>>3AG2:HELIX   95 AK5 TYR N  447  LYS N  479  1                                  33    
YTMWNTISSMGSFISLTAVMLMVFIIWEAFASK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 95 AK5 TYR N 447 LYS N 479 1 33 ATOM 17846 N TYR N 447 143.916 324.815 169.724 1.00 41.44 N ANISOU17846 N TYR N 447 4002 6124 5617 -555 512 -610 N ATOM 17847 CA TYR N 447 143.656 324.714 171.166 1.00 45.43 C ANISOU17847 CA TYR N 447 4535 6565 6161 -548 472 -612 C ATOM 17848 C TYR N 447 144.845 324.195 171.955 1.00 53.25 C ANISOU17848 C TYR N 447 5493 7537 7204 -534 455 -637 C ATOM 17849 O TYR N 447 144.705 323.902 173.142 1.00 41.21 O ANISOU17849 O TYR N 447 3988 5961 5711 -524 421 -649 O ATOM 17850 CB TYR N 447 142.465 323.798 171.437 1.00 38.62 C ANISOU17850 CB TYR N 447 3713 5680 5280 -529 458 -653 C ATOM 17851 CG TYR N 447 141.219 324.218 170.756 1.00 37.19 C ANISOU17851 CG TYR N 447 3566 5515 5050 -541 470 -631 C ATOM 17852 CD1 TYR N 447 140.597 325.404 171.087 1.00 33.99 C ANISOU17852 CD1 TYR N 447 3190 5086 4639 -563 460 -573 C ATOM 17853 CD2 TYR N 447 140.625 323.407 169.799 1.00 35.29 C ANISOU17853 CD2 TYR N 447 3331 5312 4768 -529 490 -670 C ATOM 17854 CE1 TYR N 447 139.350 325.775 170.479 1.00 33.67 C ANISOU17854 CE1 TYR N 447 3183 5058 4553 -572 469 -552 C ATOM 17855 CE2 TYR N 447 139.384 323.792 169.147 1.00 35.15 C ANISOU17855 CE2 TYR N 447 3346 5309 4700 -540 499 -649 C ATOM 17856 CZ TYR N 447 138.766 324.983 169.511 1.00 40.83 C ANISOU17856 CZ TYR N 447 4093 6003 5416 -561 488 -588 C ATOM 17857 OH TYR N 447 137.564 325.389 168.888 1.00 38.58 O ANISOU17857 OH TYR N 447 3839 5732 5086 -571 496 -565 O ATOM 17858 N THR N 448 146.007 324.061 171.327 1.00 39.81 N ANISOU17858 N THR N 448 3740 5875 5511 -533 478 -646 N ATOM 17859 CA THR N 448 147.143 323.407 171.974 1.00 36.67 C ANISOU17859 CA THR N 448 3308 5464 5162 -516 464 -677 C ATOM 17860 C THR N 448 147.616 324.160 173.227 1.00 36.95 C ANISOU17860 C THR N 448 3345 5451 5242 -530 429 -638 C ATOM 17861 O THR N 448 147.922 323.545 174.244 1.00 41.69 O ANISOU17861 O THR N 448 3947 6014 5880 -513 400 -665 O ATOM 17862 CB THR N 448 148.287 323.260 170.946 1.00 37.07 C ANISOU17862 CB THR N 448 3303 5573 5211 -514 499 -687 C ATOM 17863 OG1 THR N 448 147.918 322.256 169.989 1.00 42.88 O ANISOU17863 OG1 THR N 448 4037 6345 5911 -494 525 -739 O ATOM 17864 CG2 THR N 448 149.618 322.878 171.645 1.00 35.98 C ANISOU17864 CG2 THR N 448 3121 5420 5127 -502 485 -703 C ATOM 17865 N MET N 449 147.737 325.482 173.178 1.00 44.30 N ANISOU17865 N MET N 449 4276 6385 6172 -561 430 -577 N ATOM 17866 CA MET N 449 148.395 326.136 174.308 1.00 42.68 C ANISOU17866 CA MET N 449 4065 6140 6012 -575 397 -546 C ATOM 17867 C MET N 449 147.626 325.943 175.623 1.00 40.68 C ANISOU17867 C MET N 449 3859 5825 5773 -567 355 -554 C ATOM 17868 O MET N 449 148.211 325.612 176.655 1.00 40.98 O ANISOU17868 O MET N 449 3891 5830 5851 -557 325 -568 O ATOM 17869 CB MET N 449 148.580 327.613 174.055 1.00 46.34 C ANISOU17869 CB MET N 449 4522 6611 6475 -611 403 -479 C ATOM 17870 CG MET N 449 149.138 328.293 175.276 1.00 62.36 C ANISOU17870 CG MET N 449 6550 8596 8547 -627 365 -449 C ATOM 17871 SD MET N 449 149.589 329.956 174.862 1.00 63.22 S ANISOU17871 SD MET N 449 6640 8717 8664 -670 375 -374 S ATOM 17872 CE MET N 449 151.133 329.638 174.032 1.00150.10 C ANISOU17872 CE MET N 449 17569 19776 19684 -667 406 -383 C ATOM 17873 N TRP N 450 146.321 326.212 175.629 1.00 43.11 N ANISOU17873 N TRP N 450 4215 6115 6050 -571 352 -543 N ATOM 17874 CA TRP N 450 145.611 326.093 176.899 1.00 38.96 C ANISOU17874 CA TRP N 450 3734 5531 5537 -564 313 -547 C ATOM 17875 C TRP N 450 145.515 324.641 177.353 1.00 40.81 C ANISOU17875 C TRP N 450 3973 5748 5784 -529 301 -608 C ATOM 17876 O TRP N 450 145.582 324.368 178.551 1.00 39.45 O ANISOU17876 O TRP N 450 3817 5531 5643 -520 266 -616 O ATOM 17877 CB TRP N 450 144.222 326.715 176.796 1.00 35.03 C ANISOU17877 CB TRP N 450 3286 5020 5005 -576 314 -519 C ATOM 17878 CG TRP N 450 144.225 328.134 176.295 1.00 39.32 C ANISOU17878 CG TRP N 450 3825 5577 5537 -609 326 -459 C ATOM 17879 CD1 TRP N 450 143.457 328.655 175.256 1.00 39.37 C ANISOU17879 CD1 TRP N 450 3844 5613 5503 -621 354 -434 C ATOM 17880 CD2 TRP N 450 144.995 329.215 176.801 1.00 45.47 C ANISOU17880 CD2 TRP N 450 4590 6341 6347 -634 310 -414 C ATOM 17881 NE1 TRP N 450 143.701 329.998 175.122 1.00 39.77 N ANISOU17881 NE1 TRP N 450 3887 5662 5561 -650 356 -376 N ATOM 17882 CE2 TRP N 450 144.656 330.363 176.041 1.00 38.00 C ANISOU17882 CE2 TRP N 450 3645 5411 5381 -660 330 -364 C ATOM 17883 CE3 TRP N 450 145.918 329.341 177.844 1.00 53.16 C ANISOU17883 CE3 TRP N 450 5549 7286 7364 -639 279 -412 C ATOM 17884 CZ2 TRP N 450 145.238 331.606 176.277 1.00 52.28 C ANISOU17884 CZ2 TRP N 450 5441 7208 7215 -690 320 -312 C ATOM 17885 CZ3 TRP N 450 146.494 330.568 178.071 1.00 58.54 C ANISOU17885 CZ3 TRP N 450 6217 7959 8066 -669 269 -362 C ATOM 17886 CH2 TRP N 450 146.150 331.689 177.296 1.00 46.49 C ANISOU17886 CH2 TRP N 450 4693 6448 6523 -695 289 -313 C ATOM 17887 N ASN N 451 145.397 323.686 176.425 1.00 39.47 N ANISOU17887 N ASN N 451 3788 5613 5594 -510 329 -651 N ATOM 17888 CA ASN N 451 145.450 322.297 176.871 1.00 32.68 C ANISOU17888 CA ASN N 451 2927 4734 4755 -476 315 -709 C ATOM 17889 C ASN N 451 146.774 321.968 177.537 1.00 38.73 C ANISOU17889 C ASN N 451 3655 5489 5572 -466 297 -722 C ATOM 17890 O ASN N 451 146.804 321.222 178.517 1.00 40.81 O ANISOU17890 O ASN N 451 3928 5711 5866 -446 267 -749 O ATOM 17891 CB ASN N 451 145.192 321.349 175.709 1.00 42.48 C ANISOU17891 CB ASN N 451 4156 6017 5967 -459 348 -756 C ATOM 17892 CG ASN N 451 143.717 321.158 175.489 1.00 38.96 C ANISOU17892 CG ASN N 451 3757 5564 5482 -457 350 -763 C ATOM 17893 OD1 ASN N 451 143.062 320.496 176.280 1.00 38.54 O ANISOU17893 OD1 ASN N 451 3733 5469 5441 -440 326 -786 O ATOM 17894 ND2 ASN N 451 143.175 321.807 174.452 1.00 35.22 N ANISOU17894 ND2 ASN N 451 3291 5130 4963 -475 378 -738 N ATOM 17895 N THR N 452 147.890 322.461 176.977 1.00 39.86 N ANISOU17895 N THR N 452 3752 5669 5724 -480 316 -704 N ATOM 17896 CA THR N 452 149.209 322.199 177.557 1.00 35.54 C ANISOU17896 CA THR N 452 3164 5115 5226 -472 300 -713 C ATOM 17897 C THR N 452 149.315 322.753 178.961 1.00 41.60 C ANISOU17897 C THR N 452 3952 5830 6023 -482 256 -684 C ATOM 17898 O THR N 452 149.774 322.073 179.887 1.00 37.20 O ANISOU17898 O THR N 452 3389 5241 5503 -463 226 -708 O ATOM 17899 CB THR N 452 150.302 322.826 176.653 1.00 34.69 C ANISOU17899 CB THR N 452 3004 5059 5118 -489 330 -689 C ATOM 17900 OG1 THR N 452 150.202 322.246 175.365 1.00 41.82 O ANISOU17900 OG1 THR N 452 3888 6011 5989 -477 371 -719 O ATOM 17901 CG2 THR N 452 151.726 322.630 177.220 1.00 39.08 C ANISOU17901 CG2 THR N 452 3513 5612 5725 -483 314 -694 C ATOM 17902 N ILE N 453 148.946 324.015 179.128 1.00 37.77 N ANISOU17902 N ILE N 453 3490 5337 5524 -514 250 -631 N ATOM 17903 CA ILE N 453 148.998 324.638 180.448 1.00 36.15 C ANISOU17903 CA ILE N 453 3308 5083 5343 -527 207 -602 C ATOM 17904 C ILE N 453 148.111 323.877 181.442 1.00 44.87 C ANISOU17904 C ILE N 453 4459 6138 6450 -504 177 -629 C ATOM 17905 O ILE N 453 148.524 323.596 182.572 1.00 41.46 O ANISOU17905 O ILE N 453 4030 5670 6051 -495 141 -636 O ATOM 17906 CB ILE N 453 148.580 326.116 180.357 1.00 35.58 C ANISOU17906 CB ILE N 453 3258 5011 5252 -564 208 -544 C ATOM 17907 CG1 ILE N 453 149.625 326.896 179.551 1.00 47.43 C ANISOU17907 CG1 ILE N 453 4708 6553 6758 -588 232 -512 C ATOM 17908 CG2 ILE N 453 148.384 326.730 181.779 1.00 41.08 C ANISOU17908 CG2 ILE N 453 3991 5652 5966 -576 162 -519 C ATOM 17909 CD1 ILE N 453 149.145 328.281 179.209 1.00 39.03 C ANISOU17909 CD1 ILE N 453 3662 5492 5674 -622 240 -456 C ATOM 17910 N SER N 454 146.868 323.569 181.043 1.00 38.60 N ANISOU17910 N SER N 454 3701 5344 5622 -495 190 -641 N ATOM 17911 CA SER N 454 145.923 322.871 181.950 1.00 37.17 C ANISOU17911 CA SER N 454 3565 5116 5442 -475 163 -663 C ATOM 17912 C SER N 454 146.540 321.555 182.461 1.00 33.38 C ANISOU17912 C SER N 454 3064 4620 4999 -442 147 -711 C ATOM 17913 O SER N 454 146.506 321.263 183.662 1.00 37.23 O ANISOU17913 O SER N 454 3573 5063 5511 -431 109 -713 O ATOM 17914 CB SER N 454 144.563 322.607 181.216 1.00 33.83 C ANISOU17914 CB SER N 454 3174 4703 4975 -469 186 -674 C ATOM 17915 OG SER N 454 143.641 321.750 181.964 1.00 33.54 O ANISOU17915 OG SER N 454 3177 4627 4941 -446 164 -700 O ATOM 17916 N SER N 455 147.158 320.769 181.558 1.00 35.71 N ANISOU17916 N SER N 455 3317 4952 5301 -425 173 -748 N ATOM 17917 CA SER N 455 147.781 319.517 181.974 1.00 39.16 C ANISOU17917 CA SER N 455 3730 5372 5776 -393 158 -794 C ATOM 17918 C SER N 455 149.001 319.723 182.881 1.00 39.26 C ANISOU17918 C SER N 455 3715 5367 5833 -395 129 -780 C ATOM 17919 O SER N 455 149.241 318.906 183.777 1.00 39.31 O ANISOU17919 O SER N 455 3723 5338 5874 -371 98 -803 O ATOM 17920 CB SER N 455 148.174 318.698 180.757 1.00 41.92 C ANISOU17920 CB SER N 455 4040 5766 6121 -376 195 -837 C ATOM 17921 OG SER N 455 147.002 318.284 180.048 1.00 38.48 O ANISOU17921 OG SER N 455 3634 5342 5647 -369 216 -859 O ATOM 17922 N MET N 456 149.808 320.766 182.653 1.00 39.20 N ANISOU17922 N MET N 456 3681 5385 5827 -423 137 -743 N ATOM 17923 CA MET N 456 150.846 321.092 183.625 1.00 44.76 C ANISOU17923 CA MET N 456 4366 6071 6571 -430 104 -724 C ATOM 17924 C MET N 456 150.247 321.406 184.984 1.00 41.28 C ANISOU17924 C MET N 456 3975 5576 6134 -435 60 -703 C ATOM 17925 O MET N 456 150.780 320.972 186.010 1.00 38.92 O ANISOU17925 O MET N 456 3672 5246 5869 -422 25 -711 O ATOM 17926 CB MET N 456 151.692 322.268 183.137 1.00 34.26 C ANISOU17926 CB MET N 456 3003 4776 5240 -463 119 -683 C ATOM 17927 CG MET N 456 152.632 321.842 181.998 1.00 45.57 C ANISOU17927 CG MET N 456 4375 6260 6678 -454 156 -704 C ATOM 17928 SD MET N 456 153.286 323.283 181.108 1.00 45.86 S ANISOU17928 SD MET N 456 4379 6346 6701 -496 185 -651 S ATOM 17929 CE MET N 456 154.340 322.380 179.944 1.00 48.55 C ANISOU17929 CE MET N 456 4652 6741 7052 -473 225 -690 C ATOM 17930 N GLY N 457 149.165 322.195 185.006 1.00 41.75 N ANISOU17930 N GLY N 457 4081 5626 6158 -454 62 -675 N ATOM 17931 CA GLY N 457 148.456 322.427 186.270 1.00 38.14 C ANISOU17931 CA GLY N 457 3675 5118 5699 -456 24 -658 C ATOM 17932 C GLY N 457 148.079 321.140 186.978 1.00 54.45 C ANISOU17932 C GLY N 457 5758 7149 7781 -420 1 -695 C ATOM 17933 O GLY N 457 148.188 321.045 188.194 1.00 39.81 O ANISOU17933 O GLY N 457 3923 5257 5945 -415 -38 -688 O ATOM 17934 N SER N 458 147.632 320.125 186.226 1.00 38.87 N ANISOU17934 N SER N 458 3779 5189 5802 -396 25 -734 N ATOM 17935 CA SER N 458 147.186 318.880 186.855 1.00 32.15 C ANISOU17935 CA SER N 458 2945 4302 4967 -362 4 -768 C ATOM 17936 C SER N 458 148.315 318.187 187.609 1.00 44.57 C ANISOU17936 C SER N 458 4487 5857 6590 -343 -25 -785 C ATOM 17937 O SER N 458 148.067 317.550 188.641 1.00 34.50 O ANISOU17937 O SER N 458 3235 4540 5334 -324 -60 -792 O ATOM 17938 CB SER N 458 146.563 317.931 185.813 1.00 36.97 C ANISOU17938 CB SER N 458 3551 4932 5563 -342 36 -810 C ATOM 17939 OG SER N 458 147.536 317.197 185.070 1.00 36.37 O ANISOU17939 OG SER N 458 3422 4885 5511 -325 55 -847 O ATOM 17940 N PHE N 459 149.567 318.314 187.127 1.00 36.72 N ANISOU17940 N PHE N 459 3439 4894 5618 -348 -13 -789 N ATOM 17941 CA PHE N 459 150.697 317.770 187.881 1.00 40.48 C ANISOU17941 CA PHE N 459 3883 5355 6143 -332 -43 -800 C ATOM 17942 C PHE N 459 150.956 318.535 189.180 1.00 38.43 C ANISOU17942 C PHE N 459 3645 5065 5892 -350 -85 -762 C ATOM 17943 O PHE N 459 151.375 317.933 190.165 1.00 39.62 O ANISOU17943 O PHE N 459 3794 5185 6076 -332 -121 -770 O ATOM 17944 CB PHE N 459 151.976 317.766 187.000 1.00 43.11 C ANISOU17944 CB PHE N 459 4152 5733 6496 -333 -17 -812 C ATOM 17945 CG PHE N 459 152.183 316.489 186.255 1.00 36.17 C ANISOU17945 CG PHE N 459 3241 4867 5634 -299 4 -865 C ATOM 17946 CD1 PHE N 459 151.101 315.825 185.656 1.00 44.25 C ANISOU17946 CD1 PHE N 459 4290 5890 6634 -284 24 -895 C ATOM 17947 CD2 PHE N 459 153.439 315.918 186.152 1.00 51.04 C ANISOU17947 CD2 PHE N 459 5070 6764 7559 -283 3 -886 C ATOM 17948 CE1 PHE N 459 151.304 314.627 184.972 1.00 45.13 C ANISOU17948 CE1 PHE N 459 4372 6012 6762 -253 42 -947 C ATOM 17949 CE2 PHE N 459 153.626 314.757 185.465 1.00 71.40 C ANISOU17949 CE2 PHE N 459 7621 9354 10155 -251 22 -937 C ATOM 17950 CZ PHE N 459 152.558 314.106 184.882 1.00 65.59 C ANISOU17950 CZ PHE N 459 6912 8616 9395 -237 41 -968 C ATOM 17951 N ILE N 460 150.731 319.847 189.211 1.00 36.01 N ANISOU17951 N ILE N 460 3359 4767 5558 -385 -82 -721 N ATOM 17952 CA ILE N 460 150.953 320.572 190.459 1.00 37.91 C ANISOU17952 CA ILE N 460 3623 4978 5804 -403 -123 -688 C ATOM 17953 C ILE N 460 149.997 320.065 191.528 1.00 42.87 C ANISOU17953 C ILE N 460 4304 5560 6426 -386 -154 -690 C ATOM 17954 O ILE N 460 150.372 319.885 192.700 1.00 40.48 O ANISOU17954 O ILE N 460 4009 5227 6143 -380 -194 -685 O ATOM 17955 CB ILE N 460 150.787 322.085 190.236 1.00 39.64 C ANISOU17955 CB ILE N 460 3856 5212 5993 -444 -112 -645 C ATOM 17956 CG1 ILE N 460 151.907 322.598 189.323 1.00 50.01 C ANISOU17956 CG1 ILE N 460 5112 6570 7319 -463 -87 -637 C ATOM 17957 CG2 ILE N 460 150.780 322.815 191.577 1.00 38.48 C ANISOU17957 CG2 ILE N 460 3744 5031 5845 -462 -155 -616 C ATOM 17958 CD1 ILE N 460 151.722 324.041 188.902 1.00 37.33 C ANISOU17958 CD1 ILE N 460 3517 4982 5686 -503 -72 -595 C ATOM 17959 N SER N 461 148.751 319.790 191.135 1.00 35.66 N ANISOU17959 N SER N 461 3425 4641 5483 -377 -136 -699 N ATOM 17960 CA SER N 461 147.810 319.281 192.123 1.00 35.79 C ANISOU17960 CA SER N 461 3491 4616 5492 -360 -164 -699 C ATOM 17961 C SER N 461 148.207 317.889 192.547 1.00 42.37 C ANISOU17961 C SER N 461 4306 5429 6365 -324 -185 -733 C ATOM 17962 O SER N 461 148.009 317.515 193.700 1.00 40.92 O ANISOU17962 O SER N 461 4149 5209 6190 -312 -222 -726 O ATOM 17963 CB SER N 461 146.366 319.296 191.579 1.00 34.65 C ANISOU17963 CB SER N 461 3386 4471 5307 -360 -140 -699 C ATOM 17964 OG SER N 461 145.975 320.628 191.279 1.00 42.92 O ANISOU17964 OG SER N 461 4454 5534 6321 -393 -125 -665 O ATOM 17965 N LEU N 462 148.808 317.115 191.644 1.00 34.86 N ANISOU17965 N LEU N 462 3308 4501 5438 -306 -162 -768 N ATOM 17966 CA LEU N 462 149.275 315.804 192.064 1.00 34.51 C ANISOU17966 CA LEU N 462 3242 4434 5437 -271 -184 -800 C ATOM 17967 C LEU N 462 150.329 315.959 193.148 1.00 48.21 C ANISOU17967 C LEU N 462 4961 6152 7204 -274 -224 -783 C ATOM 17968 O LEU N 462 150.350 315.198 194.132 1.00 38.87 O ANISOU17968 O LEU N 462 3790 4934 6046 -252 -261 -788 O ATOM 17969 CB LEU N 462 149.829 315.019 190.870 1.00 37.40 C ANISOU17969 CB LEU N 462 3558 4830 5824 -253 -150 -843 C ATOM 17970 CG LEU N 462 150.774 313.857 191.217 1.00 37.67 C ANISOU17970 CG LEU N 462 3553 4847 5913 -220 -172 -874 C ATOM 17971 CD1 LEU N 462 150.009 312.718 191.823 1.00 38.80 C ANISOU17971 CD1 LEU N 462 3725 4947 6072 -190 -197 -894 C ATOM 17972 CD2 LEU N 462 151.564 313.390 189.941 1.00 43.05 C ANISOU17972 CD2 LEU N 462 4177 5569 6612 -209 -134 -911 C ATOM 17973 N THR N 463 151.191 316.971 193.001 1.00 40.01 N ANISOU17973 N THR N 463 3898 5140 6165 -301 -219 -761 N ATOM 17974 CA THR N 463 152.230 317.169 194.013 1.00 44.28 C ANISOU17974 CA THR N 463 4422 5668 6736 -306 -258 -745 C ATOM 17975 C THR N 463 151.585 317.500 195.350 1.00 39.31 C ANISOU17975 C THR N 463 3847 5001 6089 -314 -297 -717 C ATOM 17976 O THR N 463 152.009 316.996 196.401 1.00 43.33 O ANISOU17976 O THR N 463 4356 5483 6623 -300 -337 -717 O ATOM 17977 CB THR N 463 153.222 318.250 193.554 1.00 33.76 C ANISOU17977 CB THR N 463 3052 4372 5403 -338 -244 -724 C ATOM 17978 OG1 THR N 463 153.865 317.824 192.320 1.00 40.95 O ANISOU17978 OG1 THR N 463 3909 5321 6331 -328 -206 -751 O ATOM 17979 CG2 THR N 463 154.312 318.477 194.578 1.00 33.62 C ANISOU17979 CG2 THR N 463 3015 4344 5415 -345 -284 -708 C ATOM 17980 N ALA N 464 150.504 318.290 195.330 1.00 35.86 N ANISOU17980 N ALA N 464 3458 4561 5606 -334 -286 -696 N ATOM 17981 CA ALA N 464 149.785 318.563 196.589 1.00 42.32 C ANISOU17981 CA ALA N 464 4331 5345 6403 -339 -320 -672 C ATOM 17982 C ALA N 464 149.188 317.290 197.191 1.00 41.01 C ANISOU17982 C ALA N 464 4187 5147 6250 -304 -342 -689 C ATOM 17983 O ALA N 464 149.231 317.089 198.421 1.00 42.35 O ANISOU17983 O ALA N 464 4377 5287 6426 -298 -382 -677 O ATOM 17984 CB ALA N 464 148.694 319.618 196.383 1.00 35.64 C ANISOU17984 CB ALA N 464 3531 4503 5506 -364 -302 -647 C ATOM 17985 N VAL N 465 148.620 316.418 196.361 1.00 38.60 N ANISOU17985 N VAL N 465 3876 4844 5947 -281 -316 -718 N ATOM 17986 CA VAL N 465 148.018 315.189 196.890 1.00 36.38 C ANISOU17986 CA VAL N 465 3614 4529 5680 -249 -336 -734 C ATOM 17987 C VAL N 465 149.077 314.317 197.570 1.00 60.46 C ANISOU17987 C VAL N 465 6629 7560 8782 -227 -372 -747 C ATOM 17988 O VAL N 465 148.847 313.752 198.641 1.00 44.15 O ANISOU17988 O VAL N 465 4587 5461 6726 -212 -409 -739 O ATOM 17989 CB VAL N 465 147.304 314.394 195.783 1.00 40.17 C ANISOU17989 CB VAL N 465 4088 5017 6157 -230 -301 -766 C ATOM 17990 CG1 VAL N 465 146.759 313.096 196.365 1.00 39.45 C ANISOU17990 CG1 VAL N 465 4014 4889 6087 -197 -326 -782 C ATOM 17991 CG2 VAL N 465 146.176 315.232 195.217 1.00 45.85 C ANISOU17991 CG2 VAL N 465 4845 5753 6825 -252 -271 -750 C ATOM 17992 N MET N 466 150.206 314.109 196.909 1.00 36.54 N ANISOU17992 N MET N 466 3544 4553 5787 -221 -359 -768 N ATOM 17993 CA MET N 466 151.286 313.337 197.537 1.00 39.14 C ANISOU17993 CA MET N 466 3837 4866 6168 -200 -394 -778 C ATOM 17994 C MET N 466 151.699 313.990 198.847 1.00 33.13 C ANISOU17994 C MET N 466 3094 4091 5404 -218 -436 -743 C ATOM 17995 O MET N 466 151.896 313.313 199.867 1.00 41.48 O ANISOU17995 O MET N 466 4157 5118 6486 -200 -478 -740 O ATOM 17996 CB MET N 466 152.491 313.220 196.587 1.00 40.77 C ANISOU17996 CB MET N 466 3978 5105 6407 -197 -370 -802 C ATOM 17997 CG MET N 466 152.072 312.546 195.266 1.00 43.65 C ANISOU17997 CG MET N 466 4326 5487 6772 -179 -327 -841 C ATOM 17998 SD MET N 466 153.513 312.024 194.265 1.00 43.09 S ANISOU17998 SD MET N 466 4176 5449 6747 -164 -303 -877 S ATOM 17999 CE MET N 466 154.198 313.656 193.973 1.00 37.65 C ANISOU17999 CE MET N 466 3471 4804 6031 -209 -286 -841 C ATOM 18000 N LEU N 467 151.807 315.310 198.835 1.00 38.73 N ANISOU18000 N LEU N 467 3813 4821 6081 -253 -427 -717 N ATOM 18001 CA LEU N 467 152.191 315.995 200.056 1.00 37.73 C ANISOU18001 CA LEU N 467 3704 4682 5948 -273 -467 -687 C ATOM 18002 C LEU N 467 151.162 315.750 201.150 1.00 66.48 C ANISOU18002 C LEU N 467 7404 8290 9566 -266 -495 -672 C ATOM 18003 O LEU N 467 151.523 315.521 202.310 1.00 41.15 O ANISOU18003 O LEU N 467 4203 5060 6371 -261 -539 -660 O ATOM 18004 CB LEU N 467 152.387 317.486 199.796 1.00 38.34 C ANISOU18004 CB LEU N 467 3786 4787 5996 -313 -450 -663 C ATOM 18005 CG LEU N 467 153.034 318.173 201.011 1.00 48.83 C ANISOU18005 CG LEU N 467 5122 6106 7324 -334 -492 -638 C ATOM 18006 CD1 LEU N 467 154.453 317.689 201.214 1.00 42.40 C ANISOU18006 CD1 LEU N 467 4253 5298 6561 -323 -514 -648 C ATOM 18007 CD2 LEU N 467 153.010 319.682 200.819 1.00 41.06 C ANISOU18007 CD2 LEU N 467 4152 5142 6306 -375 -477 -614 C ATOM 18008 N MET N 468 149.877 315.721 200.790 1.00 40.41 N ANISOU18008 N MET N 468 4142 4983 6229 -264 -472 -672 N ATOM 18009 CA MET N 468 148.853 315.525 201.808 1.00 39.18 C ANISOU18009 CA MET N 468 4042 4798 6048 -258 -497 -655 C ATOM 18010 C MET N 468 149.027 314.186 202.512 1.00 41.00 C ANISOU18010 C MET N 468 4265 4998 6317 -225 -532 -666 C ATOM 18011 O MET N 468 148.863 314.092 203.727 1.00 36.02 O ANISOU18011 O MET N 468 3663 4345 5679 -224 -571 -647 O ATOM 18012 CB MET N 468 147.456 315.591 201.200 1.00 34.88 C ANISOU18012 CB MET N 468 3535 4255 5464 -259 -464 -655 C ATOM 18013 CG MET N 468 146.396 315.258 202.237 1.00 42.86 C ANISOU18013 CG MET N 468 4600 5237 6450 -251 -489 -638 C ATOM 18014 SD MET N 468 144.868 314.936 201.353 1.00 52.71 S ANISOU18014 SD MET N 468 5877 6485 7665 -242 -450 -646 S ATOM 18015 CE MET N 468 145.207 313.299 200.651 1.00 59.14 C ANISOU18015 CE MET N 468 6648 7289 8534 -202 -446 -688 C ATOM 18016 N VAL N 469 149.333 313.132 201.755 1.00 35.26 N ANISOU18016 N VAL N 469 3499 4269 5629 -197 -520 -697 N ATOM 18017 CA VAL N 469 149.571 311.831 202.372 1.00 38.23 C ANISOU18017 CA VAL N 469 3863 4613 6048 -165 -555 -709 C ATOM 18018 C VAL N 469 150.724 311.922 203.372 1.00 48.08 C ANISOU18018 C VAL N 469 5090 5854 7324 -168 -599 -694 C ATOM 18019 O VAL N 469 150.638 311.441 204.509 1.00 40.52 O ANISOU18019 O VAL N 469 4153 4868 6374 -158 -641 -679 O ATOM 18020 CB VAL N 469 149.837 310.771 201.296 1.00 42.44 C ANISOU18020 CB VAL N 469 4354 5148 6624 -136 -532 -750 C ATOM 18021 CG1 VAL N 469 150.289 309.490 201.909 1.00 33.87 C ANISOU18021 CG1 VAL N 469 3250 4029 5592 -104 -571 -761 C ATOM 18022 CG2 VAL N 469 148.514 310.553 200.433 1.00 39.59 C ANISOU18022 CG2 VAL N 469 4021 4789 6232 -132 -494 -764 C ATOM 18023 N PHE N 470 151.824 312.544 202.960 1.00 38.91 N ANISOU18023 N PHE N 470 3888 4720 6177 -183 -589 -698 N ATOM 18024 CA PHE N 470 152.950 312.689 203.878 1.00 43.55 C ANISOU18024 CA PHE N 470 4453 5304 6789 -188 -630 -684 C ATOM 18025 C PHE N 470 152.527 313.404 205.170 1.00 44.80 C ANISOU18025 C PHE N 470 4662 5452 6910 -210 -663 -650 C ATOM 18026 O PHE N 470 152.922 313.000 206.283 1.00 42.80 O ANISOU18026 O PHE N 470 4411 5177 6673 -201 -709 -637 O ATOM 18027 CB PHE N 470 154.085 313.457 203.185 1.00 36.48 C ANISOU18027 CB PHE N 470 3509 4445 5906 -208 -610 -688 C ATOM 18028 CG PHE N 470 155.013 314.123 204.164 1.00 42.62 C ANISOU18028 CG PHE N 470 4279 5227 6689 -228 -647 -665 C ATOM 18029 CD1 PHE N 470 155.947 313.359 204.870 1.00 38.09 C ANISOU18029 CD1 PHE N 470 3675 4638 6161 -209 -688 -666 C ATOM 18030 CD2 PHE N 470 154.901 315.487 204.444 1.00 38.31 C ANISOU18030 CD2 PHE N 470 3759 4696 6101 -266 -644 -641 C ATOM 18031 CE1 PHE N 470 156.802 313.965 205.825 1.00 44.34 C ANISOU18031 CE1 PHE N 470 4459 5434 6955 -228 -725 -645 C ATOM 18032 CE2 PHE N 470 155.748 316.097 205.419 1.00 37.61 C ANISOU18032 CE2 PHE N 470 3664 4610 6016 -286 -681 -621 C ATOM 18033 CZ PHE N 470 156.688 315.323 206.095 1.00 44.88 C ANISOU18033 CZ PHE N 470 4552 5518 6980 -267 -722 -624 C ATOM 18034 N ILE N 471 151.732 314.470 205.043 1.00 38.41 N ANISOU18034 N ILE N 471 3892 4655 6048 -237 -640 -635 N ATOM 18035 CA ILE N 471 151.367 315.278 206.217 1.00 46.13 C ANISOU18035 CA ILE N 471 4916 5624 6986 -260 -667 -606 C ATOM 18036 C ILE N 471 150.568 314.452 207.207 1.00 45.49 C ANISOU18036 C ILE N 471 4874 5511 6898 -240 -698 -597 C ATOM 18037 O ILE N 471 150.773 314.541 208.423 1.00 39.56 O ANISOU18037 O ILE N 471 4141 4748 6141 -246 -739 -579 O ATOM 18038 CB ILE N 471 150.601 316.536 205.784 1.00 38.81 C ANISOU18038 CB ILE N 471 4024 4716 6007 -291 -633 -594 C ATOM 18039 CG1 ILE N 471 151.568 317.446 205.041 1.00 42.66 C ANISOU18039 CG1 ILE N 471 4472 5234 6504 -315 -612 -596 C ATOM 18040 CG2 ILE N 471 149.987 317.254 206.982 1.00 37.13 C ANISOU18040 CG2 ILE N 471 3866 4492 5750 -310 -657 -569 C ATOM 18041 CD1 ILE N 471 150.917 318.586 204.247 1.00 35.30 C ANISOU18041 CD1 ILE N 471 3560 4322 5530 -343 -571 -588 C ATOM 18042 N ILE N 472 149.653 313.623 206.707 1.00 44.68 N ANISOU18042 N ILE N 472 4785 5396 6796 -218 -680 -609 N ATOM 18043 CA ILE N 472 148.890 312.746 207.589 1.00 35.63 C ANISOU18043 CA ILE N 472 3672 4219 5647 -198 -710 -599 C ATOM 18044 C ILE N 472 149.812 311.767 208.292 1.00 49.72 C ANISOU18044 C ILE N 472 5427 5983 7483 -176 -755 -601 C ATOM 18045 O ILE N 472 149.665 311.504 209.496 1.00 36.44 O ANISOU18045 O ILE N 472 3770 4280 5795 -173 -797 -581 O ATOM 18046 CB ILE N 472 147.819 312.013 206.784 1.00 33.59 C ANISOU18046 CB ILE N 472 3427 3951 5384 -179 -679 -614 C ATOM 18047 CG1 ILE N 472 146.781 313.058 206.313 1.00 37.79 C ANISOU18047 CG1 ILE N 472 3998 4503 5858 -204 -640 -604 C ATOM 18048 CG2 ILE N 472 147.115 310.935 207.643 1.00 37.33 C ANISOU18048 CG2 ILE N 472 3929 4391 5865 -156 -712 -604 C ATOM 18049 CD1 ILE N 472 145.906 312.488 205.204 1.00 34.20 C ANISOU18049 CD1 ILE N 472 3545 4049 5401 -188 -602 -624 C ATOM 18050 N TRP N 473 150.741 311.175 207.532 1.00 39.76 N ANISOU18050 N TRP N 473 4110 4725 6273 -158 -748 -625 N ATOM 18051 CA TRP N 473 151.741 310.283 208.113 1.00 38.99 C ANISOU18051 CA TRP N 473 3976 4608 6229 -137 -790 -628 C ATOM 18052 C TRP N 473 152.520 310.986 209.198 1.00 35.58 C ANISOU18052 C TRP N 473 3545 4183 5789 -158 -828 -604 C ATOM 18053 O TRP N 473 152.696 310.448 210.288 1.00 40.99 O ANISOU18053 O TRP N 473 4240 4847 6489 -148 -875 -588 O ATOM 18054 CB TRP N 473 152.726 309.774 207.055 1.00 40.37 C ANISOU18054 CB TRP N 473 4089 4794 6457 -119 -771 -659 C ATOM 18055 CG TRP N 473 153.908 309.042 207.729 1.00 48.33 C ANISOU18055 CG TRP N 473 5057 5786 7520 -101 -816 -658 C ATOM 18056 CD1 TRP N 473 153.876 307.791 208.238 1.00 37.64 C ANISOU18056 CD1 TRP N 473 3700 4396 6205 -70 -850 -660 C ATOM 18057 CD2 TRP N 473 155.248 309.551 207.987 1.00 39.91 C ANISOU18057 CD2 TRP N 473 3951 4740 6474 -114 -834 -652 C ATOM 18058 NE1 TRP N 473 155.116 307.463 208.770 1.00 36.22 N ANISOU18058 NE1 TRP N 473 3480 4212 6069 -62 -887 -656 N ATOM 18059 CE2 TRP N 473 155.955 308.535 208.643 1.00 37.75 C ANISOU18059 CE2 TRP N 473 3652 4441 6251 -88 -878 -651 C ATOM 18060 CE3 TRP N 473 155.911 310.766 207.704 1.00 41.13 C ANISOU18060 CE3 TRP N 473 4088 4930 6610 -145 -816 -647 C ATOM 18061 CZ2 TRP N 473 157.313 308.670 209.014 1.00 41.91 C ANISOU18061 CZ2 TRP N 473 4135 4980 6810 -92 -904 -645 C ATOM 18062 CZ3 TRP N 473 157.246 310.914 208.081 1.00 52.79 C ANISOU18062 CZ3 TRP N 473 5522 6418 8118 -150 -843 -642 C ATOM 18063 CH2 TRP N 473 157.930 309.871 208.756 1.00 37.68 C ANISOU18063 CH2 TRP N 473 3583 4480 6254 -123 -887 -641 C ATOM 18064 N GLU N 474 152.996 312.205 208.921 1.00 43.33 N ANISOU18064 N GLU N 474 4519 5196 6749 -188 -810 -600 N ATOM 18065 CA GLU N 474 153.788 312.903 209.927 1.00 43.20 C ANISOU18065 CA GLU N 474 4501 5186 6726 -210 -846 -581 C ATOM 18066 C GLU N 474 152.999 313.109 211.204 1.00 53.50 C ANISOU18066 C GLU N 474 5863 6475 7989 -219 -877 -556 C ATOM 18067 O GLU N 474 153.565 313.016 212.294 1.00 42.92 O ANISOU18067 O GLU N 474 4523 5127 6658 -221 -924 -541 O ATOM 18068 CB GLU N 474 154.295 314.243 209.409 1.00 42.60 C ANISOU18068 CB GLU N 474 4412 5145 6630 -244 -819 -580 C ATOM 18069 CG GLU N 474 155.389 314.889 210.303 1.00 56.11 C ANISOU18069 CG GLU N 474 6107 6866 8347 -265 -857 -565 C ATOM 18070 CD GLU N 474 154.807 315.621 211.510 1.00 57.28 C ANISOU18070 CD GLU N 474 6310 7007 8446 -287 -883 -542 C ATOM 18071 OE1 GLU N 474 155.475 315.725 212.530 1.00 43.52 O ANISOU18071 OE1 GLU N 474 4565 5262 6710 -295 -926 -530 O ATOM 18072 OE2 GLU N 474 153.654 316.084 211.449 1.00 42.85 O ANISOU18072 OE2 GLU N 474 4530 5177 6572 -298 -860 -537 O ATOM 18073 N ALA N 475 151.690 313.404 211.088 1.00 41.31 N ANISOU18073 N ALA N 475 4368 4928 6399 -226 -853 -551 N ATOM 18074 CA ALA N 475 150.859 313.581 212.277 1.00 44.28 C ANISOU18074 CA ALA N 475 4800 5291 6733 -234 -879 -528 C ATOM 18075 C ALA N 475 150.812 312.301 213.100 1.00 48.41 C ANISOU18075 C ALA N 475 5325 5783 7284 -206 -923 -520 C ATOM 18076 O ALA N 475 150.966 312.334 214.321 1.00 43.85 O ANISOU18076 O ALA N 475 4767 5199 6696 -212 -966 -501 O ATOM 18077 CB ALA N 475 149.425 314.015 211.872 1.00 38.88 C ANISOU18077 CB ALA N 475 4164 4610 5999 -242 -840 -526 C ATOM 18078 N PHE N 476 150.561 311.158 212.450 1.00 36.50 N ANISOU18078 N PHE N 476 3800 4258 5812 -176 -913 -535 N ATOM 18079 CA PHE N 476 150.483 309.926 213.204 1.00 38.25 C ANISOU18079 CA PHE N 476 4024 4447 6063 -150 -956 -525 C ATOM 18080 C PHE N 476 151.851 309.486 213.676 1.00 50.48 C ANISOU18080 C PHE N 476 5528 5990 7662 -140 -997 -524 C ATOM 18081 O PHE N 476 151.954 308.736 214.655 1.00 42.03 O ANISOU18081 O PHE N 476 4464 4896 6608 -127 -1045 -506 O ATOM 18082 CB PHE N 476 149.882 308.838 212.358 1.00 39.30 C ANISOU18082 CB PHE N 476 4148 4559 6224 -121 -935 -543 C ATOM 18083 CG PHE N 476 148.376 308.893 212.254 1.00 52.23 C ANISOU18083 CG PHE N 476 5837 6192 7816 -124 -911 -537 C ATOM 18084 CD1 PHE N 476 147.596 308.677 213.368 1.00 33.65 C ANISOU18084 CD1 PHE N 476 3529 3821 5435 -126 -941 -510 C ATOM 18085 CD2 PHE N 476 147.754 309.137 211.029 1.00 35.18 C ANISOU18085 CD2 PHE N 476 3677 4046 5642 -125 -857 -556 C ATOM 18086 CE1 PHE N 476 146.194 308.716 213.310 1.00 39.81 C ANISOU18086 CE1 PHE N 476 4356 4599 6173 -129 -919 -503 C ATOM 18087 CE2 PHE N 476 146.307 309.156 210.939 1.00 43.12 C ANISOU18087 CE2 PHE N 476 4730 5048 6605 -128 -835 -549 C ATOM 18088 CZ PHE N 476 145.539 308.948 212.100 1.00 36.39 C ANISOU18088 CZ PHE N 476 3923 4178 5725 -130 -866 -521 C ATOM 18089 N ALA N 477 152.910 309.904 212.966 1.00 38.04 N ANISOU18089 N ALA N 477 3905 4436 6111 -145 -980 -541 N ATOM 18090 CA ALA N 477 154.253 309.474 213.348 1.00 58.11 C ANISOU18090 CA ALA N 477 6400 6976 8704 -135 -1017 -540 C ATOM 18091 C ALA N 477 154.764 310.220 214.576 1.00 39.34 C ANISOU18091 C ALA N 477 4037 4609 6302 -160 -1058 -515 C ATOM 18092 O ALA N 477 155.535 309.656 215.360 1.00 43.81 O ANISOU18092 O ALA N 477 4583 5163 6901 -149 -1105 -504 O ATOM 18093 CB ALA N 477 155.232 309.657 212.191 1.00 39.05 C ANISOU18093 CB ALA N 477 3928 4584 6325 -134 -985 -565 C ATOM 18094 N SER N 478 154.371 311.483 214.746 1.00 45.89 N ANISOU18094 N SER N 478 4899 5460 7076 -193 -1041 -508 N ATOM 18095 CA SER N 478 154.912 312.306 215.818 1.00 43.96 C ANISOU18095 CA SER N 478 4666 5229 6809 -219 -1075 -490 C ATOM 18096 C SER N 478 154.105 312.227 217.100 1.00 78.82 C ANISOU18096 C SER N 478 9135 9628 11184 -223 -1110 -467 C ATOM 18097 O SER N 478 154.674 312.404 218.177 1.00 41.18 O ANISOU18097 O SER N 478 4370 4863 6412 -234 -1154 -451 O ATOM 18098 CB SER N 478 155.007 313.768 215.368 1.00 52.26 C ANISOU18098 CB SER N 478 5721 6310 7824 -254 -1041 -496 C ATOM 18099 OG SER N 478 156.007 313.894 214.374 1.00 42.74 O ANISOU18099 OG SER N 478 4460 5122 6657 -254 -1019 -513 O ATOM 18100 N LYS N 479 152.800 311.977 217.012 1.00 41.99 N ATOM 18101 CA LYS N 479 151.943 311.734 218.178 1.00 37.41 C ATOM 18102 C LYS N 479 151.979 312.899 219.145 1.00 44.36 C ATOM 18103 O LYS N 479 152.314 312.735 220.330 1.00 46.10 O ATOM 18104 CB LYS N 479 152.299 310.422 218.891 1.00 38.04 C ATOM 18105 CG LYS N 479 152.047 309.169 218.037 1.00 40.07 C ATOM 18106 CD LYS N 479 152.368 307.901 218.822 1.00 45.35 C ATOM 18107 CE LYS N 479 151.683 306.670 218.287 1.00 49.14 C ATOM 18108 NZ LYS N 479 151.880 305.487 219.215 1.00 45.24 N