>>3BNF:HELIX   26  26 ALA A  406  TYR A  435  1                                  30    
APEEVLRLLASGNEEAQKARIKLVKVLAKY
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 26 26 ALA A 406 TYR A 435 1 30 ATOM 2989 N ALA A 406 8.168 59.858 23.428 1.00 23.77 N ATOM 2990 CA ALA A 406 7.296 60.895 22.837 1.00 24.32 C ATOM 2991 C ALA A 406 6.405 60.324 21.749 1.00 24.32 C ATOM 2992 O ALA A 406 6.575 60.650 20.544 1.00 25.11 O ATOM 2993 CB ALA A 406 8.130 62.044 22.288 1.00 22.81 C ATOM 2994 N PRO A 407 5.470 59.459 22.153 1.00 24.46 N ATOM 2995 CA PRO A 407 4.678 58.658 21.227 1.00 23.62 C ATOM 2996 C PRO A 407 3.882 59.501 20.264 1.00 23.60 C ATOM 2997 O PRO A 407 3.824 59.222 19.096 1.00 22.89 O ATOM 2998 CB PRO A 407 3.705 57.938 22.178 1.00 23.79 C ATOM 2999 CG PRO A 407 4.490 57.857 23.465 1.00 26.80 C ATOM 3000 CD PRO A 407 5.106 59.161 23.566 1.00 25.53 C ATOM 3001 N GLU A 408 3.257 60.557 20.768 1.00 22.74 N ATOM 3002 CA GLU A 408 2.442 61.396 19.878 1.00 22.55 C ATOM 3003 C GLU A 408 3.258 62.150 18.849 1.00 22.66 C ATOM 3004 O GLU A 408 2.836 62.237 17.696 1.00 24.10 O ATOM 3005 CB GLU A 408 1.468 62.263 20.698 1.00 23.08 C ATOM 3006 CG GLU A 408 0.492 61.381 21.357 1.00 20.32 C ATOM 3007 CD GLU A 408 -0.276 62.016 22.489 1.00 24.05 C ATOM 3008 OE1 GLU A 408 -0.754 63.169 22.413 1.00 23.09 O ATOM 3009 OE2 GLU A 408 -0.459 61.318 23.476 1.00 20.87 O ATOM 3010 N GLU A 409 4.421 62.689 19.239 1.00 24.16 N ATOM 3011 CA GLU A 409 5.285 63.364 18.278 1.00 23.51 C ATOM 3012 C GLU A 409 5.778 62.386 17.237 1.00 24.53 C ATOM 3013 O GLU A 409 5.794 62.741 16.032 1.00 23.50 O ATOM 3014 CB GLU A 409 6.460 64.100 18.930 1.00 24.84 C ATOM 3015 CG GLU A 409 7.354 64.814 17.933 1.00 26.82 C ATOM 3016 CD GLU A 409 6.683 65.976 17.160 1.00 33.22 C ATOM 3017 OE1 GLU A 409 5.502 66.307 17.383 1.00 33.47 O ATOM 3018 OE2 GLU A 409 7.385 66.599 16.333 1.00 37.28 O ATOM 3019 N VAL A 410 6.113 61.160 17.687 1.00 24.47 N ATOM 3020 CA VAL A 410 6.591 60.087 16.796 1.00 24.60 C ATOM 3021 C VAL A 410 5.566 59.798 15.709 1.00 22.92 C ATOM 3022 O VAL A 410 5.884 59.841 14.534 1.00 23.07 O ATOM 3023 CB VAL A 410 7.050 58.784 17.538 1.00 24.40 C ATOM 3024 CG1 VAL A 410 7.155 57.575 16.592 1.00 28.07 C ATOM 3025 CG2 VAL A 410 8.427 59.049 18.140 1.00 24.55 C ATOM 3026 N LEU A 411 4.347 59.481 16.100 1.00 23.36 N ATOM 3027 CA LEU A 411 3.262 59.239 15.106 1.00 23.06 C ATOM 3028 C LEU A 411 3.037 60.455 14.221 1.00 22.54 C ATOM 3029 O LEU A 411 2.897 60.334 13.008 1.00 22.60 O ATOM 3030 CB LEU A 411 1.967 58.845 15.796 1.00 22.29 C ATOM 3031 CG LEU A 411 2.063 57.627 16.756 1.00 19.90 C ATOM 3032 CD1 LEU A 411 0.752 57.536 17.548 1.00 20.30 C ATOM 3033 CD2 LEU A 411 2.422 56.316 16.033 1.00 21.30 C ATOM 3034 N ARG A 412 3.005 61.643 14.803 1.00 24.43 N ATOM 3035 CA ARG A 412 2.761 62.847 13.973 1.00 23.93 C ATOM 3036 C ARG A 412 3.859 62.998 12.891 1.00 23.92 C ATOM 3037 O ARG A 412 3.568 63.309 11.682 1.00 21.82 O ATOM 3038 CB ARG A 412 2.554 64.116 14.851 1.00 25.65 C ATOM 3039 CG ARG A 412 2.143 65.401 14.075 1.00 25.30 C ATOM 3040 CD ARG A 412 2.593 66.699 14.775 1.00 27.04 C ATOM 3041 NE ARG A 412 4.045 66.785 14.720 1.00 32.21 N ATOM 3042 CZ ARG A 412 4.761 67.168 13.657 1.00 33.37 C ATOM 3043 NH1 ARG A 412 4.180 67.585 12.515 1.00 33.27 N ATOM 3044 NH2 ARG A 412 6.081 67.156 13.753 1.00 31.15 N ATOM 3045 N LEU A 413 5.113 62.727 13.283 1.00 22.69 N ATOM 3046 CA LEU A 413 6.260 62.826 12.353 1.00 22.56 C ATOM 3047 C LEU A 413 6.200 61.814 11.211 1.00 22.79 C ATOM 3048 O LEU A 413 6.481 62.126 10.059 1.00 22.08 O ATOM 3049 CB LEU A 413 7.608 62.675 13.103 1.00 21.74 C ATOM 3050 CG LEU A 413 8.032 63.845 13.982 1.00 23.56 C ATOM 3051 CD1 LEU A 413 9.299 63.460 14.863 1.00 26.23 C ATOM 3052 CD2 LEU A 413 8.295 65.089 13.082 1.00 24.96 C ATOM 3053 N LEU A 414 5.822 60.592 11.545 1.00 22.30 N ATOM 3054 CA LEU A 414 5.808 59.499 10.578 1.00 22.33 C ATOM 3055 C LEU A 414 4.651 59.762 9.598 1.00 22.76 C ATOM 3056 O LEU A 414 4.759 59.559 8.369 1.00 23.13 O ATOM 3057 CB LEU A 414 5.579 58.191 11.318 1.00 22.16 C ATOM 3058 CG LEU A 414 6.823 57.605 11.959 1.00 25.01 C ATOM 3059 CD1 LEU A 414 6.357 56.499 12.912 1.00 21.69 C ATOM 3060 CD2 LEU A 414 7.897 57.180 10.847 1.00 21.40 C ATOM 3061 N ALA A 415 3.548 60.223 10.151 1.00 22.13 N ATOM 3062 CA ALA A 415 2.391 60.618 9.317 1.00 21.45 C ATOM 3063 C ALA A 415 2.796 61.804 8.429 1.00 21.03 C ATOM 3064 O ALA A 415 2.437 61.862 7.241 1.00 22.11 O ATOM 3065 CB ALA A 415 1.183 60.983 10.215 1.00 20.70 C ATOM 3066 N SER A 416 3.535 62.773 8.956 1.00 21.03 N ATOM 3067 CA SER A 416 4.018 63.947 8.169 1.00 20.76 C ATOM 3068 C SER A 416 5.006 63.545 7.068 1.00 21.41 C ATOM 3069 O SER A 416 4.908 63.980 5.914 1.00 22.79 O ATOM 3070 CB SER A 416 4.608 65.044 9.072 1.00 21.20 C ATOM 3071 OG SER A 416 5.062 66.152 8.283 1.00 23.31 O ATOM 3072 N GLY A 417 5.936 62.693 7.416 1.00 21.64 N ATOM 3073 CA GLY A 417 6.887 62.076 6.468 1.00 21.70 C ATOM 3074 C GLY A 417 6.216 61.375 5.291 1.00 23.28 C ATOM 3075 O GLY A 417 6.482 61.673 4.109 1.00 21.10 O ATOM 3076 N ASN A 418 5.281 60.508 5.627 1.00 21.93 N ATOM 3077 CA ASN A 418 4.598 59.733 4.635 1.00 23.01 C ATOM 3078 C ASN A 418 3.858 60.686 3.687 1.00 23.18 C ATOM 3079 O ASN A 418 3.981 60.554 2.467 1.00 23.46 O ATOM 3080 CB ASN A 418 3.626 58.770 5.288 1.00 22.53 C ATOM 3081 CG ASN A 418 2.974 57.867 4.259 1.00 24.34 C ATOM 3082 OD1 ASN A 418 3.654 57.161 3.531 1.00 21.65 O ATOM 3083 ND2 ASN A 418 1.664 57.933 4.165 1.00 20.67 N ATOM 3084 N GLU A 419 3.199 61.696 4.251 1.00 23.44 N ATOM 3085 CA GLU A 419 2.524 62.708 3.425 1.00 23.44 C ATOM 3086 C GLU A 419 3.473 63.407 2.451 1.00 22.58 C ATOM 3087 O GLU A 419 3.109 63.621 1.309 1.00 22.02 O ATOM 3088 CB GLU A 419 1.741 63.718 4.273 1.00 25.40 C ATOM 3089 CG GLU A 419 1.132 64.921 3.461 1.00 23.24 C ATOM 3090 CD GLU A 419 0.074 64.492 2.412 1.00 26.24 C ATOM 3091 OE1 GLU A 419 -0.147 63.293 2.311 1.00 25.12 O ATOM 3092 OE2 GLU A 419 -0.520 65.362 1.670 1.00 28.38 O ATOM 3093 N GLU A 420 4.692 63.741 2.880 1.00 21.68 N ATOM 3094 CA GLU A 420 5.663 64.327 1.945 1.00 22.85 C ATOM 3095 C GLU A 420 5.999 63.297 0.871 1.00 22.46 C ATOM 3096 O GLU A 420 6.164 63.668 -0.277 1.00 23.22 O ATOM 3097 CB GLU A 420 6.914 64.848 2.629 1.00 22.90 C ATOM 3098 CG GLU A 420 6.647 66.145 3.385 1.00 24.46 C ATOM 3099 CD GLU A 420 6.457 67.306 2.411 1.00 27.27 C ATOM 3100 OE1 GLU A 420 7.304 67.506 1.536 1.00 29.88 O ATOM 3101 OE2 GLU A 420 5.447 67.995 2.502 1.00 29.26 O ATOM 3102 N ALA A 421 6.057 62.026 1.253 1.00 24.45 N ATOM 3103 CA ALA A 421 6.550 60.945 0.354 1.00 23.56 C ATOM 3104 C ALA A 421 5.467 60.709 -0.666 1.00 23.31 C ATOM 3105 O ALA A 421 5.743 60.657 -1.872 1.00 24.06 O ATOM 3106 CB ALA A 421 6.850 59.641 1.127 1.00 25.14 C ATOM 3107 N GLN A 422 4.222 60.692 -0.210 1.00 24.52 N ATOM 3108 CA GLN A 422 3.073 60.580 -1.114 1.00 23.86 C ATOM 3109 C GLN A 422 2.919 61.751 -2.077 1.00 24.35 C ATOM 3110 O GLN A 422 2.714 61.536 -3.289 1.00 23.17 O ATOM 3111 CB GLN A 422 1.808 60.323 -0.307 1.00 25.21 C ATOM 3112 CG GLN A 422 1.810 58.932 0.360 1.00 23.84 C ATOM 3113 CD GLN A 422 1.706 57.778 -0.659 1.00 26.75 C ATOM 3114 OE1 GLN A 422 0.781 56.949 -0.581 1.00 29.68 O ATOM 3115 NE2 GLN A 422 2.684 57.675 -1.553 1.00 27.51 N ATOM 3116 N LYS A 423 3.146 62.975 -1.594 1.00 22.84 N ATOM 3117 CA LYS A 423 3.148 64.100 -2.514 1.00 22.37 C ATOM 3118 C LYS A 423 4.217 63.938 -3.575 1.00 21.82 C ATOM 3119 O LYS A 423 3.997 64.295 -4.733 1.00 22.87 O ATOM 3120 CB LYS A 423 3.458 65.376 -1.765 1.00 24.32 C ATOM 3121 CG LYS A 423 2.317 65.887 -0.955 1.00 23.71 C ATOM 3122 CD LYS A 423 2.814 67.038 -0.122 1.00 28.40 C ATOM 3123 CE LYS A 423 1.909 68.241 -0.264 1.00 37.96 C ATOM 3124 NZ LYS A 423 2.314 69.310 0.721 1.00 39.76 N ATOM 3125 N ALA A 424 5.386 63.420 -3.168 1.00 21.46 N ATOM 3126 CA ALA A 424 6.469 63.091 -4.110 1.00 21.04 C ATOM 3127 C ALA A 424 5.976 62.097 -5.172 1.00 20.93 C ATOM 3128 O ALA A 424 6.166 62.306 -6.363 1.00 20.89 O ATOM 3129 CB ALA A 424 7.673 62.535 -3.366 1.00 20.63 C ATOM 3130 N ARG A 425 5.324 61.034 -4.736 1.00 20.08 N ATOM 3131 CA ARG A 425 4.891 59.984 -5.652 1.00 21.00 C ATOM 3132 C ARG A 425 3.819 60.390 -6.608 1.00 20.79 C ATOM 3133 O ARG A 425 3.834 59.903 -7.734 1.00 20.95 O ATOM 3134 CB ARG A 425 4.422 58.737 -4.882 1.00 20.67 C ATOM 3135 CG ARG A 425 5.560 58.180 -3.907 1.00 22.11 C ATOM 3136 CD ARG A 425 5.303 56.793 -3.436 1.00 21.82 C ATOM 3137 NE ARG A 425 5.142 55.881 -4.574 1.00 20.43 N ATOM 3138 CZ ARG A 425 4.192 54.945 -4.622 1.00 26.83 C ATOM 3139 NH1 ARG A 425 3.305 54.812 -3.621 1.00 25.57 N ATOM 3140 NH2 ARG A 425 4.095 54.150 -5.679 1.00 25.66 N ATOM 3141 N ILE A 426 2.880 61.236 -6.175 1.00 22.07 N ATOM 3142 CA ILE A 426 1.856 61.716 -7.097 1.00 21.92 C ATOM 3143 C ILE A 426 2.525 62.522 -8.244 1.00 21.47 C ATOM 3144 O ILE A 426 2.243 62.284 -9.418 1.00 21.41 O ATOM 3145 CB ILE A 426 0.777 62.500 -6.380 1.00 23.60 C ATOM 3146 CG1 ILE A 426 -0.007 61.551 -5.450 1.00 23.95 C ATOM 3147 CG2 ILE A 426 -0.175 63.214 -7.422 1.00 22.23 C ATOM 3148 CD1 ILE A 426 -0.848 62.192 -4.363 1.00 26.15 C ATOM 3149 N LYS A 427 3.424 63.443 -7.896 1.00 21.07 N ATOM 3150 CA LYS A 427 4.236 64.211 -8.862 1.00 21.74 C ATOM 3151 C LYS A 427 5.083 63.307 -9.730 1.00 21.20 C ATOM 3152 O LYS A 427 5.308 63.596 -10.918 1.00 23.33 O ATOM 3153 CB LYS A 427 5.162 65.207 -8.136 1.00 21.78 C ATOM 3154 CG LYS A 427 4.345 66.264 -7.402 1.00 23.88 C ATOM 3155 CD LYS A 427 5.148 67.423 -6.954 1.00 26.40 C ATOM 3156 CE LYS A 427 4.228 68.322 -6.158 1.00 32.15 C ATOM 3157 NZ LYS A 427 4.935 69.401 -5.389 1.00 34.52 N ATOM 3158 N LEU A 428 5.546 62.202 -9.179 1.00 22.26 N ATOM 3159 CA LEU A 428 6.423 61.266 -9.926 1.00 23.11 C ATOM 3160 C LEU A 428 5.645 60.564 -10.982 1.00 24.30 C ATOM 3161 O LEU A 428 6.181 60.302 -12.071 1.00 24.16 O ATOM 3162 CB LEU A 428 7.092 60.242 -8.973 1.00 22.61 C ATOM 3163 CG LEU A 428 8.435 60.798 -8.438 1.00 21.15 C ATOM 3164 CD1 LEU A 428 8.811 60.002 -7.219 1.00 18.25 C ATOM 3165 CD2 LEU A 428 9.634 60.849 -9.494 1.00 22.23 C ATOM 3166 N VAL A 429 4.358 60.281 -10.701 1.00 23.09 N ATOM 3167 CA VAL A 429 3.528 59.513 -11.650 1.00 25.92 C ATOM 3168 C VAL A 429 3.482 60.283 -12.957 1.00 26.53 C ATOM 3169 O VAL A 429 3.659 59.729 -14.050 1.00 26.09 O ATOM 3170 CB VAL A 429 2.076 59.259 -11.119 1.00 26.28 C ATOM 3171 CG1 VAL A 429 1.184 58.606 -12.223 1.00 27.55 C ATOM 3172 CG2 VAL A 429 2.096 58.420 -9.878 1.00 27.08 C ATOM 3173 N LYS A 430 3.296 61.577 -12.807 1.00 25.63 N ATOM 3174 CA LYS A 430 3.259 62.497 -13.931 1.00 26.25 C ATOM 3175 C LYS A 430 4.576 62.548 -14.692 1.00 24.36 C ATOM 3176 O LYS A 430 4.565 62.614 -15.920 1.00 23.63 O ATOM 3177 CB LYS A 430 2.911 63.894 -13.427 1.00 26.77 C ATOM 3178 CG LYS A 430 1.498 64.005 -12.892 1.00 32.57 C ATOM 3179 CD LYS A 430 1.262 65.464 -12.521 1.00 36.64 C ATOM 3180 CE LYS A 430 0.000 66.033 -13.129 1.00 38.73 C ATOM 3181 NZ LYS A 430 0.030 67.558 -13.303 1.00 38.48 N ATOM 3182 N VAL A 431 5.700 62.587 -13.974 1.00 22.87 N ATOM 3183 CA VAL A 431 7.011 62.664 -14.631 1.00 23.54 C ATOM 3184 C VAL A 431 7.246 61.348 -15.397 1.00 23.88 C ATOM 3185 O VAL A 431 7.676 61.345 -16.569 1.00 25.22 O ATOM 3186 CB VAL A 431 8.183 62.946 -13.650 1.00 22.88 C ATOM 3187 CG1 VAL A 431 9.544 62.788 -14.373 1.00 21.98 C ATOM 3188 CG2 VAL A 431 8.065 64.377 -13.038 1.00 23.13 C ATOM 3189 N LEU A 432 6.971 60.243 -14.737 1.00 24.24 N ATOM 3190 CA LEU A 432 7.042 58.935 -15.406 1.00 24.66 C ATOM 3191 C LEU A 432 6.112 58.920 -16.633 1.00 24.16 C ATOM 3192 O LEU A 432 6.525 58.465 -17.714 1.00 24.46 O ATOM 3193 CB LEU A 432 6.644 57.855 -14.434 1.00 24.93 C ATOM 3194 CG LEU A 432 7.686 57.609 -13.322 1.00 24.51 C ATOM 3195 CD1 LEU A 432 7.059 56.698 -12.273 1.00 26.61 C ATOM 3196 CD2 LEU A 432 8.962 56.973 -13.865 1.00 27.26 C ATOM 3197 N ALA A 433 4.887 59.426 -16.480 1.00 24.88 N ATOM 3198 CA ALA A 433 3.968 59.496 -17.638 1.00 23.42 C ATOM 3199 C ALA A 433 4.621 60.259 -18.780 1.00 25.68 C ATOM 3200 O ALA A 433 4.613 59.818 -19.955 1.00 25.08 O ATOM 3201 CB ALA A 433 2.624 60.097 -17.263 1.00 23.87 C ATOM 3202 N LYS A 434 5.222 61.393 -18.448 1.00 23.88 N ATOM 3203 CA LYS A 434 5.806 62.209 -19.485 1.00 25.78 C ATOM 3204 C LYS A 434 6.839 61.450 -20.309 1.00 25.58 C ATOM 3205 O LYS A 434 6.933 61.652 -21.520 1.00 26.25 O ATOM 3206 CB LYS A 434 6.401 63.483 -18.910 1.00 25.02 C ATOM 3207 CG LYS A 434 7.075 64.223 -19.999 1.00 26.41 C ATOM 3208 CD LYS A 434 7.782 65.451 -19.537 1.00 30.83 C ATOM 3209 CE LYS A 434 8.902 65.786 -20.533 1.00 35.27 C ATOM 3210 NZ LYS A 434 9.485 67.106 -20.252 1.00 36.45 N ATOM 3211 N TYR A 435 7.554 60.536 -19.658 1.00 26.35 N ATOM 3212 CA TYR A 435 8.581 59.724 -20.351 1.00 27.10 C ATOM 3213 C TYR A 435 8.153 58.299 -20.776 1.00 26.89 C ATOM 3214 O TYR A 435 9.007 57.468 -21.033 1.00 27.29 O ATOM 3215 CB TYR A 435 9.842 59.683 -19.500 1.00 27.37 C ATOM 3216 CG TYR A 435 10.491 61.025 -19.443 1.00 28.45 C ATOM 3217 CD1 TYR A 435 11.301 61.463 -20.508 1.00 29.88 C ATOM 3218 CD2 TYR A 435 10.213 61.904 -18.410 1.00 28.54 C ATOM 3219 CE1 TYR A 435 11.892 62.711 -20.483 1.00 31.38 C ATOM 3220 CE2 TYR A 435 10.787 63.191 -18.387 1.00 29.64 C ATOM 3221 CZ TYR A 435 11.623 63.575 -19.424 1.00 28.35 C ATOM 3222 OH TYR A 435 12.182 64.824 -19.467 1.00 29.46 O