35 132.524 338.738 191.211 1.00 33.20 N ANISOU18685 N SER O 35 3757 4116 4740 -707 -68 -189 N ATOM 18686 CA SER O 35 133.642 337.942 191.714 1.00 34.54 C ANISOU18686 CA SER O 35 3909 4295 4922 -701 -84 -214 C ATOM 18687 C SER O 35 134.705 338.838 192.337 1.00 45.53 C ANISOU18687 C SER O 35 5297 5672 6331 -729 -106 -207 C ATOM 18688 O SER O 35 135.274 338.492 193.393 1.00 34.95 O ANISOU18688 O SER O 35 3968 4318 4994 -724 -131 -227 O ATOM 18689 CB SER O 35 134.232 337.052 190.601 1.00 42.25 C ANISOU18689 CB SER O 35 4835 5314 5905 -693 -60 -223 C ATOM 18690 OG SER O 35 134.559 337.802 189.462 1.00 59.52 O ANISOU18690 OG SER O 35 6989 7524 8100 -716 -38 -195 O ATOM 18691 N SER O 36 134.934 340.020 191.746 1.00 39.13 N ANISOU18691 N SER O 36 4474 4863 5530 -759 -98 -178 N ATOM 18692 CA SER O 36 135.952 340.941 192.260 1.00 42.23 C ANISOU18692 CA SER O 36 4863 5244 5938 -791 -117 -171 C ATOM 18693 C SER O 36 135.491 341.596 193.547 1.00 35.33 C ANISOU18693 C SER O 36 4043 4327 5053 -794 -140 -180 C ATOM 18694 O SER O 36 136.298 341.835 194.452 1.00 43.58 O ANISOU18694 O SER O 36 5094 5359 6106 -806 -162 -194 O ATOM 18695 CB SER O 36 136.287 342.031 191.211 1.00 42.12 C ANISOU18695 CB SER O 36 4822 5245 5937 -824 -100 -136 C ATOM 18696 OG SER O 36 136.964 341.483 190.088 1.00 63.15 O ANISOU18696 OG SER O 36 7431 7951 8612 -824 -79 -128 O ATOM 18697 N LEU O 37 134.198 341.927 193.623 1.00 39.30 N ANISOU18697 N LEU O 37 4583 4811 5540 -784 -134 -172 N ATOM 18698 CA LEU O 37 133.631 342.424 194.873 1.00 39.11 C ANISOU18698 CA LEU O 37 4611 4746 5501 -782 -153 -185 C ATOM 18699 C LEU O 37 133.834 341.428 196.020 1.00 40.74 C ANISOU18699 C LEU O 37 4833 4946 5698 -758 -174 -215 C ATOM 18700 O LEU O 37 134.222 341.806 197.138 1.00 38.39 O ANISOU18700 O LEU O 37 4561 4627 5400 -766 -195 -230 O ATOM 18701 CB LEU O 37 132.144 342.718 194.687 1.00 41.51 C ANISOU18701 CB LEU O 37 4948 5035 5790 -769 -140 -173 C ATOM 18702 CG LEU O 37 131.532 343.214 195.999 1.00 55.02 C ANISOU18702 CG LEU O 37 6714 6706 7486 -764 -158 -187 C ATOM 18703 CD1 LEU O 37 132.183 344.552 196.400 1.00 51.63 C ANISOU18703 CD1 LEU O 37 6295 6254 7069 -798 -165 -185 C ATOM 18704 CD2 LEU O 37 130.016 343.356 195.931 1.00 43.14 C ANISOU18704 CD2 LEU O 37 5241 5186 5966 -745 -147 -178 C ATOM 18705 N VAL O 38 133.579 340.148 195.765 1.00 38.89 N ANISOU18705 N VAL O 38 4587 4732 5458 -730 -168 -226 N ATOM 18706 CA VAL O 38 133.698 339.158 196.829 1.00 37.94 C ANISOU18706 CA VAL O 38 4483 4606 5328 -707 -187 -252 C ATOM 18707 C VAL O 38 135.153 339.016 197.280 1.00 43.78 C ANISOU18707 C VAL O 38 5196 5352 6086 -720 -205 -265 C ATOM 18708 O VAL O 38 135.446 338.953 198.484 1.00 42.86 O ANISOU18708 O VAL O 38 5102 5219 5963 -718 -228 -281 O ATOM 18709 CB VAL O 38 133.099 337.815 196.361 1.00 42.99 C ANISOU18709 CB VAL O 38 5112 5265 5959 -675 -174 -261 C ATOM 18710 CG1 VAL O 38 133.604 336.689 197.239 1.00 33.66 C ANISOU18710 CG1 VAL O 38 3931 4084 4775 -656 -193 -286 C ATOM 18711 CG2 VAL O 38 131.547 337.872 196.340 1.00 39.61 C ANISOU18711 CG2 VAL O 38 4720 4822 5507 -659 -163 -254 C ATOM 18712 N LEU O 39 136.091 338.973 196.315 1.00 36.68 N ANISOU18712 N LEU O 39 4247 4480 5209 -733 -194 -257 N ATOM 18713 CA LEU O 39 137.507 338.887 196.655 1.00 40.19 C ANISOU18713 CA LEU O 39 4662 4934 5675 -747 -210 -267 C ATOM 18714 C LEU O 39 137.929 340.095 197.476 1.00 44.48 C ANISOU18714 C LEU O 39 5228 5453 6221 -775 -228 -265 C ATOM 18715 O LEU O 39 138.614 339.955 198.492 1.00 37.90 O ANISOU18715 O LEU O 39 4399 4610 5392 -776 -251 -283 O ATOM 18716 CB LEU O 39 138.365 338.808 195.380 1.00 36.86 C ANISOU18716 CB LEU O 39 4183 4547 5276 -759 -192 -255 C ATOM 18717 CG LEU O 39 139.851 338.618 195.672 1.00 42.19 C ANISOU18717 CG LEU O 39 4821 5235 5974 -771 -207 -266 C ATOM 18718 CD1 LEU O 39 140.087 337.383 196.531 1.00 38.96 C ANISOU18718 CD1 LEU O 39 4415 4822 5564 -742 -226 -294 C ATOM 18719 CD2 LEU O 39 140.653 338.489 194.389 1.00 44.91 C ANISOU18719 CD2 LEU O 39 5108 5617 6340 -782 -186 -254 C ATOM 18720 N TYR O 40 137.495 341.286 197.061 1.00 36.91 N ANISOU18720 N TYR O 40 4281 4482 5260 -798 -217 -246 N ATOM 18721 CA TYR O 40 137.836 342.509 197.782 1.00 38.70 C ANISOU18721 CA TYR O 40 4530 4683 5491 -826 -230 -247 C ATOM 18722 C TYR O 40 137.293 342.490 199.201 1.00 37.36 C ANISOU18722 C TYR O 40 4410 4482 5301 -811 -249 -269 C ATOM 18723 O TYR O 40 138.023 342.804 200.158 1.00 41.26 O ANISOU18723 O TYR O 40 4912 4964 5802 -823 -269 -285 O ATOM 18724 CB TYR O 40 137.287 343.749 197.061 1.00 34.33 C ANISOU18724 CB TYR O 40 3986 4118 4939 -849 -211 -223 C ATOM 18725 CG TYR O 40 137.487 345.016 197.909 1.00 45.82 C ANISOU18725 CG TYR O 40 5471 5540 6398 -874 -223 -230 C ATOM 18726 CD1 TYR O 40 138.764 345.466 198.257 1.00 60.33 C ANISOU18726 CD1 TYR O 40 7288 7379 8257 -900 -236 -239 C ATOM 18727 CD2 TYR O 40 136.403 345.712 198.422 1.00 48.87 C ANISOU18727 CD2 TYR O 40 5907 5893 6770 -870 -220 -233 C ATOM 18728 CE1 TYR O 40 138.943 346.620 199.081 1.00 47.53 C ANISOU18728 CE1 TYR O 40 5693 5723 6642 -922 -247 -250 C ATOM 18729 CE2 TYR O 40 136.577 346.846 199.222 1.00 46.28 C ANISOU18729 CE2 TYR O 40 5605 5531 6447 -890 -229 -244 C ATOM 18730 CZ TYR O 40 137.824 347.291 199.541 1.00 60.90 C ANISOU18730 CZ TYR O 40 7436 7383 8321 -915 -242 -253 C ATOM 18731 OH TYR O 40 137.930 348.404 200.330 1.00 53.31 O ANISOU18731 OH TYR O 40 6501 6386 7368 -933 -250 -266 O ATOM 18732 N ILE O 41 136.008 342.165 199.362 1.00 43.89 N ANISOU18732 N ILE O 41 5273 5298 6105 -787 -242 -269 N ATOM 18733 CA ILE O 41 135.423 342.150 200.707 1.00 47.01 C ANISOU18733 CA ILE O 41 5716 5667 6479 -773 -257 -289 C ATOM 18734 C ILE O 41 136.128 341.139 201.591 1.00 45.17 C ANISOU18734 C ILE O 41 5475 5443 6245 -759 -278 -310 C ATOM 18735 O ILE O 41 136.359 341.380 202.788 1.00 43.56 O ANISOU18735 O ILE O 41 5295 5221 6034 -762 -296 -328 O ATOM 18736 CB ILE O 41 133.914 341.876 200.639 1.00 49.43 C ANISOU18736 CB ILE O 41 6056 5964 6760 -749 -244 -283 C ATOM 18737 CG1 ILE O 41 133.256 343.075 200.001 1.00 43.49 C ANISOU18737 CG1 ILE O 41 5316 5196 6011 -765 -228 -263 C ATOM 18738 CG2 ILE O 41 133.346 341.590 202.044 1.00 37.17 C ANISOU18738 CG2 ILE O 41 4549 4393 5183 -731 -258 -304 C ATOM 18739 CD1 ILE O 41 131.819 342.843 199.661 1.00 66.17 C ANISOU18739 CD1 ILE O 41 8212 8065 8865 -743 -213 -253 C ATOM 18740 N ILE O 42 136.441 339.959 201.041 1.00 41.68 N ANISOU18740 N ILE O 42 4999 5027 5809 -741 -275 -310 N ATOM 18741 CA ILE O 42 137.263 339.035 201.828 1.00 46.90 C ANISOU18741 CA ILE O 42 5648 5697 6476 -730 -296 -329 C ATOM 18742 C ILE O 42 138.475 339.779 202.363 1.00 47.47 C ANISOU18742 C ILE O 42 5706 5763 6567 -757 -315 -337 C ATOM 18743 O ILE O 42 138.740 339.793 203.570 1.00 44.06 O ANISOU18743 O ILE O 42 5294 5318 6129 -756 -336 -354 O ATOM 18744 CB ILE O 42 137.672 337.809 200.986 1.00 44.04 C ANISOU18744 CB ILE O 42 5242 5364 6129 -712 -289 -329 C ATOM 18745 CG1 ILE O 42 136.475 336.886 200.764 1.00 50.57 C ANISOU18745 CG1 ILE O 42 6087 6193 6935 -681 -276 -329 C ATOM 18746 CG2 ILE O 42 138.828 337.005 201.644 1.00 36.71 C ANISOU18746 CG2 ILE O 42 4288 4444 5216 -705 -312 -347 C ATOM 18747 CD1 ILE O 42 136.849 335.677 199.920 1.00 41.36 C ANISOU18747 CD1 ILE O 42 4877 5053 5783 -662 -266 -334 C ATOM 18748 N SER O 43 139.205 340.452 201.480 1.00 44.07 N ANISOU18748 N SER O 43 5241 5343 6159 -783 -306 -323 N ATOM 18749 CA SER O 43 140.424 341.117 201.923 1.00 40.06 C ANISOU18749 CA SER O 43 4715 4832 5672 -810 -323 -330 C ATOM 18750 C SER O 43 140.106 342.241 202.909 1.00 39.93 C ANISOU18750 C SER O 43 4743 4783 5646 -826 -333 -339 C ATOM 18751 O SER O 43 140.787 342.402 203.935 1.00 41.62 O ANISOU18751 O SER O 43 4962 4988 5866 -833 -356 -357 O ATOM 18752 CB SER O 43 141.218 341.624 200.707 1.00 43.18 C ANISOU18752 CB SER O 43 5064 5248 6094 -836 -309 -311 C ATOM 18753 OG SER O 43 140.613 342.777 200.142 1.00 47.85 O ANISOU18753 OG SER O 43 5673 5827 6683 -857 -291 -293 O ATOM 18754 N LEU O 44 139.023 342.973 202.654 1.00 42.23 N ANISOU18754 N LEU O 44 5066 5056 5922 -828 -316 -329 N ATOM 18755 CA LEU O 44 138.570 343.998 203.595 1.00 39.97 C ANISOU18755 CA LEU O 44 4824 4736 5625 -838 -322 -341 C ATOM 18756 C LEU O 44 138.278 343.421 204.986 1.00 42.97 C ANISOU18756 C LEU O 44 5237 5106 5985 -816 -341 -365 C ATOM 18757 O LEU O 44 138.677 343.999 206.007 1.00 43.66 O ANISOU18757 O LEU O 44 5340 5175 6074 -828 -358 -383 O ATOM 18758 CB LEU O 44 137.330 344.679 203.021 1.00 35.76 C ANISOU18758 CB LEU O 44 4320 4187 5080 -837 -299 -326 C ATOM 18759 CG LEU O 44 136.672 345.720 203.875 1.00 47.65 C ANISOU18759 CG LEU O 44 5872 5656 6576 -842 -300 -338 C ATOM 18760 CD1 LEU O 44 137.585 346.915 203.970 1.00 53.05 C ANISOU18760 CD1 LEU O 44 6546 6324 7286 -877 -306 -341 C ATOM 18761 CD2 LEU O 44 135.391 346.056 203.179 1.00 47.97 C ANISOU18761 CD2 LEU O 44 5935 5687 6604 -834 -276 -320 C ATOM 18762 N MET O 45 137.603 342.271 205.056 1.00 46.29 N ANISOU18762 N MET O 45 5666 5538 6385 -786 -338 -366 N ATOM 18763 CA MET O 45 137.271 341.669 206.355 1.00 45.69 C ANISOU18763 CA MET O 45 5619 5455 6288 -766 -353 -386 C ATOM 18764 C MET O 45 138.494 341.203 207.130 1.00 46.60 C ANISOU18764 C MET O 45 5710 5579 6417 -769 -381 -402 C ATOM 18765 O MET O 45 138.432 341.067 208.360 1.00 45.87 O ANISOU18765 O MET O 45 5641 5476 6310 -762 -399 -420 O ATOM 18766 CB MET O 45 136.354 340.441 206.179 1.00 45.26 C ANISOU18766 CB MET O 45 5572 5412 6211 -733 -344 -381 C ATOM 18767 CG MET O 45 135.057 340.673 205.442 1.00 41.93 C ANISOU18767 CG MET O 45 5172 4984 5774 -724 -319 -365 C ATOM 18768 SD MET O 45 133.921 341.770 206.332 1.00 46.23 S ANISOU18768 SD MET O 45 5775 5495 6295 -727 -312 -375 S ATOM 18769 CE MET O 45 134.268 343.410 205.669 1.00 45.62 C ANISOU18769 CE MET O 45 5693 5400 6242 -761 -303 -364 C ATOM 18770 N LEU O 46 139.578 340.889 206.438 1.00 39.13 N ANISOU18770 N LEU O 46 4718 4654 5498 -778 -386 -394 N ATOM 18771 CA LEU O 46 140.699 340.196 207.045 1.00 48.02 C ANISOU18771 CA LEU O 46 5816 5792 6639 -776 -413 -407 C ATOM 18772 C LEU O 46 141.847 341.129 207.409 1.00 77.12 C ANISOU18772 C LEU O 46 9484 9470 10346 -807 -431 -414 C ATOM 18773 O LEU O 46 142.835 340.682 207.998 1.00 46.93 O ANISOU18773 O LEU O 46 5638 5655 6537 -808 -456 -424 O ATOM 18774 CB LEU O 46 141.174 339.100 206.093 1.00 40.97 C ANISOU18774 CB LEU O 46 4878 4927 5763 -762 -407 -397 C ATOM 18775 CG LEU O 46 140.148 338.012 205.767 1.00 56.85 C ANISOU18775 CG LEU O 46 6901 6945 7756 -729 -392 -392 C ATOM 18776 CD1 LEU O 46 140.792 337.054 204.770 1.00 68.01 C ANISOU18776 CD1 LEU O 46 8263 8384 9192 -719 -386 -386 C ATOM 18777 CD2 LEU O 46 139.685 337.290 207.013 1.00 47.26 C ANISOU18777 CD2 LEU O 46 5717 5722 6519 -707 -409 -407 C ATOM 18778 N THR O 47 141.731 342.419 207.098 1.00 42.57 N ATOM 18779 CA THR O 47 142.842 343.364 207.255 1.00 59.18 C ATOM 18780 C THR O 47 142.573 344.469 208.287 1.00 71.23 C ATOM 18781 O THR O 47 143.035 345.606 208.143 1.00 42.79 O ATOM 18782 CB THR O 47 143.211 343.973 205.901 1.00 52.46 C ATOM 18783 OG1 THR O 47 142.044 344.545 205.280 1.00 45.12 O ATOM 18784 CG2 THR O 47 143.810 342.911 204.987 1.00 83.65 C