>>3AZJ:HELIX   15  15 SER D   55  ASN D   84  1                                  30    
SSKAMGIMNSFVNDIFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 15 15 SER D 55 ASN D 84 1 30 ATOM 2428 N SER D 55 7.916 -7.050 43.293 1.00 25.78 N ATOM 2429 CA SER D 55 8.660 -8.282 43.102 1.00 24.50 C ATOM 2430 C SER D 55 7.985 -9.033 41.971 1.00 25.33 C ATOM 2431 O SER D 55 6.819 -8.803 41.669 1.00 27.47 O ATOM 2432 CB SER D 55 8.587 -9.143 44.342 1.00 25.47 C ATOM 2433 OG SER D 55 7.319 -9.768 44.418 1.00 27.27 O ATOM 2434 N SER D 56 8.705 -9.955 41.360 1.00 23.80 N ATOM 2435 CA SER D 56 8.153 -10.702 40.262 1.00 21.83 C ATOM 2436 C SER D 56 7.006 -11.590 40.729 1.00 23.72 C ATOM 2437 O SER D 56 6.085 -11.894 39.963 1.00 21.60 O ATOM 2438 CB SER D 56 9.245 -11.539 39.614 1.00 18.82 C ATOM 2439 OG SER D 56 9.153 -12.870 40.041 1.00 20.22 O ATOM 2440 N LYS D 57 7.055 -11.985 41.996 1.00 25.84 N ATOM 2441 CA LYS D 57 6.027 -12.855 42.541 1.00 29.06 C ATOM 2442 C LYS D 57 4.697 -12.110 42.724 1.00 28.33 C ATOM 2443 O LYS D 57 3.630 -12.710 42.666 1.00 27.95 O ATOM 2444 CB LYS D 57 6.523 -13.466 43.856 1.00 35.15 C ATOM 2445 CG LYS D 57 6.041 -14.893 44.093 1.00 41.47 C ATOM 2446 CD LYS D 57 6.441 -15.450 45.487 1.00 47.09 C ATOM 2447 CE LYS D 57 7.954 -15.669 45.641 1.00 48.01 C ATOM 2448 NZ LYS D 57 8.568 -16.474 44.548 1.00 49.87 N ATOM 2449 N ALA D 58 4.765 -10.798 42.931 1.00 27.23 N ATOM 2450 CA ALA D 58 3.563 -9.981 43.071 1.00 23.23 C ATOM 2451 C ALA D 58 3.011 -9.671 41.679 1.00 21.52 C ATOM 2452 O ALA D 58 1.805 -9.577 41.475 1.00 24.11 O ATOM 2453 CB ALA D 58 3.884 -8.716 43.796 1.00 23.70 C ATOM 2454 N MET D 59 3.900 -9.510 40.712 1.00 22.35 N ATOM 2455 CA MET D 59 3.458 -9.273 39.352 1.00 22.17 C ATOM 2456 C MET D 59 2.742 -10.562 38.963 1.00 24.57 C ATOM 2457 O MET D 59 1.759 -10.542 38.214 1.00 25.45 O ATOM 2458 CB MET D 59 4.655 -9.038 38.441 1.00 21.60 C ATOM 2459 CG MET D 59 4.272 -8.682 37.028 1.00 22.08 C ATOM 2460 SD MET D 59 3.204 -7.235 37.016 1.00 36.00 S ATOM 2461 CE MET D 59 4.446 -5.865 37.011 1.00 19.90 C ATOM 2462 N GLY D 60 3.244 -11.686 39.478 1.00 21.21 N ATOM 2463 CA GLY D 60 2.604 -12.955 39.203 1.00 22.02 C ATOM 2464 C GLY D 60 1.128 -12.823 39.546 1.00 24.28 C ATOM 2465 O GLY D 60 0.252 -13.006 38.694 1.00 23.59 O ATOM 2466 N ILE D 61 0.861 -12.490 40.807 1.00 21.21 N ATOM 2467 CA ILE D 61 -0.491 -12.281 41.293 1.00 19.36 C ATOM 2468 C ILE D 61 -1.243 -11.221 40.478 1.00 20.35 C ATOM 2469 O ILE D 61 -2.372 -11.464 40.042 1.00 16.28 O ATOM 2470 CB ILE D 61 -0.456 -11.858 42.755 1.00 22.54 C ATOM 2471 CG1 ILE D 61 0.026 -13.040 43.584 1.00 20.70 C ATOM 2472 CG2 ILE D 61 -1.843 -11.371 43.222 1.00 14.78 C ATOM 2473 CD1 ILE D 61 0.416 -12.637 44.946 1.00 26.08 C ATOM 2474 N MET D 62 -0.643 -10.048 40.272 1.00 19.00 N ATOM 2475 CA MET D 62 -1.330 -9.040 39.479 1.00 22.15 C ATOM 2476 C MET D 62 -1.781 -9.567 38.116 1.00 23.87 C ATOM 2477 O MET D 62 -2.822 -9.154 37.598 1.00 23.36 O ATOM 2478 CB MET D 62 -0.467 -7.805 39.273 1.00 19.54 C ATOM 2479 CG MET D 62 -0.310 -6.947 40.511 1.00 22.40 C ATOM 2480 SD MET D 62 -1.846 -6.560 41.307 1.00 26.69 S ATOM 2481 CE MET D 62 -2.514 -5.463 40.199 1.00 12.97 C ATOM 2482 N ASN D 63 -1.022 -10.485 37.530 1.00 24.99 N ATOM 2483 CA ASN D 63 -1.417 -11.006 36.229 1.00 26.50 C ATOM 2484 C ASN D 63 -2.607 -11.921 36.344 1.00 26.73 C ATOM 2485 O ASN D 63 -3.497 -11.923 35.490 1.00 27.61 O ATOM 2486 CB ASN D 63 -0.278 -11.756 35.572 1.00 27.32 C ATOM 2487 CG ASN D 63 0.112 -11.130 34.289 1.00 31.76 C ATOM 2488 OD1 ASN D 63 0.730 -10.070 34.293 1.00 35.66 O ATOM 2489 ND2 ASN D 63 -0.273 -11.749 33.167 1.00 35.70 N ATOM 2490 N SER D 64 -2.611 -12.708 37.410 1.00 24.00 N ATOM 2491 CA SER D 64 -3.703 -13.616 37.648 1.00 23.87 C ATOM 2492 C SER D 64 -4.949 -12.780 37.861 1.00 23.41 C ATOM 2493 O SER D 64 -6.022 -13.126 37.366 1.00 25.12 O ATOM 2494 CB SER D 64 -3.425 -14.481 38.877 1.00 24.50 C ATOM 2495 OG SER D 64 -2.206 -15.184 38.725 1.00 29.66 O ATOM 2496 N PHE D 65 -4.799 -11.669 38.581 1.00 23.35 N ATOM 2497 CA PHE D 65 -5.930 -10.787 38.855 1.00 21.18 C ATOM 2498 C PHE D 65 -6.571 -10.284 37.569 1.00 21.12 C ATOM 2499 O PHE D 65 -7.790 -10.403 37.397 1.00 19.48 O ATOM 2500 CB PHE D 65 -5.506 -9.584 39.699 1.00 19.20 C ATOM 2501 CG PHE D 65 -6.619 -8.589 39.932 1.00 20.58 C ATOM 2502 CD1 PHE D 65 -7.755 -8.947 40.662 1.00 19.51 C ATOM 2503 CD2 PHE D 65 -6.548 -7.303 39.395 1.00 19.25 C ATOM 2504 CE1 PHE D 65 -8.799 -8.048 40.848 1.00 16.76 C ATOM 2505 CE2 PHE D 65 -7.590 -6.400 39.577 1.00 18.51 C ATOM 2506 CZ PHE D 65 -8.719 -6.776 40.305 1.00 19.01 C ATOM 2507 N VAL D 66 -5.751 -9.733 36.672 1.00 18.54 N ATOM 2508 CA VAL D 66 -6.257 -9.208 35.415 1.00 16.63 C ATOM 2509 C VAL D 66 -6.969 -10.271 34.595 1.00 17.25 C ATOM 2510 O VAL D 66 -8.115 -10.064 34.155 1.00 14.94 O ATOM 2511 CB VAL D 66 -5.140 -8.575 34.575 1.00 15.16 C ATOM 2512 CG1 VAL D 66 -5.653 -8.230 33.197 1.00 15.78 C ATOM 2513 CG2 VAL D 66 -4.673 -7.302 35.235 1.00 18.23 C ATOM 2514 N ASN D 67 -6.318 -11.414 34.398 1.00 17.99 N ATOM 2515 CA ASN D 67 -6.953 -12.477 33.618 1.00 21.12 C ATOM 2516 C ASN D 67 -8.270 -12.933 34.232 1.00 21.89 C ATOM 2517 O ASN D 67 -9.235 -13.223 33.524 1.00 20.03 O ATOM 2518 CB ASN D 67 -5.990 -13.642 33.434 1.00 19.55 C ATOM 2519 CG ASN D 67 -4.885 -13.297 32.459 1.00 26.40 C ATOM 2520 OD1 ASN D 67 -5.156 -12.826 31.347 1.00 31.93 O ATOM 2521 ND2 ASN D 67 -3.639 -13.501 32.866 1.00 26.19 N ATOM 2522 N ASP D 68 -8.313 -12.944 35.557 1.00 22.98 N ATOM 2523 CA ASP D 68 -9.503 -13.330 36.269 1.00 22.06 C ATOM 2524 C ASP D 68 -10.654 -12.373 36.002 1.00 22.71 C ATOM 2525 O ASP D 68 -11.666 -12.784 35.437 1.00 24.13 O ATOM 2526 CB ASP D 68 -9.222 -13.414 37.766 1.00 21.09 C ATOM 2527 CG ASP D 68 -10.375 -14.037 38.537 1.00 23.63 C ATOM 2528 OD1 ASP D 68 -11.357 -14.486 37.898 1.00 27.29 O ATOM 2529 OD2 ASP D 68 -10.302 -14.080 39.781 1.00 26.60 O ATOM 2530 N ILE D 69 -10.514 -11.106 36.393 1.00 21.25 N ATOM 2531 CA ILE D 69 -11.591 -10.147 36.158 1.00 20.69 C ATOM 2532 C ILE D 69 -11.945 -10.091 34.665 1.00 23.58 C ATOM 2533 O ILE D 69 -13.117 -9.922 34.308 1.00 22.55 O ATOM 2534 CB ILE D 69 -11.246 -8.710 36.699 1.00 17.61 C ATOM 2535 CG1 ILE D 69 -11.499 -8.626 38.202 1.00 12.50 C ATOM 2536 CG2 ILE D 69 -12.195 -7.681 36.110 1.00 15.99 C ATOM 2537 CD1 ILE D 69 -10.979 -9.780 38.958 1.00 20.62 C ATOM 2538 N PHE D 70 -10.948 -10.250 33.794 1.00 23.35 N ATOM 2539 CA PHE D 70 -11.206 -10.252 32.353 1.00 25.55 C ATOM 2540 C PHE D 70 -12.173 -11.377 31.976 1.00 28.40 C ATOM 2541 O PHE D 70 -13.081 -11.188 31.158 1.00 27.91 O ATOM 2542 CB PHE D 70 -9.914 -10.468 31.566 1.00 25.63 C ATOM 2543 CG PHE D 70 -10.121 -10.521 30.085 1.00 27.66 C ATOM 2544 CD1 PHE D 70 -9.895 -9.410 29.299 1.00 32.01 C ATOM 2545 CD2 PHE D 70 -10.595 -11.673 29.477 1.00 32.47 C ATOM 2546 CE1 PHE D 70 -10.139 -9.443 27.924 1.00 32.03 C ATOM 2547 CE2 PHE D 70 -10.846 -11.716 28.112 1.00 32.67 C ATOM 2548 CZ PHE D 70 -10.616 -10.595 27.335 1.00 33.48 C ATOM 2549 N GLU D 71 -11.946 -12.559 32.554 1.00 28.69 N ATOM 2550 CA GLU D 71 -12.755 -13.737 32.274 1.00 28.38 C ATOM 2551 C GLU D 71 -14.158 -13.589 32.846 1.00 26.56 C ATOM 2552 O GLU D 71 -15.145 -13.965 32.208 1.00 25.17 O ATOM 2553 CB GLU D 71 -12.081 -14.983 32.864 1.00 40.51 C ATOM 2554 CG GLU D 71 -11.903 -16.174 31.906 1.00 52.12 C ATOM 2555 CD GLU D 71 -13.207 -16.595 31.213 1.00 61.62 C ATOM 2556 OE1 GLU D 71 -14.242 -16.773 31.906 1.00 64.26 O ATOM 2557 OE2 GLU D 71 -13.191 -16.754 29.969 1.00 63.70 O ATOM 2558 N ARG D 72 -14.251 -13.030 34.047 1.00 23.46 N ATOM 2559 CA ARG D 72 -15.542 -12.845 34.686 1.00 22.49 C ATOM 2560 C ARG D 72 -16.432 -11.884 33.912 1.00 26.95 C ATOM 2561 O ARG D 72 -17.627 -12.144 33.715 1.00 30.12 O ATOM 2562 CB ARG D 72 -15.355 -12.299 36.083 1.00 20.19 C ATOM 2563 CG ARG D 72 -14.523 -13.180 36.970 1.00 20.03 C ATOM 2564 CD ARG D 72 -14.768 -12.818 38.388 1.00 13.75 C ATOM 2565 NE ARG D 72 -13.695 -13.275 39.236 1.00 15.23 N ATOM 2566 CZ ARG D 72 -13.576 -12.919 40.506 1.00 17.20 C ATOM 2567 NH1 ARG D 72 -14.477 -12.113 41.036 1.00 16.76 N ATOM 2568 NH2 ARG D 72 -12.548 -13.340 41.233 1.00 16.39 N ATOM 2569 N ILE D 73 -15.846 -10.771 33.482 1.00 25.42 N ATOM 2570 CA ILE D 73 -16.578 -9.756 32.737 1.00 22.66 C ATOM 2571 C ILE D 73 -16.972 -10.244 31.345 1.00 22.87 C ATOM 2572 O ILE D 73 -18.153 -10.172 30.963 1.00 18.64 O ATOM 2573 CB ILE D 73 -15.753 -8.447 32.669 1.00 19.95 C ATOM 2574 CG1 ILE D 73 -15.596 -7.906 34.103 1.00 15.21 C ATOM 2575 CG2 ILE D 73 -16.432 -7.441 31.767 1.00 16.51 C ATOM 2576 CD1 ILE D 73 -14.830 -6.647 34.243 1.00 15.46 C ATOM 2577 N ALA D 74 -16.000 -10.763 30.600 1.00 22.04 N ATOM 2578 CA ALA D 74 -16.285 -11.277 29.266 1.00 24.28 C ATOM 2579 C ALA D 74 -17.340 -12.349 29.429 1.00 26.11 C ATOM 2580 O ALA D 74 -18.279 -12.448 28.648 1.00 27.15 O ATOM 2581 CB ALA D 74 -15.040 -11.878 28.659 1.00 24.58 C ATOM 2582 N GLY D 75 -17.172 -13.155 30.469 1.00 25.42 N ATOM 2583 CA GLY D 75 -18.115 -14.216 30.717 1.00 24.01 C ATOM 2584 C GLY D 75 -19.515 -13.678 30.908 1.00 25.04 C ATOM 2585 O GLY D 75 -20.439 -14.089 30.221 1.00 22.39 O ATOM 2586 N GLU D 76 -19.678 -12.757 31.848 1.00 27.88 N ATOM 2587 CA GLU D 76 -20.992 -12.203 32.103 1.00 28.88 C ATOM 2588 C GLU D 76 -21.444 -11.501 30.838 1.00 28.96 C ATOM 2589 O GLU D 76 -22.605 -11.587 30.462 1.00 31.51 O ATOM 2590 CB GLU D 76 -20.941 -11.221 33.274 1.00 31.31 C ATOM 2591 CG GLU D 76 -22.300 -10.879 33.858 1.00 33.83 C ATOM 2592 CD GLU D 76 -22.915 -12.066 34.583 1.00 43.00 C ATOM 2593 OE1 GLU D 76 -23.999 -12.521 34.139 1.00 41.59 O ATOM 2594 OE2 GLU D 76 -22.311 -12.540 35.592 1.00 40.55 O ATOM 2595 N ALA D 77 -20.525 -10.819 30.165 1.00 26.84 N ATOM 2596 CA ALA D 77 -20.876 -10.129 28.928 1.00 28.64 C ATOM 2597 C ALA D 77 -21.430 -11.119 27.930 1.00 28.98 C ATOM 2598 O ALA D 77 -22.489 -10.919 27.346 1.00 28.82 O ATOM 2599 CB ALA D 77 -19.663 -9.463 28.332 1.00 31.07 C ATOM 2600 N SER D 78 -20.688 -12.195 27.733 1.00 31.06 N ATOM 2601 CA SER D 78 -21.077 -13.234 26.798 1.00 29.44 C ATOM 2602 C SER D 78 -22.504 -13.734 26.989 1.00 28.30 C ATOM 2603 O SER D 78 -23.259 -13.877 26.027 1.00 28.30 O ATOM 2604 CB SER D 78 -20.123 -14.399 26.926 1.00 22.89 C ATOM 2605 OG SER D 78 -20.667 -15.499 26.253 1.00 23.87 O ATOM 2606 N ARG D 79 -22.841 -13.971 28.251 1.00 27.42 N ATOM 2607 CA ARG D 79 -24.131 -14.484 28.710 1.00 27.16 C ATOM 2608 C ARG D 79 -25.259 -13.483 28.540 1.00 26.06 C ATOM 2609 O ARG D 79 -26.356 -13.817 28.085 1.00 21.49 O ATOM 2610 CB ARG D 79 -24.006 -14.843 30.189 1.00 29.79 C ATOM 2611 CG ARG D 79 -24.589 -16.166 30.572 1.00 32.71 C ATOM 2612 CD ARG D 79 -24.197 -16.528 31.983 1.00 34.93 C ATOM 2613 NE ARG D 79 -22.749 -16.664 32.113 1.00 39.79 N ATOM 2614 CZ ARG D 79 -22.025 -15.985 32.999 1.00 38.78 C ATOM 2615 NH1 ARG D 79 -22.630 -15.125 33.822 1.00 35.61 N ATOM 2616 NH2 ARG D 79 -20.711 -16.179 33.076 1.00 31.00 N ATOM 2617 N LEU D 80 -24.988 -12.254 28.950 1.00 25.46 N ATOM 2618 CA LEU D 80 -25.966 -11.193 28.825 1.00 27.46 C ATOM 2619 C LEU D 80 -26.372 -11.145 27.351 1.00 28.00 C ATOM 2620 O LEU D 80 -27.551 -11.080 27.005 1.00 25.28 O ATOM 2621 CB LEU D 80 -25.339 -9.859 29.255 1.00 25.20 C ATOM 2622 CG LEU D 80 -26.305 -8.829 29.843 1.00 29.46 C ATOM 2623 CD1 LEU D 80 -27.312 -9.534 30.726 1.00 29.16 C ATOM 2624 CD2 LEU D 80 -25.541 -7.802 30.660 1.00 32.42 C ATOM 2625 N ALA D 81 -25.374 -11.209 26.485 1.00 27.34 N ATOM 2626 CA ALA D 81 -25.620 -11.162 25.068 1.00 30.62 C ATOM 2627 C ALA D 81 -26.477 -12.336 24.619 1.00 34.27 C ATOM 2628 O ALA D 81 -27.391 -12.188 23.794 1.00 33.77 O ATOM 2629 CB ALA D 81 -24.302 -11.162 24.325 1.00 30.80 C ATOM 2630 N HIS D 82 -26.192 -13.508 25.167 1.00 36.30 N ATOM 2631 CA HIS D 82 -26.926 -14.674 24.752 1.00 37.73 C ATOM 2632 C HIS D 82 -28.367 -14.559 25.182 1.00 38.66 C ATOM 2633 O HIS D 82 -29.266 -14.846 24.404 1.00 38.67 O ATOM 2634 CB HIS D 82 -26.272 -15.921 25.308 1.00 42.84 C ATOM 2635 CG HIS D 82 -26.870 -17.196 24.805 1.00 52.30 C ATOM 2636 ND1 HIS D 82 -27.456 -18.126 25.642 1.00 55.43 N ATOM 2637 CD2 HIS D 82 -26.966 -17.703 23.554 1.00 56.54 C ATOM 2638 CE1 HIS D 82 -27.887 -19.149 24.927 1.00 56.86 C ATOM 2639 NE2 HIS D 82 -27.603 -18.918 23.656 1.00 59.09 N ATOM 2640 N TYR D 83 -28.596 -14.106 26.408 1.00 41.71 N ATOM 2641 CA TYR D 83 -29.964 -13.965 26.914 1.00 42.27 C ATOM 2642 C TYR D 83 -30.809 -13.053 26.048 1.00 40.85 C ATOM 2643 O TYR D 83 -32.019 -13.201 25.977 1.00 38.68 O ATOM 2644 CB TYR D 83 -29.977 -13.400 28.333 1.00 43.29 C ATOM 2645 CG TYR D 83 -29.216 -14.210 29.343 1.00 50.36 C ATOM 2646 CD1 TYR D 83 -28.761 -15.495 29.053 1.00 52.55 C ATOM 2647 CD2 TYR D 83 -28.974 -13.701 30.613 1.00 54.01 C ATOM 2648 CE1 TYR D 83 -28.084 -16.244 30.010 1.00 53.47 C ATOM 2649 CE2 TYR D 83 -28.303 -14.443 31.569 1.00 52.43 C ATOM 2650 CZ TYR D 83 -27.862 -15.705 31.266 1.00 50.64 C ATOM 2651 OH TYR D 83 -27.194 -16.421 32.231 1.00 55.91 O ATOM 2652 N ASN D 84 -30.178 -12.094 25.395 1.00 40.77 N ATOM 2653 CA ASN D 84 -30.941 -11.181 24.570 1.00 41.15 C ATOM 2654 C ASN D 84 -30.824 -11.469 23.090 1.00 40.48 C ATOM 2655 O ASN D 84 -30.939 -10.583 22.253 1.00 39.50 O ATOM 2656 CB ASN D 84 -30.535 -9.757 24.903 1.00 37.10 C ATOM 2657 CG ASN D 84 -30.963 -9.384 26.267 1.00 34.63 C ATOM 2658 OD1 ASN D 84 -32.138 -9.162 26.511 1.00 38.32 O ATOM 2659 ND2 ASN D 84 -30.028 -9.354 27.188 1.00 37.84 N