>>3AZJ:HELIX    3   3 GLN A   85  ALA A  114  1                                  30    
QSSAVMALQEACEAYLVGLFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 3 3 GLN A 85 ALA A 114 1 30 ATOM 412 N GLN A 85 -43.710 -10.149 36.164 1.00 37.48 N ATOM 413 CA GLN A 85 -44.395 -11.305 35.642 1.00 35.43 C ATOM 414 C GLN A 85 -44.882 -11.996 36.900 1.00 36.11 C ATOM 415 O GLN A 85 -44.234 -11.940 37.946 1.00 34.83 O ATOM 416 CB GLN A 85 -43.456 -12.244 34.904 1.00 32.95 C ATOM 417 CG GLN A 85 -42.802 -11.644 33.713 1.00 35.99 C ATOM 418 CD GLN A 85 -42.461 -12.681 32.676 1.00 40.50 C ATOM 419 OE1 GLN A 85 -42.009 -13.786 32.999 1.00 42.17 O ATOM 420 NE2 GLN A 85 -42.671 -12.334 31.414 1.00 39.91 N ATOM 421 N SER A 86 -46.037 -12.630 36.798 1.00 38.40 N ATOM 422 CA SER A 86 -46.612 -13.345 37.917 1.00 36.52 C ATOM 423 C SER A 86 -45.557 -14.329 38.378 1.00 35.82 C ATOM 424 O SER A 86 -45.208 -14.385 39.551 1.00 38.75 O ATOM 425 CB SER A 86 -47.847 -14.086 37.434 1.00 37.03 C ATOM 426 OG SER A 86 -48.280 -15.006 38.401 1.00 41.70 O ATOM 427 N SER A 87 -45.036 -15.083 37.415 1.00 34.52 N ATOM 428 CA SER A 87 -44.026 -16.101 37.653 1.00 30.90 C ATOM 429 C SER A 87 -42.706 -15.605 38.272 1.00 31.07 C ATOM 430 O SER A 87 -42.055 -16.352 39.014 1.00 23.39 O ATOM 431 CB SER A 87 -43.743 -16.830 36.343 1.00 27.18 C ATOM 432 OG SER A 87 -43.431 -15.909 35.313 1.00 29.36 O ATOM 433 N ALA A 88 -42.293 -14.376 37.951 1.00 30.22 N ATOM 434 CA ALA A 88 -41.056 -13.836 38.522 1.00 30.75 C ATOM 435 C ALA A 88 -41.228 -13.693 40.033 1.00 29.64 C ATOM 436 O ALA A 88 -40.346 -14.055 40.817 1.00 30.36 O ATOM 437 CB ALA A 88 -40.739 -12.505 37.926 1.00 30.10 C ATOM 438 N VAL A 89 -42.369 -13.166 40.445 1.00 25.55 N ATOM 439 CA VAL A 89 -42.607 -13.021 41.857 1.00 25.02 C ATOM 440 C VAL A 89 -42.672 -14.393 42.506 1.00 29.05 C ATOM 441 O VAL A 89 -42.162 -14.567 43.615 1.00 30.81 O ATOM 442 CB VAL A 89 -43.913 -12.279 42.159 1.00 20.39 C ATOM 443 CG1 VAL A 89 -44.147 -12.260 43.660 1.00 17.62 C ATOM 444 CG2 VAL A 89 -43.847 -10.872 41.622 1.00 16.47 C ATOM 445 N MET A 90 -43.299 -15.364 41.838 1.00 30.19 N ATOM 446 CA MET A 90 -43.379 -16.704 42.421 1.00 33.97 C ATOM 447 C MET A 90 -41.994 -17.343 42.545 1.00 33.93 C ATOM 448 O MET A 90 -41.705 -18.013 43.520 1.00 32.69 O ATOM 449 CB MET A 90 -44.298 -17.614 41.603 1.00 39.62 C ATOM 450 CG MET A 90 -45.772 -17.473 41.935 1.00 48.96 C ATOM 451 SD MET A 90 -46.074 -17.519 43.738 1.00 60.72 S ATOM 452 CE MET A 90 -46.072 -15.667 44.125 1.00 61.10 C ATOM 453 N ALA A 91 -41.134 -17.116 41.556 1.00 35.39 N ATOM 454 CA ALA A 91 -39.786 -17.663 41.573 1.00 32.90 C ATOM 455 C ALA A 91 -39.021 -17.065 42.743 1.00 33.59 C ATOM 456 O ALA A 91 -38.329 -17.780 43.469 1.00 34.15 O ATOM 457 CB ALA A 91 -39.075 -17.350 40.267 1.00 27.76 C ATOM 458 N LEU A 92 -39.146 -15.754 42.923 1.00 33.47 N ATOM 459 CA LEU A 92 -38.463 -15.073 44.015 1.00 33.70 C ATOM 460 C LEU A 92 -38.853 -15.669 45.353 1.00 36.11 C ATOM 461 O LEU A 92 -37.997 -15.942 46.192 1.00 38.42 O ATOM 462 CB LEU A 92 -38.808 -13.587 44.019 1.00 33.37 C ATOM 463 CG LEU A 92 -37.940 -12.721 43.116 1.00 34.14 C ATOM 464 CD1 LEU A 92 -38.468 -11.317 43.110 1.00 33.30 C ATOM 465 CD2 LEU A 92 -36.512 -12.753 43.608 1.00 32.21 C ATOM 466 N GLN A 93 -40.148 -15.878 45.559 1.00 34.82 N ATOM 467 CA GLN A 93 -40.597 -16.426 46.821 1.00 32.24 C ATOM 468 C GLN A 93 -40.094 -17.839 47.022 1.00 32.36 C ATOM 469 O GLN A 93 -39.719 -18.237 48.123 1.00 35.02 O ATOM 470 CB GLN A 93 -42.116 -16.408 46.916 1.00 30.84 C ATOM 471 CG GLN A 93 -42.555 -16.478 48.347 1.00 32.09 C ATOM 472 CD GLN A 93 -44.020 -16.356 48.515 1.00 31.13 C ATOM 473 OE1 GLN A 93 -44.651 -15.493 47.908 1.00 37.32 O ATOM 474 NE2 GLN A 93 -44.587 -17.204 49.358 1.00 27.23 N ATOM 475 N GLU A 94 -40.100 -18.609 45.953 1.00 29.38 N ATOM 476 CA GLU A 94 -39.627 -19.966 46.035 1.00 29.81 C ATOM 477 C GLU A 94 -38.159 -19.954 46.440 1.00 29.61 C ATOM 478 O GLU A 94 -37.759 -20.629 47.377 1.00 27.91 O ATOM 479 CB GLU A 94 -39.772 -20.638 44.677 1.00 32.62 C ATOM 480 CG GLU A 94 -41.168 -21.102 44.349 1.00 31.82 C ATOM 481 CD GLU A 94 -41.520 -22.384 45.037 1.00 31.61 C ATOM 482 OE1 GLU A 94 -40.591 -23.139 45.410 1.00 29.25 O ATOM 483 OE2 GLU A 94 -42.728 -22.638 45.188 1.00 33.50 O ATOM 484 N ALA A 95 -37.361 -19.182 45.712 1.00 29.99 N ATOM 485 CA ALA A 95 -35.929 -19.097 45.969 1.00 28.21 C ATOM 486 C ALA A 95 -35.712 -18.671 47.401 1.00 26.02 C ATOM 487 O ALA A 95 -34.996 -19.313 48.173 1.00 24.48 O ATOM 488 CB ALA A 95 -35.264 -18.079 45.002 1.00 23.46 C ATOM 489 N CYS A 96 -36.361 -17.575 47.736 1.00 24.46 N ATOM 490 CA CYS A 96 -36.284 -16.994 49.045 1.00 26.24 C ATOM 491 C CYS A 96 -36.610 -17.950 50.210 1.00 25.95 C ATOM 492 O CYS A 96 -35.825 -18.072 51.148 1.00 27.43 O ATOM 493 CB CYS A 96 -37.195 -15.783 49.064 1.00 26.41 C ATOM 494 SG CYS A 96 -37.071 -14.901 50.563 1.00 41.85 S ATOM 495 N GLU A 97 -37.757 -18.625 50.160 1.00 26.74 N ATOM 496 CA GLU A 97 -38.147 -19.550 51.226 1.00 24.24 C ATOM 497 C GLU A 97 -37.228 -20.770 51.296 1.00 19.78 C ATOM 498 O GLU A 97 -36.910 -21.282 52.368 1.00 15.10 O ATOM 499 CB GLU A 97 -39.608 -20.001 51.040 1.00 27.07 C ATOM 500 CG GLU A 97 -40.675 -19.017 51.575 1.00 33.26 C ATOM 501 CD GLU A 97 -42.102 -19.601 51.567 1.00 37.66 C ATOM 502 OE1 GLU A 97 -42.269 -20.792 51.906 1.00 36.93 O ATOM 503 OE2 GLU A 97 -43.060 -18.868 51.241 1.00 36.12 O ATOM 504 N ALA A 98 -36.804 -21.243 50.140 1.00 20.76 N ATOM 505 CA ALA A 98 -35.923 -22.400 50.085 1.00 20.38 C ATOM 506 C ALA A 98 -34.646 -22.057 50.827 1.00 22.86 C ATOM 507 O ALA A 98 -34.085 -22.890 51.537 1.00 27.87 O ATOM 508 CB ALA A 98 -35.606 -22.748 48.636 1.00 16.50 C ATOM 509 N TYR A 99 -34.205 -20.816 50.640 1.00 23.07 N ATOM 510 CA TYR A 99 -33.003 -20.289 51.255 1.00 21.27 C ATOM 511 C TYR A 99 -33.212 -20.178 52.751 1.00 21.97 C ATOM 512 O TYR A 99 -32.388 -20.639 53.534 1.00 27.95 O ATOM 513 CB TYR A 99 -32.666 -18.905 50.668 1.00 19.59 C ATOM 514 CG TYR A 99 -31.682 -18.097 51.498 1.00 24.19 C ATOM 515 CD1 TYR A 99 -30.298 -18.338 51.432 1.00 24.88 C ATOM 516 CD2 TYR A 99 -32.134 -17.120 52.389 1.00 23.26 C ATOM 517 CE1 TYR A 99 -29.401 -17.618 52.239 1.00 20.98 C ATOM 518 CE2 TYR A 99 -31.250 -16.407 53.193 1.00 17.20 C ATOM 519 CZ TYR A 99 -29.900 -16.659 53.115 1.00 22.42 C ATOM 520 OH TYR A 99 -29.050 -15.958 53.933 1.00 28.30 O ATOM 521 N LEU A 100 -34.306 -19.561 53.161 1.00 21.35 N ATOM 522 CA LEU A 100 -34.530 -19.411 54.579 1.00 23.77 C ATOM 523 C LEU A 100 -34.568 -20.766 55.278 1.00 25.35 C ATOM 524 O LEU A 100 -33.855 -20.971 56.263 1.00 25.69 O ATOM 525 CB LEU A 100 -35.806 -18.611 54.823 1.00 19.77 C ATOM 526 CG LEU A 100 -35.573 -17.111 54.617 1.00 24.77 C ATOM 527 CD1 LEU A 100 -36.887 -16.265 54.766 1.00 14.98 C ATOM 528 CD2 LEU A 100 -34.512 -16.688 55.636 1.00 19.05 C ATOM 529 N VAL A 101 -35.366 -21.697 54.755 1.00 24.18 N ATOM 530 CA VAL A 101 -35.480 -23.025 55.356 1.00 21.76 C ATOM 531 C VAL A 101 -34.097 -23.673 55.479 1.00 23.28 C ATOM 532 O VAL A 101 -33.795 -24.385 56.454 1.00 23.80 O ATOM 533 CB VAL A 101 -36.419 -23.930 54.526 1.00 19.99 C ATOM 534 CG1 VAL A 101 -36.424 -25.340 55.077 1.00 10.87 C ATOM 535 CG2 VAL A 101 -37.826 -23.367 54.552 1.00 17.42 C ATOM 536 N GLY A 102 -33.251 -23.418 54.494 1.00 16.57 N ATOM 537 CA GLY A 102 -31.915 -23.963 54.543 1.00 16.71 C ATOM 538 C GLY A 102 -31.092 -23.298 55.625 1.00 19.45 C ATOM 539 O GLY A 102 -30.344 -23.959 56.330 1.00 24.42 O ATOM 540 N LEU A 103 -31.222 -21.987 55.767 1.00 21.89 N ATOM 541 CA LEU A 103 -30.475 -21.263 56.790 1.00 21.04 C ATOM 542 C LEU A 103 -30.975 -21.677 58.187 1.00 24.51 C ATOM 543 O LEU A 103 -30.186 -21.761 59.136 1.00 26.58 O ATOM 544 CB LEU A 103 -30.631 -19.755 56.577 1.00 18.17 C ATOM 545 CG LEU A 103 -29.975 -18.819 57.590 1.00 18.49 C ATOM 546 CD1 LEU A 103 -28.478 -18.936 57.467 1.00 18.89 C ATOM 547 CD2 LEU A 103 -30.441 -17.381 57.366 1.00 10.87 C ATOM 548 N PHE A 104 -32.277 -21.943 58.329 1.00 23.11 N ATOM 549 CA PHE A 104 -32.767 -22.370 59.630 1.00 22.01 C ATOM 550 C PHE A 104 -32.165 -23.753 59.919 1.00 24.51 C ATOM 551 O PHE A 104 -31.872 -24.092 61.055 1.00 22.64 O ATOM 552 CB PHE A 104 -34.300 -22.408 59.664 1.00 20.39 C ATOM 553 CG PHE A 104 -34.925 -21.089 60.000 1.00 15.58 C ATOM 554 CD1 PHE A 104 -34.476 -20.357 61.092 1.00 17.48 C ATOM 555 CD2 PHE A 104 -35.921 -20.552 59.202 1.00 16.17 C ATOM 556 CE1 PHE A 104 -35.000 -19.099 61.388 1.00 16.14 C ATOM 557 CE2 PHE A 104 -36.460 -19.293 59.485 1.00 16.03 C ATOM 558 CZ PHE A 104 -35.993 -18.565 60.581 1.00 18.95 C ATOM 559 N GLU A 105 -31.963 -24.556 58.883 1.00 26.17 N ATOM 560 CA GLU A 105 -31.342 -25.856 59.084 1.00 25.97 C ATOM 561 C GLU A 105 -29.953 -25.647 59.698 1.00 27.49 C ATOM 562 O GLU A 105 -29.672 -26.153 60.782 1.00 27.79 O ATOM 563 CB GLU A 105 -31.215 -26.589 57.760 1.00 23.17 C ATOM 564 CG GLU A 105 -32.095 -27.796 57.652 1.00 25.57 C ATOM 565 CD GLU A 105 -32.720 -27.943 56.269 1.00 33.55 C ATOM 566 OE1 GLU A 105 -32.001 -27.794 55.262 1.00 32.89 O ATOM 567 OE2 GLU A 105 -33.938 -28.225 56.191 1.00 38.46 O ATOM 568 N ASP A 106 -29.088 -24.900 59.015 1.00 28.38 N ATOM 569 CA ASP A 106 -27.744 -24.636 59.538 1.00 29.77 C ATOM 570 C ASP A 106 -27.766 -23.950 60.902 1.00 30.90 C ATOM 571 O ASP A 106 -26.921 -24.220 61.756 1.00 31.87 O ATOM 572 CB ASP A 106 -26.958 -23.745 58.590 1.00 26.57 C ATOM 573 CG ASP A 106 -26.732 -24.384 57.254 1.00 30.08 C ATOM 574 OD1 ASP A 106 -26.729 -25.643 57.186 1.00 28.38 O ATOM 575 OD2 ASP A 106 -26.544 -23.618 56.279 1.00 29.53 O ATOM 576 N THR A 107 -28.719 -23.043 61.094 1.00 28.09 N ATOM 577 CA THR A 107 -28.834 -22.335 62.360 1.00 29.45 C ATOM 578 C THR A 107 -29.113 -23.322 63.508 1.00 29.63 C ATOM 579 O THR A 107 -28.537 -23.228 64.600 1.00 29.07 O ATOM 580 CB THR A 107 -29.967 -21.278 62.296 1.00 30.54 C ATOM 581 OG1 THR A 107 -29.621 -20.255 61.352 1.00 34.01 O ATOM 582 CG2 THR A 107 -30.186 -20.643 63.653 1.00 27.37 C ATOM 583 N ASN A 108 -29.991 -24.283 63.261 1.00 26.88 N ATOM 584 CA ASN A 108 -30.307 -25.229 64.298 1.00 23.87 C ATOM 585 C ASN A 108 -29.067 -26.048 64.624 1.00 24.48 C ATOM 586 O ASN A 108 -28.825 -26.378 65.791 1.00 26.93 O ATOM 587 CB ASN A 108 -31.469 -26.121 63.880 1.00 20.48 C ATOM 588 CG ASN A 108 -32.080 -26.833 65.049 1.00 24.22 C ATOM 589 OD1 ASN A 108 -32.374 -26.217 66.084 1.00 28.54 O ATOM 590 ND2 ASN A 108 -32.273 -28.134 64.912 1.00 18.74 N ATOM 591 N LEU A 109 -28.274 -26.374 63.610 1.00 22.33 N ATOM 592 CA LEU A 109 -27.049 -27.115 63.862 1.00 25.07 C ATOM 593 C LEU A 109 -26.164 -26.300 64.830 1.00 30.14 C ATOM 594 O LEU A 109 -25.563 -26.848 65.763 1.00 32.30 O ATOM 595 CB LEU A 109 -26.298 -27.369 62.562 1.00 22.90 C ATOM 596 CG LEU A 109 -26.799 -28.482 61.641 1.00 19.92 C ATOM 597 CD1 LEU A 109 -25.959 -28.531 60.402 1.00 18.27 C ATOM 598 CD2 LEU A 109 -26.689 -29.790 62.322 1.00 13.43 C ATOM 599 N CYS A 110 -26.096 -24.989 64.627 1.00 29.22 N ATOM 600 CA CYS A 110 -25.298 -24.153 65.514 1.00 31.57 C ATOM 601 C CYS A 110 -25.879 -24.062 66.917 1.00 32.42 C ATOM 602 O CYS A 110 -25.134 -24.008 67.893 1.00 33.44 O ATOM 603 CB CYS A 110 -25.148 -22.744 64.946 1.00 30.51 C ATOM 604 SG CYS A 110 -24.272 -22.730 63.397 1.00 30.67 S ATOM 605 N ALA A 111 -27.205 -24.029 67.028 1.00 32.59 N ATOM 606 CA ALA A 111 -27.815 -23.946 68.353 1.00 29.81 C ATOM 607 C ALA A 111 -27.520 -25.239 69.109 1.00 28.96 C ATOM 608 O ALA A 111 -27.189 -25.220 70.287 1.00 30.08 O ATOM 609 CB ALA A 111 -29.300 -23.726 68.233 1.00 23.20 C ATOM 610 N ILE A 112 -27.617 -26.361 68.407 1.00 27.52 N ATOM 611 CA ILE A 112 -27.363 -27.658 69.004 1.00 26.65 C ATOM 612 C ILE A 112 -25.883 -27.781 69.347 1.00 28.53 C ATOM 613 O ILE A 112 -25.494 -28.479 70.282 1.00 28.70 O ATOM 614 CB ILE A 112 -27.759 -28.779 68.024 1.00 26.15 C ATOM 615 CG1 ILE A 112 -29.264 -28.724 67.785 1.00 24.42 C ATOM 616 CG2 ILE A 112 -27.305 -30.138 68.544 1.00 19.30 C ATOM 617 CD1 ILE A 112 -29.765 -29.786 66.851 1.00 23.12 C ATOM 618 N HIS A 113 -25.042 -27.099 68.594 1.00 29.18 N ATOM 619 CA HIS A 113 -23.629 -27.203 68.877 1.00 29.06 C ATOM 620 C HIS A 113 -23.343 -26.547 70.213 1.00 30.55 C ATOM 621 O HIS A 113 -22.398 -26.931 70.917 1.00 30.65 O ATOM 622 CB HIS A 113 -22.816 -26.538 67.777 1.00 26.56 C ATOM 623 CG HIS A 113 -21.355 -26.836 67.854 1.00 24.54 C ATOM 624 ND1 HIS A 113 -20.441 -25.941 68.361 1.00 27.89 N ATOM 625 CD2 HIS A 113 -20.645 -27.915 67.456 1.00 24.22 C ATOM 626 CE1 HIS A 113 -19.229 -26.454 68.266 1.00 24.27 C ATOM 627 NE2 HIS A 113 -19.325 -27.650 67.719 1.00 23.84 N ATOM 628 N ALA A 114 -24.170 -25.559 70.548 1.00 29.91 N ATOM 629 CA ALA A 114 -24.041 -24.813 71.795 1.00 29.44 C ATOM 630 C ALA A 114 -24.920 -25.457 72.851 1.00 29.71 C ATOM 631 O ALA A 114 -25.353 -24.817 73.806 1.00 27.99 O ATOM 632 CB ALA A 114 -24.439 -23.366 71.591 1.00 28.79 C