>>3AZN:HELIX    3   3 GLN A   85  ALA A  114  1                                  30    
QSSAVMALQEACEAYLVGLFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 3 3 GLN A 85 ALA A 114 1 30 ATOM 412 N GLN A 85 -43.673 -9.969 36.665 1.00 40.79 N ATOM 413 CA GLN A 85 -44.307 -11.112 36.043 1.00 32.82 C ATOM 414 C GLN A 85 -44.833 -11.977 37.204 1.00 44.62 C ATOM 415 O GLN A 85 -44.137 -12.199 38.206 1.00 41.58 O ATOM 416 CB GLN A 85 -43.262 -11.863 35.213 1.00 13.23 C ATOM 417 CG GLN A 85 -43.806 -12.878 34.242 1.00 37.10 C ATOM 418 CD GLN A 85 -42.779 -13.276 33.195 1.00 32.10 C ATOM 419 OE1 GLN A 85 -41.783 -13.924 33.504 1.00 52.21 O ATOM 420 NE2 GLN A 85 -43.014 -12.877 31.949 1.00 33.04 N ATOM 421 N SER A 86 -46.076 -12.428 37.084 1.00 50.82 N ATOM 422 CA SER A 86 -46.696 -13.255 38.112 1.00 46.14 C ATOM 423 C SER A 86 -45.741 -14.323 38.622 1.00 43.39 C ATOM 424 O SER A 86 -45.560 -14.493 39.825 1.00 44.27 O ATOM 425 CB SER A 86 -47.940 -13.929 37.546 1.00 39.51 C ATOM 426 OG SER A 86 -48.429 -14.898 38.451 1.00 51.05 O ATOM 427 N SER A 87 -45.135 -15.039 37.680 1.00 53.72 N ATOM 428 CA SER A 87 -44.195 -16.116 37.973 1.00 39.14 C ATOM 429 C SER A 87 -42.911 -15.662 38.656 1.00 45.79 C ATOM 430 O SER A 87 -42.403 -16.347 39.538 1.00 39.51 O ATOM 431 CB SER A 87 -43.855 -16.856 36.674 1.00 34.35 C ATOM 432 OG SER A 87 -43.608 -15.941 35.615 1.00 43.97 O ATOM 433 N ALA A 88 -42.383 -14.514 38.237 1.00 47.54 N ATOM 434 CA ALA A 88 -41.155 -13.983 38.814 1.00 39.79 C ATOM 435 C ALA A 88 -41.284 -13.808 40.326 1.00 46.05 C ATOM 436 O ALA A 88 -40.346 -14.095 41.077 1.00 45.45 O ATOM 437 CB ALA A 88 -40.806 -12.661 38.164 1.00 41.60 C ATOM 438 N VAL A 89 -42.441 -13.340 40.777 1.00 31.51 N ATOM 439 CA VAL A 89 -42.649 -13.158 42.206 1.00 29.43 C ATOM 440 C VAL A 89 -42.656 -14.497 42.922 1.00 38.12 C ATOM 441 O VAL A 89 -42.041 -14.643 43.985 1.00 36.72 O ATOM 442 CB VAL A 89 -43.970 -12.445 42.505 1.00 35.64 C ATOM 443 CG1 VAL A 89 -44.204 -12.398 44.015 1.00 38.39 C ATOM 444 CG2 VAL A 89 -43.937 -11.043 41.926 1.00 24.36 C ATOM 445 N MET A 90 -43.361 -15.469 42.346 1.00 34.40 N ATOM 446 CA MET A 90 -43.425 -16.802 42.937 1.00 37.55 C ATOM 447 C MET A 90 -42.036 -17.416 43.035 1.00 27.92 C ATOM 448 O MET A 90 -41.698 -18.036 44.040 1.00 35.23 O ATOM 449 CB MET A 90 -44.347 -17.711 42.122 1.00 53.67 C ATOM 450 CG MET A 90 -45.822 -17.466 42.381 1.00 56.33 C ATOM 451 SD MET A 90 -46.187 -17.458 44.164 1.00 81.98 S ATOM 452 CE MET A 90 -46.130 -15.652 44.519 1.00 78.18 C ATOM 453 N ALA A 91 -41.233 -17.234 41.989 1.00 42.47 N ATOM 454 CA ALA A 91 -39.865 -17.746 41.967 1.00 32.49 C ATOM 455 C ALA A 91 -39.125 -17.202 43.181 1.00 33.62 C ATOM 456 O ALA A 91 -38.526 -17.968 43.927 1.00 38.21 O ATOM 457 CB ALA A 91 -39.162 -17.318 40.691 1.00 27.32 C ATOM 458 N LEU A 92 -39.174 -15.885 43.383 1.00 24.61 N ATOM 459 CA LEU A 92 -38.516 -15.267 44.535 1.00 27.01 C ATOM 460 C LEU A 92 -38.997 -15.860 45.861 1.00 30.61 C ATOM 461 O LEU A 92 -38.194 -16.198 46.725 1.00 35.80 O ATOM 462 CB LEU A 92 -38.769 -13.760 44.563 1.00 31.15 C ATOM 463 CG LEU A 92 -38.040 -12.853 43.575 1.00 34.93 C ATOM 464 CD1 LEU A 92 -38.594 -11.457 43.682 1.00 26.17 C ATOM 465 CD2 LEU A 92 -36.558 -12.852 43.876 1.00 33.84 C ATOM 466 N GLN A 93 -40.308 -15.983 46.036 1.00 40.64 N ATOM 467 CA GLN A 93 -40.810 -16.533 47.285 1.00 40.53 C ATOM 468 C GLN A 93 -40.306 -17.955 47.473 1.00 41.99 C ATOM 469 O GLN A 93 -39.976 -18.361 48.582 1.00 37.83 O ATOM 470 CB GLN A 93 -42.335 -16.510 47.331 1.00 32.56 C ATOM 471 CG GLN A 93 -42.838 -16.320 48.747 1.00 37.67 C ATOM 472 CD GLN A 93 -44.338 -16.358 48.863 1.00 43.15 C ATOM 473 OE1 GLN A 93 -45.053 -15.820 48.016 1.00 51.88 O ATOM 474 NE2 GLN A 93 -44.831 -16.980 49.931 1.00 16.42 N ATOM 475 N GLU A 94 -40.244 -18.712 46.385 1.00 29.03 N ATOM 476 CA GLU A 94 -39.753 -20.075 46.458 1.00 33.97 C ATOM 477 C GLU A 94 -38.290 -20.066 46.905 1.00 33.85 C ATOM 478 O GLU A 94 -37.919 -20.719 47.877 1.00 32.34 O ATOM 479 CB GLU A 94 -39.858 -20.736 45.092 1.00 39.75 C ATOM 480 CG GLU A 94 -41.248 -21.162 44.693 1.00 54.31 C ATOM 481 CD GLU A 94 -41.747 -22.330 45.508 1.00 55.39 C ATOM 482 OE1 GLU A 94 -40.936 -23.239 45.801 1.00 48.02 O ATOM 483 OE2 GLU A 94 -42.953 -22.339 45.840 1.00 63.40 O ATOM 484 N ALA A 95 -37.471 -19.317 46.173 1.00 31.28 N ATOM 485 CA ALA A 95 -36.044 -19.192 46.442 1.00 37.10 C ATOM 486 C ALA A 95 -35.824 -18.717 47.863 1.00 30.87 C ATOM 487 O ALA A 95 -35.028 -19.269 48.624 1.00 27.78 O ATOM 488 CB ALA A 95 -35.412 -18.188 45.457 1.00 21.95 C ATOM 489 N CYS A 96 -36.543 -17.667 48.199 1.00 23.83 N ATOM 490 CA CYS A 96 -36.457 -17.062 49.504 1.00 43.82 C ATOM 491 C CYS A 96 -36.838 -18.009 50.668 1.00 39.48 C ATOM 492 O CYS A 96 -36.073 -18.180 51.623 1.00 26.42 O ATOM 493 CB CYS A 96 -37.330 -15.809 49.492 1.00 19.55 C ATOM 494 SG CYS A 96 -37.201 -14.843 50.952 1.00 57.21 S ATOM 495 N GLU A 97 -38.009 -18.632 50.597 1.00 37.61 N ATOM 496 CA GLU A 97 -38.421 -19.533 51.669 1.00 36.98 C ATOM 497 C GLU A 97 -37.527 -20.760 51.777 1.00 27.76 C ATOM 498 O GLU A 97 -37.393 -21.354 52.844 1.00 21.50 O ATOM 499 CB GLU A 97 -39.869 -19.966 51.485 1.00 44.71 C ATOM 500 CG GLU A 97 -40.874 -18.956 51.991 1.00 41.48 C ATOM 501 CD GLU A 97 -42.270 -19.522 52.010 1.00 55.50 C ATOM 502 OE1 GLU A 97 -42.442 -20.622 52.576 1.00 70.52 O ATOM 503 OE2 GLU A 97 -43.189 -18.877 51.462 1.00 60.63 O ATOM 504 N ALA A 98 -36.926 -21.151 50.667 1.00 19.43 N ATOM 505 CA ALA A 98 -36.029 -22.287 50.688 1.00 25.09 C ATOM 506 C ALA A 98 -34.799 -21.839 51.486 1.00 31.04 C ATOM 507 O ALA A 98 -34.400 -22.471 52.459 1.00 38.34 O ATOM 508 CB ALA A 98 -35.642 -22.666 49.265 1.00 15.25 C ATOM 509 N TYR A 99 -34.222 -20.719 51.068 1.00 43.74 N ATOM 510 CA TYR A 99 -33.054 -20.146 51.715 1.00 23.28 C ATOM 511 C TYR A 99 -33.221 -20.115 53.225 1.00 31.88 C ATOM 512 O TYR A 99 -32.375 -20.636 53.955 1.00 54.12 O ATOM 513 CB TYR A 99 -32.811 -18.720 51.200 1.00 13.53 C ATOM 514 CG TYR A 99 -31.766 -17.969 51.988 1.00 23.30 C ATOM 515 CD1 TYR A 99 -30.411 -18.285 51.868 1.00 32.00 C ATOM 516 CD2 TYR A 99 -32.134 -16.998 52.912 1.00 14.83 C ATOM 517 CE1 TYR A 99 -29.448 -17.652 52.656 1.00 20.82 C ATOM 518 CE2 TYR A 99 -31.185 -16.365 53.705 1.00 33.12 C ATOM 519 CZ TYR A 99 -29.847 -16.699 53.574 1.00 35.02 C ATOM 520 OH TYR A 99 -28.918 -16.104 54.387 1.00 32.99 O ATOM 521 N LEU A 100 -34.306 -19.506 53.696 1.00 25.54 N ATOM 522 CA LEU A 100 -34.527 -19.402 55.134 1.00 31.38 C ATOM 523 C LEU A 100 -34.613 -20.763 55.801 1.00 32.05 C ATOM 524 O LEU A 100 -33.935 -21.003 56.798 1.00 34.74 O ATOM 525 CB LEU A 100 -35.786 -18.591 55.424 1.00 12.71 C ATOM 526 CG LEU A 100 -35.686 -17.121 55.026 1.00 33.61 C ATOM 527 CD1 LEU A 100 -37.057 -16.451 55.054 1.00 32.43 C ATOM 528 CD2 LEU A 100 -34.723 -16.434 55.967 1.00 24.71 C ATOM 529 N VAL A 101 -35.435 -21.658 55.253 1.00 28.21 N ATOM 530 CA VAL A 101 -35.580 -22.995 55.825 1.00 25.89 C ATOM 531 C VAL A 101 -34.217 -23.664 55.935 1.00 27.70 C ATOM 532 O VAL A 101 -33.934 -24.395 56.893 1.00 16.21 O ATOM 533 CB VAL A 101 -36.477 -23.887 54.963 1.00 13.45 C ATOM 534 CG1 VAL A 101 -36.537 -25.293 55.560 1.00 10.86 C ATOM 535 CG2 VAL A 101 -37.871 -23.281 54.875 1.00 25.89 C ATOM 536 N GLY A 102 -33.375 -23.401 54.943 1.00 14.83 N ATOM 537 CA GLY A 102 -32.047 -23.969 54.936 1.00 16.17 C ATOM 538 C GLY A 102 -31.214 -23.361 56.038 1.00 19.77 C ATOM 539 O GLY A 102 -30.482 -24.069 56.735 1.00 15.17 O ATOM 540 N LEU A 103 -31.336 -22.046 56.197 1.00 27.58 N ATOM 541 CA LEU A 103 -30.597 -21.321 57.220 1.00 21.10 C ATOM 542 C LEU A 103 -31.081 -21.699 58.615 1.00 25.42 C ATOM 543 O LEU A 103 -30.294 -21.734 59.561 1.00 31.20 O ATOM 544 CB LEU A 103 -30.739 -19.812 57.007 1.00 28.85 C ATOM 545 CG LEU A 103 -30.019 -18.907 58.010 1.00 19.80 C ATOM 546 CD1 LEU A 103 -28.536 -19.223 57.987 1.00 15.93 C ATOM 547 CD2 LEU A 103 -30.274 -17.440 57.677 1.00 11.92 C ATOM 548 N PHE A 104 -32.373 -21.984 58.759 1.00 27.68 N ATOM 549 CA PHE A 104 -32.869 -22.367 60.073 1.00 29.76 C ATOM 550 C PHE A 104 -32.292 -23.727 60.428 1.00 34.15 C ATOM 551 O PHE A 104 -32.149 -24.058 61.594 1.00 47.05 O ATOM 552 CB PHE A 104 -34.399 -22.398 60.110 1.00 19.89 C ATOM 553 CG PHE A 104 -35.019 -21.071 60.447 1.00 18.79 C ATOM 554 CD1 PHE A 104 -34.625 -20.374 61.585 1.00 31.59 C ATOM 555 CD2 PHE A 104 -35.978 -20.501 59.621 1.00 30.55 C ATOM 556 CE1 PHE A 104 -35.173 -19.124 61.896 1.00 20.94 C ATOM 557 CE2 PHE A 104 -36.533 -19.248 59.929 1.00 28.67 C ATOM 558 CZ PHE A 104 -36.122 -18.566 61.069 1.00 19.77 C ATOM 559 N GLU A 105 -31.942 -24.511 59.418 1.00 31.55 N ATOM 560 CA GLU A 105 -31.354 -25.814 59.668 1.00 27.50 C ATOM 561 C GLU A 105 -29.967 -25.672 60.281 1.00 44.21 C ATOM 562 O GLU A 105 -29.719 -26.155 61.388 1.00 50.62 O ATOM 563 CB GLU A 105 -31.254 -26.602 58.375 1.00 40.81 C ATOM 564 CG GLU A 105 -32.551 -27.237 57.946 1.00 57.53 C ATOM 565 CD GLU A 105 -32.418 -27.940 56.620 1.00 68.87 C ATOM 566 OE1 GLU A 105 -31.451 -28.726 56.458 1.00 73.40 O ATOM 567 OE2 GLU A 105 -33.280 -27.704 55.744 1.00 61.23 O ATOM 568 N ASP A 106 -29.061 -25.015 59.563 1.00 37.80 N ATOM 569 CA ASP A 106 -27.707 -24.820 60.068 1.00 31.57 C ATOM 570 C ASP A 106 -27.711 -24.071 61.401 1.00 38.45 C ATOM 571 O ASP A 106 -26.820 -24.263 62.228 1.00 32.89 O ATOM 572 CB ASP A 106 -26.865 -24.050 59.059 1.00 25.79 C ATOM 573 CG ASP A 106 -26.746 -24.766 57.729 1.00 62.50 C ATOM 574 OD1 ASP A 106 -26.917 -26.013 57.697 1.00 68.68 O ATOM 575 OD2 ASP A 106 -26.463 -24.075 56.720 1.00 38.57 O ATOM 576 N THR A 107 -28.708 -23.211 61.604 1.00 31.58 N ATOM 577 CA THR A 107 -28.819 -22.456 62.852 1.00 39.39 C ATOM 578 C THR A 107 -29.106 -23.433 64.000 1.00 25.89 C ATOM 579 O THR A 107 -28.444 -23.418 65.036 1.00 27.25 O ATOM 580 CB THR A 107 -29.962 -21.381 62.770 1.00 45.83 C ATOM 581 OG1 THR A 107 -29.589 -20.343 61.853 1.00 37.45 O ATOM 582 CG2 THR A 107 -30.217 -20.747 64.133 1.00 33.60 C ATOM 583 N ASN A 108 -30.094 -24.292 63.796 1.00 31.47 N ATOM 584 CA ASN A 108 -30.468 -25.270 64.801 1.00 35.81 C ATOM 585 C ASN A 108 -29.257 -26.141 65.131 1.00 34.34 C ATOM 586 O ASN A 108 -29.033 -26.484 66.290 1.00 37.37 O ATOM 587 CB ASN A 108 -31.635 -26.118 64.287 1.00 29.84 C ATOM 588 CG ASN A 108 -32.352 -26.850 65.395 1.00 37.65 C ATOM 589 OD1 ASN A 108 -32.564 -26.300 66.473 1.00 42.41 O ATOM 590 ND2 ASN A 108 -32.747 -28.091 65.131 1.00 40.22 N ATOM 591 N LEU A 109 -28.473 -26.489 64.114 1.00 21.04 N ATOM 592 CA LEU A 109 -27.277 -27.292 64.335 1.00 29.73 C ATOM 593 C LEU A 109 -26.296 -26.593 65.270 1.00 35.25 C ATOM 594 O LEU A 109 -25.629 -27.245 66.081 1.00 37.69 O ATOM 595 CB LEU A 109 -26.572 -27.583 63.018 1.00 23.91 C ATOM 596 CG LEU A 109 -27.076 -28.798 62.258 1.00 17.94 C ATOM 597 CD1 LEU A 109 -26.236 -28.964 61.023 1.00 17.21 C ATOM 598 CD2 LEU A 109 -26.983 -30.035 63.125 1.00 17.51 C ATOM 599 N CYS A 110 -26.205 -25.272 65.133 1.00 25.67 N ATOM 600 CA CYS A 110 -25.325 -24.456 65.961 1.00 39.22 C ATOM 601 C CYS A 110 -25.810 -24.388 67.400 1.00 47.08 C ATOM 602 O CYS A 110 -25.032 -24.578 68.342 1.00 39.53 O ATOM 603 CB CYS A 110 -25.242 -23.035 65.412 1.00 29.51 C ATOM 604 SG CYS A 110 -24.280 -22.901 63.929 1.00 43.68 S ATOM 605 N ALA A 111 -27.100 -24.099 67.555 1.00 44.60 N ATOM 606 CA ALA A 111 -27.711 -23.997 68.872 1.00 45.25 C ATOM 607 C ALA A 111 -27.474 -25.286 69.647 1.00 38.47 C ATOM 608 O ALA A 111 -27.124 -25.266 70.831 1.00 30.39 O ATOM 609 CB ALA A 111 -29.199 -23.734 68.731 1.00 29.48 C ATOM 610 N ILE A 112 -27.653 -26.409 68.965 1.00 23.57 N ATOM 611 CA ILE A 112 -27.462 -27.701 69.592 1.00 34.78 C ATOM 612 C ILE A 112 -25.997 -27.868 69.951 1.00 35.24 C ATOM 613 O ILE A 112 -25.660 -28.308 71.043 1.00 41.22 O ATOM 614 CB ILE A 112 -27.915 -28.820 68.651 1.00 30.72 C ATOM 615 CG1 ILE A 112 -29.414 -28.683 68.399 1.00 10.86 C ATOM 616 CG2 ILE A 112 -27.612 -30.179 69.251 1.00 11.93 C ATOM 617 CD1 ILE A 112 -29.923 -29.610 67.320 1.00 31.87 C ATOM 618 N HIS A 113 -25.122 -27.494 69.033 1.00 41.06 N ATOM 619 CA HIS A 113 -23.695 -27.606 69.288 1.00 43.06 C ATOM 620 C HIS A 113 -23.334 -26.891 70.585 1.00 39.94 C ATOM 621 O HIS A 113 -22.345 -27.240 71.238 1.00 42.21 O ATOM 622 CB HIS A 113 -22.909 -27.005 68.122 1.00 35.34 C ATOM 623 CG HIS A 113 -21.427 -27.198 68.220 1.00 29.14 C ATOM 624 ND1 HIS A 113 -20.597 -26.289 68.839 1.00 27.88 N ATOM 625 CD2 HIS A 113 -20.621 -28.175 67.739 1.00 28.52 C ATOM 626 CE1 HIS A 113 -19.345 -26.691 68.728 1.00 17.44 C ATOM 627 NE2 HIS A 113 -19.332 -27.833 68.065 1.00 36.00 N ATOM 628 N ALA A 114 -24.143 -25.897 70.951 1.00 33.50 N ATOM 629 CA ALA A 114 -23.922 -25.113 72.163 1.00 17.76 C ATOM 630 C ALA A 114 -24.759 -25.675 73.302 1.00 30.87 C ATOM 631 O ALA A 114 -25.137 -24.959 74.239 1.00 26.72 O ATOM 632 CB ALA A 114 -24.275 -23.647 71.915 1.00 11.33 C