>>3AG2:HELIX   24 AC6 TYR A  447  LYS A  479  1                                  33    
YTMWNTISSMGSFISLTAVMLMVFIIWEAFASK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 24 AC6 TYR A 447 LYS A 479 1 33 ATOM 3519 N TYR A 447 41.532 302.499 175.426 1.00 25.51 N ANISOU 3519 N TYR A 447 3203 3893 2597 -495 -282 115 N ATOM 3520 CA TYR A 447 42.009 302.578 176.823 1.00 23.17 C ANISOU 3520 CA TYR A 447 2929 3539 2337 -476 -268 117 C ATOM 3521 C TYR A 447 40.901 303.024 177.778 1.00 32.87 C ANISOU 3521 C TYR A 447 4138 4772 3578 -461 -268 143 C ATOM 3522 O TYR A 447 41.169 303.251 178.951 1.00 30.01 O ANISOU 3522 O TYR A 447 3789 4369 3243 -443 -257 149 O ATOM 3523 CB TYR A 447 43.174 303.559 176.947 1.00 26.15 C ANISOU 3523 CB TYR A 447 3325 3886 2724 -444 -258 132 C ATOM 3524 CG TYR A 447 44.388 303.213 176.095 1.00 29.03 C ANISOU 3524 CG TYR A 447 3710 4243 3078 -454 -255 108 C ATOM 3525 CD1 TYR A 447 45.098 302.027 176.340 1.00 24.92 C ANISOU 3525 CD1 TYR A 447 3212 3689 2569 -474 -248 70 C ATOM 3526 CD2 TYR A 447 44.797 304.038 175.028 1.00 27.31 C ANISOU 3526 CD2 TYR A 447 3486 4053 2837 -443 -259 125 C ATOM 3527 CE1 TYR A 447 46.198 301.662 175.606 1.00 26.18 C ANISOU 3527 CE1 TYR A 447 3388 3840 2718 -482 -244 46 C ATOM 3528 CE2 TYR A 447 45.900 303.652 174.224 1.00 28.82 C ANISOU 3528 CE2 TYR A 447 3693 4240 3016 -454 -255 101 C ATOM 3529 CZ TYR A 447 46.608 302.486 174.539 1.00 32.03 C ANISOU 3529 CZ TYR A 447 4123 4612 3435 -473 -247 61 C ATOM 3530 OH TYR A 447 47.697 302.111 173.787 1.00 29.88 O ANISOU 3530 OH TYR A 447 3866 4335 3152 -482 -242 36 O ATOM 3531 N THR A 448 39.673 303.188 177.288 1.00 27.40 N ANISOU 3531 N THR A 448 3413 4131 2868 -469 -281 158 N ATOM 3532 CA THR A 448 38.634 303.829 178.089 1.00 25.48 C ANISOU 3532 CA THR A 448 3148 3897 2636 -450 -281 187 C ATOM 3533 C THR A 448 38.308 303.049 179.343 1.00 26.45 C ANISOU 3533 C THR A 448 3278 3989 2783 -460 -272 174 C ATOM 3534 O THR A 448 38.171 303.637 180.443 1.00 27.92 O ANISOU 3534 O THR A 448 3466 4152 2990 -434 -263 191 O ATOM 3535 CB THR A 448 37.367 304.013 177.217 1.00 30.23 C ANISOU 3535 CB THR A 448 3711 4565 3211 -460 -297 204 C ATOM 3536 OG1 THR A 448 37.701 304.984 176.223 1.00 29.26 O ANISOU 3536 OG1 THR A 448 3581 4466 3069 -442 -304 227 O ATOM 3537 CG2 THR A 448 36.118 304.478 178.097 1.00 30.25 C ANISOU 3537 CG2 THR A 448 3687 4581 3227 -444 -297 230 C ATOM 3538 N MET A 449 38.148 301.717 179.223 1.00 26.25 N ANISOU 3538 N MET A 449 3255 3963 2754 -498 -274 142 N ATOM 3539 CA MET A 449 37.640 300.995 180.395 1.00 35.91 C ANISOU 3539 CA MET A 449 4481 5165 4000 -509 -267 136 C ATOM 3540 C MET A 449 38.579 301.115 181.618 1.00 28.11 C ANISOU 3540 C MET A 449 3523 4117 3040 -487 -251 135 C ATOM 3541 O MET A 449 38.116 301.344 182.753 1.00 28.69 O ANISOU 3541 O MET A 449 3592 4178 3129 -473 -243 150 O ATOM 3542 CB MET A 449 37.413 299.527 180.080 1.00 28.68 C ANISOU 3542 CB MET A 449 3566 4251 3080 -554 -271 102 C ATOM 3543 CG MET A 449 37.033 298.814 181.409 1.00 40.30 C ANISOU 3543 CG MET A 449 5043 5692 4578 -563 -260 98 C ATOM 3544 SD MET A 449 36.468 297.178 181.133 1.00 57.11 S ANISOU 3544 SD MET A 449 7166 7826 6706 -616 -265 65 S ATOM 3545 CE MET A 449 34.867 297.454 180.356 1.00 49.95 C ANISOU 3545 CE MET A 449 6211 6994 5773 -631 -282 80 C ATOM 3546 N TRP A 450 39.881 300.880 181.424 1.00 26.41 N ANISOU 3546 N TRP A 450 3337 3867 2829 -486 -245 116 N ATOM 3547 CA TRP A 450 40.759 300.933 182.610 1.00 34.60 C ANISOU 3547 CA TRP A 450 4402 4852 3893 -467 -231 115 C ATOM 3548 C TRP A 450 40.866 302.347 183.162 1.00 30.16 C ANISOU 3548 C TRP A 450 3838 4284 3339 -426 -226 144 C ATOM 3549 O TRP A 450 40.940 302.546 184.393 1.00 26.74 O ANISOU 3549 O TRP A 450 3413 3823 2925 -409 -216 151 O ATOM 3550 CB TRP A 450 42.149 300.364 182.286 1.00 28.51 C ANISOU 3550 CB TRP A 450 3662 4045 3126 -474 -226 88 C ATOM 3551 CG TRP A 450 42.091 298.945 181.754 1.00 27.50 C ANISOU 3551 CG TRP A 450 3538 3918 2994 -514 -230 56 C ATOM 3552 CD1 TRP A 450 42.743 298.448 180.625 1.00 28.09 C ANISOU 3552 CD1 TRP A 450 3620 3997 3054 -531 -234 30 C ATOM 3553 CD2 TRP A 450 41.339 297.848 182.291 1.00 31.60 C ANISOU 3553 CD2 TRP A 450 4052 4432 3524 -541 -229 44 C ATOM 3554 NE1 TRP A 450 42.437 297.111 180.466 1.00 32.12 N ANISOU 3554 NE1 TRP A 450 4132 4504 3568 -568 -235 1 N ATOM 3555 CE2 TRP A 450 41.575 296.725 181.452 1.00 29.74 C ANISOU 3555 CE2 TRP A 450 3822 4197 3282 -575 -233 11 C ATOM 3556 CE3 TRP A 450 40.508 297.694 183.410 1.00 36.88 C ANISOU 3556 CE3 TRP A 450 4711 5096 4206 -541 -225 59 C ATOM 3557 CZ2 TRP A 450 40.998 295.493 181.696 1.00 37.11 C ANISOU 3557 CZ2 TRP A 450 4752 5122 4224 -609 -233 -8 C ATOM 3558 CZ3 TRP A 450 39.930 296.478 183.623 1.00 43.62 C ANISOU 3558 CZ3 TRP A 450 5560 5946 5068 -575 -225 43 C ATOM 3559 CH2 TRP A 450 40.183 295.390 182.795 1.00 42.44 C ANISOU 3559 CH2 TRP A 450 5418 5793 4915 -608 -228 10 C ATOM 3560 N ASN A 451 40.860 303.353 182.275 1.00 28.33 N ANISOU 3560 N ASN A 451 3594 4078 3091 -409 -233 162 N ATOM 3561 CA ASN A 451 40.856 304.734 182.772 1.00 28.62 C ANISOU 3561 CA ASN A 451 3626 4109 3138 -371 -228 191 C ATOM 3562 C ASN A 451 39.599 305.055 183.578 1.00 39.97 C ANISOU 3562 C ASN A 451 5040 5565 4582 -361 -227 210 C ATOM 3563 O ASN A 451 39.666 305.816 184.540 1.00 28.69 O ANISOU 3563 O ASN A 451 3615 4115 3172 -332 -218 223 O ATOM 3564 CB ASN A 451 40.985 305.738 181.608 1.00 29.15 C ANISOU 3564 CB ASN A 451 3683 4204 3189 -356 -236 210 C ATOM 3565 CG ASN A 451 42.451 305.940 181.231 1.00 26.63 C ANISOU 3565 CG ASN A 451 3391 3855 2872 -349 -231 200 C ATOM 3566 OD1 ASN A 451 43.246 306.562 181.993 1.00 27.69 O ANISOU 3566 OD1 ASN A 451 3543 3950 3027 -325 -221 204 O ATOM 3567 ND2 ASN A 451 42.833 305.379 180.105 1.00 25.48 N ANISOU 3567 ND2 ASN A 451 3248 3726 2706 -372 -237 184 N ATOM 3568 N THR A 452 38.446 304.554 183.136 1.00 27.26 N ANISOU 3568 N THR A 452 3403 3997 2958 -383 -237 212 N ATOM 3569 CA THR A 452 37.202 304.760 183.870 1.00 31.96 C ANISOU 3569 CA THR A 452 3972 4612 3558 -376 -236 229 C ATOM 3570 C THR A 452 37.281 304.125 185.245 1.00 28.13 C ANISOU 3570 C THR A 452 3502 4093 3093 -380 -223 218 C ATOM 3571 O THR A 452 36.952 304.765 186.241 1.00 30.49 O ANISOU 3571 O THR A 452 3795 4383 3405 -355 -215 233 O ATOM 3572 CB THR A 452 36.034 304.170 183.057 1.00 32.22 C ANISOU 3572 CB THR A 452 3975 4698 3571 -405 -249 229 C ATOM 3573 OG1 THR A 452 36.045 304.749 181.735 1.00 31.39 O ANISOU 3573 OG1 THR A 452 3857 4626 3444 -402 -262 240 O ATOM 3574 CG2 THR A 452 34.695 304.441 183.727 1.00 27.76 C ANISOU 3574 CG2 THR A 452 3378 4159 3010 -398 -249 248 C ATOM 3575 N ILE A 453 37.722 302.865 185.323 1.00 25.43 N ANISOU 3575 N ILE A 453 3178 3730 2754 -411 -222 191 N ATOM 3576 CA ILE A 453 37.836 302.228 186.639 1.00 23.92 C ANISOU 3576 CA ILE A 453 3001 3506 2581 -414 -210 184 C ATOM 3577 C ILE A 453 38.820 302.978 187.524 1.00 33.78 C ANISOU 3577 C ILE A 453 4274 4715 3846 -381 -198 188 C ATOM 3578 O ILE A 453 38.552 303.220 188.723 1.00 31.76 O ANISOU 3578 O ILE A 453 4017 4448 3602 -366 -188 197 O ATOM 3579 CB ILE A 453 38.219 300.751 186.476 1.00 28.97 C ANISOU 3579 CB ILE A 453 3658 4127 3223 -452 -210 156 C ATOM 3580 CG1 ILE A 453 37.037 300.045 185.766 1.00 33.94 C ANISOU 3580 CG1 ILE A 453 4260 4799 3838 -486 -221 152 C ATOM 3581 CG2 ILE A 453 38.588 300.132 187.848 1.00 30.22 C ANISOU 3581 CG2 ILE A 453 3835 4244 3401 -453 -197 151 C ATOM 3582 CD1 ILE A 453 37.404 298.665 185.178 1.00 41.36 C ANISOU 3582 CD1 ILE A 453 5213 5726 4777 -526 -225 120 C ATOM 3583 N SER A 454 39.986 303.343 186.972 1.00 29.15 N ANISOU 3583 N SER A 454 3708 4108 3259 -371 -199 181 N ATOM 3584 CA SER A 454 41.016 304.040 187.743 1.00 25.90 C ANISOU 3584 CA SER A 454 3319 3658 2863 -342 -189 183 C ATOM 3585 C SER A 454 40.484 305.354 188.341 1.00 31.41 C ANISOU 3585 C SER A 454 4002 4364 3567 -307 -184 206 C ATOM 3586 O SER A 454 40.702 305.652 189.526 1.00 27.35 O ANISOU 3586 O SER A 454 3497 3827 3068 -289 -174 208 O ATOM 3587 CB SER A 454 42.248 304.311 186.852 1.00 23.67 C ANISOU 3587 CB SER A 454 3057 3360 2578 -337 -191 174 C ATOM 3588 OG SER A 454 43.140 305.125 187.644 1.00 26.25 O ANISOU 3588 OG SER A 454 3401 3652 2920 -308 -182 177 O ATOM 3589 N SER A 455 39.735 306.134 187.555 1.00 29.87 N ANISOU 3589 N SER A 455 3782 4205 3362 -297 -192 225 N ATOM 3590 CA SER A 455 39.160 307.399 188.051 1.00 27.33 C ANISOU 3590 CA SER A 455 3444 3891 3048 -263 -187 248 C ATOM 3591 C SER A 455 38.083 307.157 189.115 1.00 34.07 C ANISOU 3591 C SER A 455 4280 4759 3907 -263 -181 253 C ATOM 3592 O SER A 455 37.962 307.916 190.091 1.00 26.89 O ANISOU 3592 O SER A 455 3369 3838 3011 -236 -171 261 O ATOM 3593 CB SER A 455 38.627 308.212 186.823 1.00 22.63 C ANISOU 3593 CB SER A 455 2825 3332 2440 -254 -198 269 C ATOM 3594 OG SER A 455 39.750 308.714 186.050 1.00 27.95 O ANISOU 3594 OG SER A 455 3518 3989 3114 -246 -201 269 O ATOM 3595 N MET A 456 37.314 306.094 188.982 1.00 25.72 N ANISOU 3595 N MET A 456 3209 3724 2839 -294 -186 247 N ATOM 3596 CA MET A 456 36.333 305.789 190.040 1.00 29.66 C ANISOU 3596 CA MET A 456 3691 4234 3343 -297 -178 253 C ATOM 3597 C MET A 456 37.054 305.437 191.340 1.00 40.27 C ANISOU 3597 C MET A 456 5061 5539 4700 -293 -165 241 C ATOM 3598 O MET A 456 36.664 305.883 192.426 1.00 26.76 O ANISOU 3598 O MET A 456 3343 3827 2997 -273 -155 248 O ATOM 3599 CB MET A 456 35.390 304.649 189.589 1.00 26.22 C ANISOU 3599 CB MET A 456 3237 3831 2896 -335 -187 248 C ATOM 3600 CG MET A 456 34.500 305.098 188.379 1.00 24.84 C ANISOU 3600 CG MET A 456 3030 3704 2704 -337 -201 263 C ATOM 3601 SD MET A 456 33.650 303.623 187.839 1.00 35.21 S ANISOU 3601 SD MET A 456 4326 5048 4005 -388 -210 250 S ATOM 3602 CE MET A 456 32.480 304.362 186.673 1.00 34.23 C ANISOU 3602 CE MET A 456 4159 4986 3861 -383 -226 272 C ATOM 3603 N GLY A 457 38.126 304.670 191.239 1.00 29.43 N ANISOU 3603 N GLY A 457 3716 4135 3330 -309 -165 222 N ATOM 3604 CA GLY A 457 38.953 304.363 192.419 1.00 26.01 C ANISOU 3604 CA GLY A 457 3310 3665 2910 -303 -154 212 C ATOM 3605 C GLY A 457 39.486 305.604 193.113 1.00 27.36 C ANISOU 3605 C GLY A 457 3489 3817 3090 -265 -146 218 C ATOM 3606 O GLY A 457 39.522 305.664 194.364 1.00 29.54 O ANISOU 3606 O GLY A 457 3770 4081 3374 -253 -135 217 O ATOM 3607 N SER A 458 39.776 306.658 192.357 1.00 28.02 N ANISOU 3607 N SER A 458 3571 3903 3175 -244 -150 224 N ATOM 3608 CA SER A 458 40.325 307.851 193.009 1.00 28.43 C ANISOU 3608 CA SER A 458 3631 3933 3238 -209 -142 228 C ATOM 3609 C SER A 458 39.277 308.573 193.865 1.00 29.05 C ANISOU 3609 C SER A 458 3686 4029 3321 -187 -134 240 C ATOM 3610 O SER A 458 39.653 309.264 194.808 1.00 27.36 O ANISOU 3610 O SER A 458 3481 3796 3117 -162 -124 237 O ATOM 3611 CB SER A 458 40.925 308.811 191.947 1.00 32.18 C ANISOU 3611 CB SER A 458 4109 4402 3715 -193 -148 234 C ATOM 3612 OG SER A 458 39.853 309.469 191.212 1.00 27.22 O ANISOU 3612 OG SER A 458 3451 3809 3081 -185 -154 254 O ATOM 3613 N PHE A 459 37.983 308.485 193.508 1.00 26.53 N ANISOU 3613 N PHE A 459 3337 3750 2994 -194 -138 254 N ATOM 3614 CA PHE A 459 36.905 308.989 194.366 1.00 31.16 C ANISOU 3614 CA PHE A 459 3899 4357 3583 -176 -129 265 C ATOM 3615 C PHE A 459 36.775 308.174 195.655 1.00 28.91 C ANISOU 3615 C PHE A 459 3620 4067 3297 -187 -119 256 C ATOM 3616 O PHE A 459 36.465 308.734 196.705 1.00 29.81 O ANISOU 3616 O PHE A 459 3728 4182 3417 -165 -107 258 O ATOM 3617 CB PHE A 459 35.537 309.023 193.621 1.00 25.52 C ANISOU 3617 CB PHE A 459 3149 3689 2859 -182 -137 283 C ATOM 3618 CG PHE A 459 35.282 310.315 192.915 1.00 31.81 C ANISOU 3618 CG PHE A 459 3929 4497 3661 -153 -141 300 C ATOM 3619 CD1 PHE A 459 36.311 310.934 192.174 1.00 33.33 C ANISOU 3619 CD1 PHE A 459 4140 4664 3857 -142 -146 300 C ATOM 3620 CD2 PHE A 459 34.017 310.925 192.961 1.00 32.98 C ANISOU 3620 CD2 PHE A 459 4042 4679 3809 -136 -140 318 C ATOM 3621 CE1 PHE A 459 36.105 312.137 191.477 1.00 35.28 C ANISOU 3621 CE1 PHE A 459 4374 4921 4111 -115 -150 319 C ATOM 3622 CE2 PHE A 459 33.779 312.151 192.216 1.00 31.09 C ANISOU 3622 CE2 PHE A 459 3787 4449 3576 -107 -145 338 C ATOM 3623 CZ PHE A 459 34.842 312.751 191.489 1.00 33.97 C ANISOU 3623 CZ PHE A 459 4173 4787 3946 -97 -150 339 C ATOM 3624 N ILE A 460 37.016 306.860 195.619 1.00 27.79 N ANISOU 3624 N ILE A 460 3490 3919 3149 -221 -122 247 N ATOM 3625 CA ILE A 460 36.962 306.089 196.864 1.00 26.86 C ANISOU 3625 CA ILE A 460 3380 3795 3032 -231 -112 242 C ATOM 3626 C ILE A 460 38.050 306.571 197.829 1.00 31.92 C ANISOU 3626 C ILE A 460 4046 4402 3681 -209 -103 232 C ATOM 3627 O ILE A 460 37.813 306.772 199.034 1.00 28.20 O ANISOU 3627 O ILE A 460 3572 3933 3211 -195 -91 232 O ATOM 3628 CB ILE A 460 37.087 304.570 196.557 1.00 27.94 C ANISOU 3628 CB ILE A 460 3525 3925 3164 -272 -117 235 C ATOM 3629 CG1 ILE A 460 35.874 304.074 195.722 1.00 27.35 C ANISOU 3629 CG1 ILE A 460 3421 3889 3080 -297 -126 243 C ATOM 3630 CG2 ILE A 460 37.223 303.758 197.934 1.00 28.48 C ANISOU 3630 CG2 ILE A 460 3605 3980 3234 -281 -106 232 C ATOM 3631 CD1 ILE A 460 36.014 302.555 195.364 1.00 31.01 C ANISOU 3631 CD1 ILE A 460 3895 4344 3543 -340 -131 233 C ATOM 3632 N SER A 461 39.253 306.831 197.318 1.00 25.41 N ANISOU 3632 N SER A 461 3246 3547 2862 -203 -108 222 N ATOM 3633 CA SER A 461 40.332 307.338 198.195 1.00 27.69 C ANISOU 3633 CA SER A 461 3557 3805 3159 -182 -100 211 C ATOM 3634 C SER A 461 39.999 308.736 198.702 1.00 32.47 C ANISOU 3634 C SER A 461 4151 4416 3771 -146 -92 215 C ATOM 3635 O SER A 461 40.345 309.053 199.841 1.00 29.39 O ANISOU 3635 O SER A 461 3769 4014 3384 -130 -82 206 O ATOM 3636 CB SER A 461 41.693 307.340 197.440 1.00 27.69 C ANISOU 3636 CB SER A 461 3583 3773 3164 -184 -107 200 C ATOM 3637 OG SER A 461 42.061 306.008 197.130 1.00 31.87 O ANISOU 3637 OG SER A 461 4125 4294 3690 -215 -113 193 O ATOM 3638 N LEU A 462 39.313 309.582 197.901 1.00 26.97 N ANISOU 3638 N LEU A 462 3433 3737 3077 -132 -96 226 N ATOM 3639 CA LEU A 462 38.826 310.867 198.441 1.00 32.87 C ANISOU 3639 CA LEU A 462 4165 4490 3832 -98 -87 231 C ATOM 3640 C LEU A 462 37.926 310.658 199.655 1.00 31.61 C ANISOU 3640 C LEU A 462 3990 4353 3668 -94 -75 232 C ATOM 3641 O LEU A 462 38.029 311.385 200.664 1.00 28.40 O ANISOU 3641 O LEU A 462 3585 3939 3267 -70 -63 223 O ATOM 3642 CB LEU A 462 38.058 311.654 197.375 1.00 27.34 C ANISOU 3642 CB LEU A 462 3442 3812 3136 -86 -93 248 C ATOM 3643 CG LEU A 462 37.286 312.883 197.875 1.00 30.24 C ANISOU 3643 CG LEU A 462 3786 4189 3513 -51 -84 255 C ATOM 3644 CD1 LEU A 462 38.205 313.973 198.440 1.00 31.91 C ANISOU 3644 CD1 LEU A 462 4017 4366 3742 -21 -75 243 C ATOM 3645 CD2 LEU A 462 36.346 313.415 196.776 1.00 35.88 C ANISOU 3645 CD2 LEU A 462 4473 4931 4229 -43 -92 277 C ATOM 3646 N THR A 463 37.030 309.675 199.577 1.00 25.04 N ANISOU 3646 N THR A 463 3141 3549 2824 -120 -77 240 N ATOM 3647 CA THR A 463 36.112 309.451 200.690 1.00 27.46 C ANISOU 3647 CA THR A 463 3430 3880 3124 -118 -65 244 C ATOM 3648 C THR A 463 36.897 309.077 201.933 1.00 32.83 C ANISOU 3648 C THR A 463 4133 4539 3801 -119 -56 230 C ATOM 3649 O THR A 463 36.604 309.562 203.042 1.00 30.39 O ANISOU 3649 O THR A 463 3818 4240 3491 -99 -43 226 O ATOM 3650 CB THR A 463 35.095 308.362 200.318 1.00 30.57 C ANISOU 3650 CB THR A 463 3803 4304 3506 -151 -70 256 C ATOM 3651 OG1 THR A 463 34.321 308.833 199.189 1.00 31.57 O ANISOU 3651 OG1 THR A 463 3906 4455 3634 -147 -79 269 O ATOM 3652 CG2 THR A 463 34.103 308.080 201.555 1.00 25.84 C ANISOU 3652 CG2 THR A 463 3183 3734 2899 -151 -55 261 C ATOM 3653 N ALA A 464 37.927 308.241 201.767 1.00 25.62 N ANISOU 3653 N ALA A 464 3247 3601 2887 -139 -62 223 N ATOM 3654 CA ALA A 464 38.829 307.935 202.876 1.00 29.09 C ANISOU 3654 CA ALA A 464 3709 4019 3324 -137 -55 211 C ATOM 3655 C ALA A 464 39.553 309.183 203.396 1.00 30.31 C ANISOU 3655 C ALA A 464 3875 4155 3487 -104 -49 198 C ATOM 3656 O ALA A 464 39.667 309.367 204.620 1.00 26.42 O ANISOU 3656 O ALA A 464 3386 3664 2990 -91 -39 190 O ATOM 3657 CB ALA A 464 39.806 306.839 202.441 1.00 26.52 C ANISOU 3657 CB ALA A 464 3409 3667 2999 -164 -65 207 C ATOM 3658 N VAL A 465 40.029 310.065 202.533 1.00 29.96 N ANISOU 3658 N VAL A 465 3835 4093 3454 -89 -56 194 N ATOM 3659 CA VAL A 465 40.688 311.276 203.027 1.00 26.01 C ANISOU 3659 CA VAL A 465 3344 3572 2965 -58 -50 180 C ATOM 3660 C VAL A 465 39.733 312.130 203.890 1.00 33.01 C ANISOU 3660 C VAL A 465 4209 4481 3852 -32 -36 179 C ATOM 3661 O VAL A 465 40.115 312.660 204.945 1.00 28.81 O ANISOU 3661 O VAL A 465 3684 3942 3321 -14 -26 164 O ATOM 3662 CB VAL A 465 41.286 312.078 201.860 1.00 34.02 C ANISOU 3662 CB VAL A 465 4366 4566 3994 -48 -58 181 C ATOM 3663 CG1 VAL A 465 41.699 313.442 202.360 1.00 34.04 C ANISOU 3663 CG1 VAL A 465 4372 4549 4011 -15 -50 168 C ATOM 3664 CG2 VAL A 465 42.500 311.283 201.317 1.00 31.24 C ANISOU 3664 CG2 VAL A 465 4040 4188 3641 -70 -68 175 C ATOM 3665 N MET A 466 38.506 312.333 203.426 1.00 30.08 N ANISOU 3665 N MET A 466 3810 4139 3481 -29 -35 195 N ATOM 3666 CA MET A 466 37.520 313.096 204.173 1.00 31.03 C ANISOU 3666 CA MET A 466 3906 4281 3602 -5 -22 194 C ATOM 3667 C MET A 466 37.255 312.443 205.528 1.00 29.67 C ANISOU 3667 C MET A 466 3732 4128 3413 -12 -11 188 C ATOM 3668 O MET A 466 37.242 313.115 206.548 1.00 28.43 O ANISOU 3668 O MET A 466 3574 3973 3256 11 2 175 O ATOM 3669 CB MET A 466 36.212 313.219 203.370 1.00 28.21 C ANISOU 3669 CB MET A 466 3517 3955 3246 -4 -25 215 C ATOM 3670 CG MET A 466 36.480 313.996 201.981 1.00 28.50 C ANISOU 3670 CG MET A 466 3554 3975 3298 6 -37 224 C ATOM 3671 SD MET A 466 34.868 314.414 201.184 1.00 32.13 S ANISOU 3671 SD MET A 466 3972 4477 3761 16 -39 248 S ATOM 3672 CE MET A 466 34.311 312.769 200.820 1.00 28.85 C ANISOU 3672 CE MET A 466 3547 4090 3324 -30 -49 259 C ATOM 3673 N LEU A 467 37.112 311.120 205.530 1.00 27.90 N ANISOU 3673 N LEU A 467 3511 3915 3176 -44 -15 198 N ATOM 3674 CA LEU A 467 36.873 310.426 206.775 1.00 28.26 C ANISOU 3674 CA LEU A 467 3555 3978 3205 -54 -4 197 C ATOM 3675 C LEU A 467 38.045 310.617 207.739 1.00 47.73 C ANISOU 3675 C LEU A 467 6047 6422 5668 -43 0 178 C ATOM 3676 O LEU A 467 37.848 310.787 208.933 1.00 30.27 O ANISOU 3676 O LEU A 467 3830 4225 3445 -32 13 171 O ATOM 3677 CB LEU A 467 36.622 308.945 206.481 1.00 27.78 C ANISOU 3677 CB LEU A 467 3494 3927 3135 -92 -11 213 C ATOM 3678 CG LEU A 467 36.203 308.151 207.740 1.00 37.58 C ANISOU 3678 CG LEU A 467 4729 5190 4359 -104 1 218 C ATOM 3679 CD1 LEU A 467 34.785 308.638 208.220 1.00 36.45 C ANISOU 3679 CD1 LEU A 467 4550 5089 4209 -91 14 225 C ATOM 3680 CD2 LEU A 467 36.168 306.637 207.483 1.00 31.27 C ANISOU 3680 CD2 LEU A 467 3936 4391 3554 -144 -6 232 C ATOM 3681 N MET A 468 39.272 310.614 207.227 1.00 28.65 N ANISOU 3681 N MET A 468 3656 3969 3260 -47 -10 170 N ATOM 3682 CA MET A 468 40.437 310.847 208.083 1.00 28.19 C ANISOU 3682 CA MET A 468 3621 3890 3200 -36 -7 151 C ATOM 3683 C MET A 468 40.358 312.178 208.810 1.00 24.70 C ANISOU 3683 C MET A 468 3173 3450 2763 -3 4 133 C ATOM 3684 O MET A 468 40.688 312.272 210.020 1.00 30.67 O ANISOU 3684 O MET A 468 3935 4212 3507 5 13 119 O ATOM 3685 CB MET A 468 41.704 310.822 207.212 1.00 32.62 C ANISOU 3685 CB MET A 468 4207 4413 3773 -43 -21 145 C ATOM 3686 CG MET A 468 42.960 311.037 208.053 1.00 32.64 C ANISOU 3686 CG MET A 468 4234 4395 3775 -34 -20 126 C ATOM 3687 SD MET A 468 44.476 311.404 207.098 1.00 40.52 S ANISOU 3687 SD MET A 468 5257 5348 4790 -33 -32 115 S ATOM 3688 CE MET A 468 43.993 313.019 206.426 1.00 50.81 C ANISOU 3688 CE MET A 468 6546 6646 6114 -4 -29 111 C ATOM 3689 N VAL A 469 39.875 313.221 208.125 1.00 27.95 N ANISOU 3689 N VAL A 469 3571 3859 3191 17 5 133 N ATOM 3690 CA VAL A 469 39.764 314.495 208.805 1.00 27.90 C ANISOU 3690 CA VAL A 469 3558 3852 3193 50 17 114 C ATOM 3691 C VAL A 469 38.732 314.388 209.938 1.00 30.82 C ANISOU 3691 C VAL A 469 3905 4260 3545 56 32 113 C ATOM 3692 O VAL A 469 38.937 314.907 211.017 1.00 31.05 O ANISOU 3692 O VAL A 469 3936 4293 3568 73 44 93 O ATOM 3693 CB VAL A 469 39.382 315.589 207.803 1.00 25.40 C ANISOU 3693 CB VAL A 469 3228 3523 2899 70 15 119 C ATOM 3694 CG1 VAL A 469 39.023 316.891 208.512 1.00 25.00 C ANISOU 3694 CG1 VAL A 469 3166 3474 2860 105 29 100 C ATOM 3695 CG2 VAL A 469 40.619 315.829 206.824 1.00 24.31 C ANISOU 3695 CG2 VAL A 469 3114 3344 2777 66 1 116 C ATOM 3696 N PHE A 470 37.601 313.750 209.652 1.00 26.50 N ANISOU 3696 N PHE A 470 3336 3743 2990 43 33 135 N ATOM 3697 CA PHE A 470 36.587 313.576 210.700 1.00 29.98 C ANISOU 3697 CA PHE A 470 3755 4224 3414 47 49 136 C ATOM 3698 C PHE A 470 37.131 312.786 211.874 1.00 29.82 C ANISOU 3698 C PHE A 470 3749 4212 3371 33 54 130 C ATOM 3699 O PHE A 470 36.803 313.062 213.049 1.00 29.10 O ANISOU 3699 O PHE A 470 3648 4144 3265 46 69 118 O ATOM 3700 CB PHE A 470 35.377 312.862 210.093 1.00 26.21 C ANISOU 3700 CB PHE A 470 3252 3776 2932 28 47 162 C ATOM 3701 CG PHE A 470 34.544 312.195 211.119 1.00 27.89 C ANISOU 3701 CG PHE A 470 3447 4029 3123 18 60 170 C ATOM 3702 CD1 PHE A 470 33.680 312.958 211.871 1.00 26.73 C ANISOU 3702 CD1 PHE A 470 3274 3909 2971 43 77 161 C ATOM 3703 CD2 PHE A 470 34.694 310.823 211.375 1.00 30.13 C ANISOU 3703 CD2 PHE A 470 3739 4319 3390 -16 56 184 C ATOM 3704 CE1 PHE A 470 32.891 312.345 212.875 1.00 31.96 C ANISOU 3704 CE1 PHE A 470 3920 4613 3612 34 90 169 C ATOM 3705 CE2 PHE A 470 33.964 310.201 212.353 1.00 33.34 C ANISOU 3705 CE2 PHE A 470 4130 4762 3777 -26 69 193 C ATOM 3706 CZ PHE A 470 33.040 310.967 213.124 1.00 30.08 C ANISOU 3706 CZ PHE A 470 3690 4382 3356 -1 86 186 C ATOM 3707 N ILE A 471 37.936 311.762 211.597 1.00 24.16 N ANISOU 3707 N ILE A 471 3053 3477 2649 6 42 139 N ATOM 3708 CA ILE A 471 38.481 310.923 212.665 1.00 28.15 C ANISOU 3708 CA ILE A 471 3573 3989 3133 -8 45 138 C ATOM 3709 C ILE A 471 39.389 311.720 213.602 1.00 31.31 C ANISOU 3709 C ILE A 471 3988 4379 3530 14 50 110 C ATOM 3710 O ILE A 471 39.362 311.552 214.838 1.00 32.95 O ANISOU 3710 O ILE A 471 4194 4610 3715 17 61 104 O ATOM 3711 CB ILE A 471 39.209 309.727 212.044 1.00 31.56 C ANISOU 3711 CB ILE A 471 4025 4399 3567 -39 30 153 C ATOM 3712 CG1 ILE A 471 38.150 308.820 211.433 1.00 28.73 C ANISOU 3712 CG1 ILE A 471 3648 4060 3207 -63 28 178 C ATOM 3713 CG2 ILE A 471 40.088 309.025 213.145 1.00 34.96 C ANISOU 3713 CG2 ILE A 471 4476 4829 3980 -47 31 150 C ATOM 3714 CD1 ILE A 471 38.709 307.545 210.649 1.00 27.47 C ANISOU 3714 CD1 ILE A 471 3507 3879 3053 -97 13 192 C ATOM 3715 N ILE A 472 40.271 312.529 213.023 1.00 27.26 N ANISOU 3715 N ILE A 472 3491 3831 3037 28 42 94 N ATOM 3716 CA ILE A 472 41.079 313.411 213.828 1.00 27.65 C ANISOU 3716 CA ILE A 472 3553 3869 3085 49 47 65 C ATOM 3717 C ILE A 472 40.208 314.356 214.622 1.00 29.33 C ANISOU 3717 C ILE A 472 3743 4107 3293 75 65 49 C ATOM 3718 O ILE A 472 40.444 314.565 215.818 1.00 30.77 O ANISOU 3718 O ILE A 472 3927 4305 3458 84 74 30 O ATOM 3719 CB ILE A 472 42.076 314.181 212.970 1.00 29.49 C ANISOU 3719 CB ILE A 472 3803 4059 3343 58 36 52 C ATOM 3720 CG1 ILE A 472 43.021 313.156 212.295 1.00 29.50 C ANISOU 3720 CG1 ILE A 472 3826 4036 3345 32 20 65 C ATOM 3721 CG2 ILE A 472 42.832 315.174 213.908 1.00 24.42 C ANISOU 3721 CG2 ILE A 472 3170 3407 2701 80 43 18 C ATOM 3722 CD1 ILE A 472 43.855 313.772 211.101 1.00 24.07 C ANISOU 3722 CD1 ILE A 472 3152 3308 2683 36 9 60 C ATOM 3723 N TRP A 473 39.206 314.968 213.979 1.00 24.96 N ANISOU 3723 N TRP A 473 3168 3559 2755 88 69 55 N ATOM 3724 CA TRP A 473 38.309 315.830 214.732 1.00 28.70 C ANISOU 3724 CA TRP A 473 3618 4059 3226 115 87 40 C ATOM 3725 C TRP A 473 37.662 315.082 215.900 1.00 30.73 C ANISOU 3725 C TRP A 473 3862 4362 3451 105 100 46 C ATOM 3726 O TRP A 473 37.602 315.595 217.022 1.00 29.56 O ANISOU 3726 O TRP A 473 3709 4233 3290 122 114 23 O ATOM 3727 CB TRP A 473 37.202 316.379 213.829 1.00 31.03 C ANISOU 3727 CB TRP A 473 3889 4360 3542 127 90 53 C ATOM 3728 CG TRP A 473 36.146 317.113 214.653 1.00 30.11 C ANISOU 3728 CG TRP A 473 3745 4274 3420 153 110 40 C ATOM 3729 CD1 TRP A 473 36.255 318.384 215.183 1.00 30.80 C ANISOU 3729 CD1 TRP A 473 3830 4351 3520 186 122 9 C ATOM 3730 CD2 TRP A 473 34.856 316.606 215.060 1.00 26.45 C ANISOU 3730 CD2 TRP A 473 3253 3857 2940 149 121 56 C ATOM 3731 NE1 TRP A 473 35.100 318.677 215.914 1.00 32.07 N ANISOU 3731 NE1 TRP A 473 3963 4552 3672 203 140 4 N ATOM 3732 CE2 TRP A 473 34.228 317.614 215.837 1.00 29.63 C ANISOU 3732 CE2 TRP A 473 3636 4278 3344 181 140 34 C ATOM 3733 CE3 TRP A 473 34.170 315.388 214.839 1.00 28.77 C ANISOU 3733 CE3 TRP A 473 3534 4179 3218 120 118 87 C ATOM 3734 CZ2 TRP A 473 32.922 317.457 216.393 1.00 31.91 C ANISOU 3734 CZ2 TRP A 473 3892 4615 3618 186 157 42 C ATOM 3735 CZ3 TRP A 473 32.862 315.234 215.399 1.00 30.78 C ANISOU 3735 CZ3 TRP A 473 3757 4481 3459 123 133 96 C ATOM 3736 CH2 TRP A 473 32.260 316.268 216.133 1.00 33.54 C ANISOU 3736 CH2 TRP A 473 4086 4848 3808 156 152 74 C ATOM 3737 N GLU A 474 37.193 313.854 215.661 1.00 28.90 N ANISOU 3737 N GLU A 474 3625 4149 3208 77 95 76 N ATOM 3738 CA GLU A 474 36.457 313.151 216.706 1.00 28.38 C ANISOU 3738 CA GLU A 474 3543 4127 3112 67 108 86 C ATOM 3739 C GLU A 474 37.360 312.889 217.920 1.00 29.92 C ANISOU 3739 C GLU A 474 3757 4328 3284 65 111 71 C ATOM 3740 O GLU A 474 36.916 312.989 219.082 1.00 27.99 O ANISOU 3740 O GLU A 474 3499 4120 3015 74 127 62 O ATOM 3741 CB GLU A 474 35.903 311.835 216.151 1.00 30.07 C ANISOU 3741 CB GLU A 474 3751 4353 3322 34 101 121 C ATOM 3742 CG GLU A 474 34.865 311.134 217.127 1.00 31.63 C ANISOU 3742 CG GLU A 474 3924 4601 3492 23 117 137 C ATOM 3743 CD GLU A 474 35.561 310.309 218.211 1.00 41.71 C ANISOU 3743 CD GLU A 474 5218 5887 4742 8 119 140 C ATOM 3744 OE1 GLU A 474 35.021 310.140 219.300 1.00 36.45 O ANISOU 3744 OE1 GLU A 474 4538 5261 4052 9 134 142 O ATOM 3745 OE2 GLU A 474 36.692 309.830 218.013 1.00 30.55 O ANISOU 3745 OE2 GLU A 474 3832 4443 3332 -5 105 141 O ATOM 3746 N ALA A 475 38.653 312.625 217.661 1.00 29.89 N ANISOU 3746 N ALA A 475 3782 4290 3286 55 96 67 N ATOM 3747 CA ALA A 475 39.577 312.367 218.761 1.00 27.54 C ANISOU 3747 CA ALA A 475 3501 3997 2964 53 97 55 C ATOM 3748 C ALA A 475 39.733 313.601 219.647 1.00 30.25 C ANISOU 3748 C ALA A 475 3841 4350 3303 83 109 17 C ATOM 3749 O ALA A 475 39.689 313.527 220.892 1.00 30.01 O ANISOU 3749 O ALA A 475 3806 4352 3243 87 120 7 O ATOM 3750 CB ALA A 475 40.921 311.942 218.207 1.00 26.19 C ANISOU 3750 CB ALA A 475 3360 3786 2804 40 78 56 C ATOM 3751 N PHE A 476 39.979 314.742 218.997 1.00 27.89 N ANISOU 3751 N PHE A 476 3545 4019 3032 104 107 -5 N ATOM 3752 CA PHE A 476 40.121 315.970 219.761 1.00 30.82 C ANISOU 3752 CA PHE A 476 3914 4393 3404 132 119 -44 C ATOM 3753 C PHE A 476 38.777 316.411 220.349 1.00 32.03 C ANISOU 3753 C PHE A 476 4036 4586 3547 150 139 -49 C ATOM 3754 O PHE A 476 38.758 317.119 221.362 1.00 31.24 O ANISOU 3754 O PHE A 476 3931 4505 3435 169 153 -80 O ATOM 3755 CB PHE A 476 40.713 317.077 218.881 1.00 27.59 C ANISOU 3755 CB PHE A 476 3515 3937 3031 149 111 -63 C ATOM 3756 CG PHE A 476 42.228 316.989 218.681 1.00 29.23 C ANISOU 3756 CG PHE A 476 3753 4109 3246 139 95 -73 C ATOM 3757 CD1 PHE A 476 43.084 317.141 219.723 1.00 30.40 C ANISOU 3757 CD1 PHE A 476 3912 4262 3375 142 96 -99 C ATOM 3758 CD2 PHE A 476 42.771 316.830 217.388 1.00 26.09 C ANISOU 3758 CD2 PHE A 476 3369 3672 2873 128 79 -57 C ATOM 3759 CE1 PHE A 476 44.446 317.104 219.558 1.00 32.46 C ANISOU 3759 CE1 PHE A 476 4198 4493 3642 134 82 -108 C ATOM 3760 CE2 PHE A 476 44.079 316.813 217.216 1.00 32.84 C ANISOU 3760 CE2 PHE A 476 4247 4496 3734 121 66 -66 C ATOM 3761 CZ PHE A 476 44.952 316.954 218.307 1.00 33.73 C ANISOU 3761 CZ PHE A 476 4371 4615 3828 124 67 -92 C ATOM 3762 N ALA A 477 37.659 316.063 219.695 1.00 28.11 N ANISOU 3762 N ALA A 477 3519 4104 3058 144 142 -22 N ATOM 3763 CA ALA A 477 36.338 316.417 220.217 1.00 30.93 C ANISOU 3763 CA ALA A 477 3845 4501 3406 160 162 -24 C ATOM 3764 C ALA A 477 35.990 315.631 221.479 1.00 27.22 C ANISOU 3764 C ALA A 477 3365 4081 2895 148 174 -18 C ATOM 3765 O ALA A 477 35.321 316.158 222.355 1.00 29.67 O ANISOU 3765 O ALA A 477 3657 4426 3192 167 193 -36 O ATOM 3766 CB ALA A 477 35.237 316.177 219.159 1.00 27.24 C ANISOU 3766 CB ALA A 477 3356 4038 2957 155 160 6 C ATOM 3767 N SER A 478 36.382 314.378 221.580 1.00 26.76 N ANISOU 3767 N SER A 478 3320 4029 2819 118 164 9 N ATOM 3768 CA SER A 478 35.950 313.509 222.659 1.00 28.52 C ANISOU 3768 CA SER A 478 3531 4299 3004 104 176 24 C ATOM 3769 C SER A 478 36.893 313.513 223.868 1.00 31.29 C ANISOU 3769 C SER A 478 3899 4663 3327 106 178 3 C ATOM 3770 O SER A 478 36.422 313.327 224.989 1.00 29.71 O ANISOU 3770 O SER A 478 3685 4511 3094 108 193 2 O ATOM 3771 CB SER A 478 35.781 312.084 222.140 1.00 30.51 C ANISOU 3771 CB SER A 478 3787 4552 3254 68 165 68 C ATOM 3772 OG SER A 478 34.662 312.125 221.266 1.00 29.17 O ANISOU 3772 OG SER A 478 3594 4386 3102 67 167 84 O ATOM 3773 N LYS A 479 38.190 313.707 223.643 1.00 32.13 N ATOM 3774 CA LYS A 479 39.230 313.863 224.667 1.00 33.64 C ATOM 3775 C LYS A 479 39.287 312.644 225.566 1.00 37.22 C ATOM 3776 O LYS A 479 39.043 312.733 226.779 1.00 32.30 O ATOM 3777 CB LYS A 479 39.009 315.134 225.522 1.00 30.65 C ATOM 3778 CG LYS A 479 39.132 316.450 224.774 1.00 29.45 C ATOM 3779 CD LYS A 479 38.895 317.675 225.652 1.00 31.11 C ATOM 3780 CE LYS A 479 39.590 318.878 225.009 1.00 39.58 C ATOM 3781 NZ LYS A 479 39.529 320.166 225.832 1.00 37.67 N