>>3AZN:HELIX   16  16 SER D   55  ASN D   84  1                                  30    
SSKAMGIMNSFVNDIFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 16 16 SER D 55 ASN D 84 1 30 ATOM 2470 N SER D 55 7.841 -7.394 43.517 1.00 27.72 N ATOM 2471 CA SER D 55 8.531 -8.673 43.334 1.00 25.12 C ATOM 2472 C SER D 55 7.862 -9.502 42.218 1.00 33.78 C ATOM 2473 O SER D 55 6.684 -9.313 41.912 1.00 33.96 O ATOM 2474 CB SER D 55 8.513 -9.464 44.637 1.00 22.37 C ATOM 2475 OG SER D 55 7.249 -10.073 44.848 1.00 42.92 O ATOM 2476 N SER D 56 8.602 -10.431 41.621 1.00 31.26 N ATOM 2477 CA SER D 56 8.049 -11.227 40.529 1.00 42.11 C ATOM 2478 C SER D 56 6.883 -12.101 40.994 1.00 38.29 C ATOM 2479 O SER D 56 5.972 -12.426 40.210 1.00 25.58 O ATOM 2480 CB SER D 56 9.144 -12.093 39.879 1.00 15.17 C ATOM 2481 OG SER D 56 9.299 -13.319 40.566 1.00 35.44 O ATOM 2482 N LYS D 57 6.909 -12.468 42.272 1.00 28.53 N ATOM 2483 CA LYS D 57 5.856 -13.298 42.835 1.00 28.92 C ATOM 2484 C LYS D 57 4.583 -12.453 42.942 1.00 27.32 C ATOM 2485 O LYS D 57 3.483 -12.937 42.704 1.00 21.75 O ATOM 2486 CB LYS D 57 6.289 -13.828 44.208 1.00 50.33 C ATOM 2487 CG LYS D 57 5.532 -15.074 44.676 1.00 71.76 C ATOM 2488 CD LYS D 57 6.024 -15.593 46.046 1.00 88.70 C ATOM 2489 CE LYS D 57 7.490 -16.063 46.027 1.00 62.33 C ATOM 2490 NZ LYS D 57 7.730 -17.200 45.096 1.00 73.06 N ATOM 2491 N ALA D 58 4.743 -11.178 43.282 1.00 25.49 N ATOM 2492 CA ALA D 58 3.604 -10.279 43.394 1.00 20.34 C ATOM 2493 C ALA D 58 2.999 -10.035 42.013 1.00 18.08 C ATOM 2494 O ALA D 58 1.786 -9.952 41.865 1.00 22.96 O ATOM 2495 CB ALA D 58 4.035 -8.968 44.030 1.00 18.05 C ATOM 2496 N MET D 59 3.851 -9.916 41.003 1.00 22.06 N ATOM 2497 CA MET D 59 3.379 -9.718 39.643 1.00 15.47 C ATOM 2498 C MET D 59 2.680 -11.020 39.218 1.00 34.59 C ATOM 2499 O MET D 59 1.751 -11.014 38.393 1.00 17.64 O ATOM 2500 CB MET D 59 4.562 -9.413 38.720 1.00 23.19 C ATOM 2501 CG MET D 59 4.168 -8.939 37.309 1.00 19.23 C ATOM 2502 SD MET D 59 3.098 -7.477 37.306 1.00 43.12 S ATOM 2503 CE MET D 59 4.331 -6.138 37.477 1.00 24.99 C ATOM 2504 N GLY D 60 3.134 -12.139 39.787 1.00 18.50 N ATOM 2505 CA GLY D 60 2.507 -13.417 39.490 1.00 21.58 C ATOM 2506 C GLY D 60 1.036 -13.352 39.880 1.00 29.97 C ATOM 2507 O GLY D 60 0.142 -13.745 39.127 1.00 20.62 O ATOM 2508 N ILE D 61 0.797 -12.836 41.079 1.00 27.36 N ATOM 2509 CA ILE D 61 -0.541 -12.667 41.608 1.00 23.51 C ATOM 2510 C ILE D 61 -1.340 -11.666 40.773 1.00 30.28 C ATOM 2511 O ILE D 61 -2.470 -11.951 40.351 1.00 15.11 O ATOM 2512 CB ILE D 61 -0.469 -12.170 43.055 1.00 14.52 C ATOM 2513 CG1 ILE D 61 0.027 -13.299 43.948 1.00 20.01 C ATOM 2514 CG2 ILE D 61 -1.830 -11.689 43.527 1.00 18.78 C ATOM 2515 CD1 ILE D 61 0.217 -12.868 45.371 1.00 45.18 C ATOM 2516 N MET D 62 -0.748 -10.496 40.538 1.00 23.45 N ATOM 2517 CA MET D 62 -1.406 -9.454 39.768 1.00 24.68 C ATOM 2518 C MET D 62 -1.859 -9.953 38.416 1.00 32.95 C ATOM 2519 O MET D 62 -2.911 -9.534 37.914 1.00 26.16 O ATOM 2520 CB MET D 62 -0.490 -8.251 39.585 1.00 31.13 C ATOM 2521 CG MET D 62 -0.230 -7.474 40.868 1.00 47.60 C ATOM 2522 SD MET D 62 -1.747 -6.986 41.708 1.00 31.07 S ATOM 2523 CE MET D 62 -2.592 -6.086 40.418 1.00 10.86 C ATOM 2524 N ASN D 63 -1.085 -10.856 37.820 1.00 32.51 N ATOM 2525 CA ASN D 63 -1.478 -11.374 36.518 1.00 35.15 C ATOM 2526 C ASN D 63 -2.720 -12.232 36.655 1.00 38.46 C ATOM 2527 O ASN D 63 -3.648 -12.135 35.850 1.00 27.54 O ATOM 2528 CB ASN D 63 -0.348 -12.168 35.885 1.00 27.81 C ATOM 2529 CG ASN D 63 0.257 -11.445 34.704 1.00 45.65 C ATOM 2530 OD1 ASN D 63 1.050 -10.524 34.874 1.00 42.92 O ATOM 2531 ND2 ASN D 63 -0.138 -11.841 33.494 1.00 48.70 N ATOM 2532 N SER D 64 -2.737 -13.056 37.697 1.00 32.99 N ATOM 2533 CA SER D 64 -3.866 -13.929 37.972 1.00 33.57 C ATOM 2534 C SER D 64 -5.120 -13.096 38.182 1.00 36.11 C ATOM 2535 O SER D 64 -6.214 -13.468 37.761 1.00 35.54 O ATOM 2536 CB SER D 64 -3.593 -14.756 39.227 1.00 26.71 C ATOM 2537 OG SER D 64 -2.455 -15.586 39.063 1.00 43.86 O ATOM 2538 N PHE D 65 -4.945 -11.961 38.842 1.00 35.92 N ATOM 2539 CA PHE D 65 -6.052 -11.071 39.126 1.00 20.22 C ATOM 2540 C PHE D 65 -6.696 -10.579 37.849 1.00 31.47 C ATOM 2541 O PHE D 65 -7.906 -10.713 37.664 1.00 35.87 O ATOM 2542 CB PHE D 65 -5.567 -9.880 39.944 1.00 21.97 C ATOM 2543 CG PHE D 65 -6.630 -8.861 40.207 1.00 34.14 C ATOM 2544 CD1 PHE D 65 -7.797 -9.214 40.877 1.00 24.35 C ATOM 2545 CD2 PHE D 65 -6.480 -7.550 39.762 1.00 20.98 C ATOM 2546 CE1 PHE D 65 -8.796 -8.277 41.095 1.00 27.26 C ATOM 2547 CE2 PHE D 65 -7.479 -6.608 39.977 1.00 22.61 C ATOM 2548 CZ PHE D 65 -8.637 -6.970 40.642 1.00 19.46 C ATOM 2549 N VAL D 66 -5.884 -10.003 36.969 1.00 32.13 N ATOM 2550 CA VAL D 66 -6.387 -9.478 35.702 1.00 25.03 C ATOM 2551 C VAL D 66 -7.098 -10.562 34.893 1.00 26.52 C ATOM 2552 O VAL D 66 -8.219 -10.364 34.421 1.00 29.39 O ATOM 2553 CB VAL D 66 -5.241 -8.889 34.853 1.00 24.36 C ATOM 2554 CG1 VAL D 66 -5.796 -8.288 33.573 1.00 13.86 C ATOM 2555 CG2 VAL D 66 -4.493 -7.836 35.656 1.00 26.56 C ATOM 2556 N ASN D 67 -6.445 -11.708 34.735 1.00 25.68 N ATOM 2557 CA ASN D 67 -7.034 -12.806 33.982 1.00 30.30 C ATOM 2558 C ASN D 67 -8.344 -13.214 34.620 1.00 29.09 C ATOM 2559 O ASN D 67 -9.329 -13.470 33.929 1.00 23.01 O ATOM 2560 CB ASN D 67 -6.076 -13.993 33.933 1.00 20.26 C ATOM 2561 CG ASN D 67 -4.851 -13.705 33.093 1.00 36.39 C ATOM 2562 OD1 ASN D 67 -4.955 -13.458 31.898 1.00 39.80 O ATOM 2563 ND2 ASN D 67 -3.683 -13.722 33.718 1.00 64.21 N ATOM 2564 N ASP D 68 -8.361 -13.252 35.944 1.00 27.87 N ATOM 2565 CA ASP D 68 -9.566 -13.618 36.662 1.00 28.72 C ATOM 2566 C ASP D 68 -10.724 -12.696 36.293 1.00 25.96 C ATOM 2567 O ASP D 68 -11.706 -13.129 35.694 1.00 24.27 O ATOM 2568 CB ASP D 68 -9.329 -13.549 38.167 1.00 37.36 C ATOM 2569 CG ASP D 68 -10.484 -14.121 38.964 1.00 39.15 C ATOM 2570 OD1 ASP D 68 -11.622 -14.154 38.448 1.00 48.74 O ATOM 2571 OD2 ASP D 68 -10.259 -14.530 40.119 1.00 56.37 O ATOM 2572 N ILE D 69 -10.605 -11.422 36.648 1.00 24.21 N ATOM 2573 CA ILE D 69 -11.664 -10.457 36.372 1.00 31.88 C ATOM 2574 C ILE D 69 -12.020 -10.377 34.887 1.00 30.48 C ATOM 2575 O ILE D 69 -13.193 -10.238 34.528 1.00 26.18 O ATOM 2576 CB ILE D 69 -11.294 -9.053 36.939 1.00 22.98 C ATOM 2577 CG1 ILE D 69 -11.508 -9.042 38.454 1.00 22.35 C ATOM 2578 CG2 ILE D 69 -12.179 -7.971 36.340 1.00 24.50 C ATOM 2579 CD1 ILE D 69 -10.707 -10.053 39.193 1.00 29.58 C ATOM 2580 N PHE D 70 -11.024 -10.475 34.018 1.00 24.80 N ATOM 2581 CA PHE D 70 -11.309 -10.443 32.594 1.00 29.63 C ATOM 2582 C PHE D 70 -12.331 -11.547 32.320 1.00 38.52 C ATOM 2583 O PHE D 70 -13.399 -11.296 31.751 1.00 32.82 O ATOM 2584 CB PHE D 70 -10.027 -10.689 31.797 1.00 28.77 C ATOM 2585 CG PHE D 70 -10.228 -10.726 30.307 1.00 43.01 C ATOM 2586 CD1 PHE D 70 -9.517 -9.870 29.480 1.00 56.67 C ATOM 2587 CD2 PHE D 70 -11.092 -11.647 29.722 1.00 44.84 C ATOM 2588 CE1 PHE D 70 -9.662 -9.934 28.092 1.00 56.67 C ATOM 2589 CE2 PHE D 70 -11.242 -11.718 28.342 1.00 47.15 C ATOM 2590 CZ PHE D 70 -10.527 -10.861 27.525 1.00 44.06 C ATOM 2591 N GLU D 71 -12.008 -12.767 32.748 1.00 32.77 N ATOM 2592 CA GLU D 71 -12.891 -13.907 32.541 1.00 24.93 C ATOM 2593 C GLU D 71 -14.273 -13.756 33.170 1.00 22.57 C ATOM 2594 O GLU D 71 -15.281 -14.096 32.552 1.00 36.84 O ATOM 2595 CB GLU D 71 -12.232 -15.186 33.050 1.00 38.42 C ATOM 2596 CG GLU D 71 -11.923 -16.179 31.949 1.00 56.77 C ATOM 2597 CD GLU D 71 -13.118 -16.412 31.026 1.00 87.06 C ATOM 2598 OE1 GLU D 71 -14.216 -16.768 31.519 1.00 80.43 O ATOM 2599 OE2 GLU D 71 -12.957 -16.238 29.801 1.00 86.43 O ATOM 2600 N ARG D 72 -14.328 -13.259 34.398 1.00 20.71 N ATOM 2601 CA ARG D 72 -15.613 -13.065 35.064 1.00 26.53 C ATOM 2602 C ARG D 72 -16.518 -12.144 34.237 1.00 38.88 C ATOM 2603 O ARG D 72 -17.676 -12.473 33.954 1.00 35.02 O ATOM 2604 CB ARG D 72 -15.410 -12.446 36.446 1.00 10.86 C ATOM 2605 CG ARG D 72 -14.518 -13.246 37.366 1.00 17.27 C ATOM 2606 CD ARG D 72 -14.836 -12.937 38.814 1.00 10.86 C ATOM 2607 NE ARG D 72 -13.827 -13.448 39.728 1.00 12.32 N ATOM 2608 CZ ARG D 72 -13.748 -13.086 41.003 1.00 37.74 C ATOM 2609 NH1 ARG D 72 -14.627 -12.220 41.484 1.00 26.31 N ATOM 2610 NH2 ARG D 72 -12.790 -13.567 41.791 1.00 26.58 N ATOM 2611 N ILE D 73 -15.973 -10.991 33.858 1.00 33.49 N ATOM 2612 CA ILE D 73 -16.692 -9.988 33.076 1.00 37.02 C ATOM 2613 C ILE D 73 -17.071 -10.468 31.676 1.00 36.44 C ATOM 2614 O ILE D 73 -18.237 -10.393 31.273 1.00 25.31 O ATOM 2615 CB ILE D 73 -15.851 -8.686 32.977 1.00 24.90 C ATOM 2616 CG1 ILE D 73 -15.906 -7.950 34.322 1.00 32.07 C ATOM 2617 CG2 ILE D 73 -16.340 -7.820 31.838 1.00 10.86 C ATOM 2618 CD1 ILE D 73 -14.872 -6.867 34.489 1.00 16.98 C ATOM 2619 N ALA D 74 -16.087 -10.961 30.936 1.00 28.52 N ATOM 2620 CA ALA D 74 -16.348 -11.440 29.587 1.00 32.89 C ATOM 2621 C ALA D 74 -17.423 -12.508 29.644 1.00 30.56 C ATOM 2622 O ALA D 74 -18.274 -12.596 28.763 1.00 27.20 O ATOM 2623 CB ALA D 74 -15.081 -12.009 28.984 1.00 18.64 C ATOM 2624 N GLY D 75 -17.369 -13.311 30.701 1.00 27.07 N ATOM 2625 CA GLY D 75 -18.320 -14.383 30.878 1.00 13.73 C ATOM 2626 C GLY D 75 -19.742 -13.906 31.064 1.00 28.05 C ATOM 2627 O GLY D 75 -20.639 -14.317 30.331 1.00 22.43 O ATOM 2628 N GLU D 76 -19.959 -13.042 32.050 1.00 33.57 N ATOM 2629 CA GLU D 76 -21.298 -12.543 32.301 1.00 34.53 C ATOM 2630 C GLU D 76 -21.776 -11.784 31.066 1.00 41.29 C ATOM 2631 O GLU D 76 -22.965 -11.797 30.750 1.00 49.67 O ATOM 2632 CB GLU D 76 -21.312 -11.645 33.542 1.00 31.81 C ATOM 2633 CG GLU D 76 -22.713 -11.344 34.093 1.00 41.25 C ATOM 2634 CD GLU D 76 -23.494 -12.604 34.457 1.00 63.13 C ATOM 2635 OE1 GLU D 76 -24.388 -13.009 33.681 1.00 61.72 O ATOM 2636 OE2 GLU D 76 -23.207 -13.198 35.519 1.00 66.94 O ATOM 2637 N ALA D 77 -20.851 -11.135 30.362 1.00 33.64 N ATOM 2638 CA ALA D 77 -21.203 -10.395 29.153 1.00 41.71 C ATOM 2639 C ALA D 77 -21.670 -11.380 28.093 1.00 45.77 C ATOM 2640 O ALA D 77 -22.681 -11.168 27.416 1.00 50.80 O ATOM 2641 CB ALA D 77 -20.009 -9.636 28.636 1.00 42.61 C ATOM 2642 N SER D 78 -20.910 -12.455 27.948 1.00 38.04 N ATOM 2643 CA SER D 78 -21.220 -13.490 26.981 1.00 35.56 C ATOM 2644 C SER D 78 -22.629 -14.017 27.219 1.00 38.70 C ATOM 2645 O SER D 78 -23.426 -14.164 26.292 1.00 44.44 O ATOM 2646 CB SER D 78 -20.205 -14.618 27.120 1.00 13.59 C ATOM 2647 OG SER D 78 -20.676 -15.793 26.487 1.00 52.18 O ATOM 2648 N ARG D 79 -22.909 -14.280 28.487 1.00 45.27 N ATOM 2649 CA ARG D 79 -24.182 -14.805 28.974 1.00 39.66 C ATOM 2650 C ARG D 79 -25.327 -13.815 28.755 1.00 38.29 C ATOM 2651 O ARG D 79 -26.406 -14.175 28.297 1.00 32.28 O ATOM 2652 CB ARG D 79 -24.026 -15.075 30.466 1.00 31.95 C ATOM 2653 CG ARG D 79 -24.559 -16.376 30.952 1.00 26.82 C ATOM 2654 CD ARG D 79 -24.117 -16.570 32.373 1.00 34.30 C ATOM 2655 NE ARG D 79 -22.663 -16.646 32.439 1.00 48.72 N ATOM 2656 CZ ARG D 79 -21.939 -16.081 33.398 1.00 59.44 C ATOM 2657 NH1 ARG D 79 -22.549 -15.398 34.363 1.00 52.08 N ATOM 2658 NH2 ARG D 79 -20.612 -16.199 33.393 1.00 24.45 N ATOM 2659 N LEU D 80 -25.068 -12.565 29.117 1.00 43.23 N ATOM 2660 CA LEU D 80 -26.022 -11.468 28.993 1.00 43.98 C ATOM 2661 C LEU D 80 -26.466 -11.269 27.536 1.00 43.49 C ATOM 2662 O LEU D 80 -27.634 -10.999 27.257 1.00 39.24 O ATOM 2663 CB LEU D 80 -25.370 -10.185 29.528 1.00 30.82 C ATOM 2664 CG LEU D 80 -26.245 -9.127 30.191 1.00 34.74 C ATOM 2665 CD1 LEU D 80 -27.193 -9.774 31.166 1.00 43.08 C ATOM 2666 CD2 LEU D 80 -25.365 -8.148 30.910 1.00 36.00 C ATOM 2667 N ALA D 81 -25.531 -11.393 26.607 1.00 29.35 N ATOM 2668 CA ALA D 81 -25.875 -11.225 25.209 1.00 42.00 C ATOM 2669 C ALA D 81 -26.748 -12.394 24.766 1.00 45.74 C ATOM 2670 O ALA D 81 -27.756 -12.222 24.087 1.00 51.26 O ATOM 2671 CB ALA D 81 -24.609 -11.156 24.361 1.00 36.55 C ATOM 2672 N HIS D 82 -26.356 -13.593 25.163 1.00 49.08 N ATOM 2673 CA HIS D 82 -27.107 -14.769 24.786 1.00 38.85 C ATOM 2674 C HIS D 82 -28.561 -14.583 25.205 1.00 36.62 C ATOM 2675 O HIS D 82 -29.458 -14.731 24.380 1.00 52.01 O ATOM 2676 CB HIS D 82 -26.500 -15.997 25.454 1.00 41.17 C ATOM 2677 CG HIS D 82 -27.165 -17.284 25.082 1.00 65.77 C ATOM 2678 ND1 HIS D 82 -27.439 -18.271 26.008 1.00 78.76 N ATOM 2679 CD2 HIS D 82 -27.569 -17.768 23.885 1.00 68.00 C ATOM 2680 CE1 HIS D 82 -27.983 -19.307 25.395 1.00 76.28 C ATOM 2681 NE2 HIS D 82 -28.072 -19.028 24.106 1.00 86.23 N ATOM 2682 N TYR D 83 -28.789 -14.229 26.469 1.00 32.97 N ATOM 2683 CA TYR D 83 -30.148 -14.044 26.991 1.00 30.58 C ATOM 2684 C TYR D 83 -30.980 -13.092 26.163 1.00 30.24 C ATOM 2685 O TYR D 83 -32.179 -13.283 26.001 1.00 34.10 O ATOM 2686 CB TYR D 83 -30.145 -13.494 28.419 1.00 28.80 C ATOM 2687 CG TYR D 83 -29.341 -14.274 29.429 1.00 65.35 C ATOM 2688 CD1 TYR D 83 -29.072 -15.634 29.259 1.00 58.84 C ATOM 2689 CD2 TYR D 83 -28.879 -13.653 30.585 1.00 71.80 C ATOM 2690 CE1 TYR D 83 -28.362 -16.349 30.221 1.00 60.95 C ATOM 2691 CE2 TYR D 83 -28.173 -14.359 31.550 1.00 76.51 C ATOM 2692 CZ TYR D 83 -27.918 -15.701 31.368 1.00 53.26 C ATOM 2693 OH TYR D 83 -27.228 -16.386 32.347 1.00 56.73 O ATOM 2694 N ASN D 84 -30.350 -12.047 25.652 1.00 39.85 N ATOM 2695 CA ASN D 84 -31.077 -11.071 24.866 1.00 42.03 C ATOM 2696 C ASN D 84 -30.946 -11.302 23.377 1.00 47.37 C ATOM 2697 O ASN D 84 -30.958 -10.364 22.585 1.00 49.93 O ATOM 2698 CB ASN D 84 -30.613 -9.681 25.254 1.00 19.97 C ATOM 2699 CG ASN D 84 -30.971 -9.353 26.679 1.00 40.48 C ATOM 2700 OD1 ASN D 84 -32.118 -9.019 26.982 1.00 56.15 O ATOM 2701 ND2 ASN D 84 -30.001 -9.476 27.573 1.00 45.03 N